2DYBA

The crystal structure of human p40(phox)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
322
structure length
297
Chain Sequence
AESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Full-length p40phox structure suggests a basis for regulation mechanism of its membrane binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Neutrophil cytosol factor 4
total genus 64
structure length 297
sequence length 322
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00564 PB1 PB1 domain
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dybA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dybA03
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2dybA01
1U06A 3WA0A 3OJ4B 1V9JA 2F2XA 2M4NA 1NYFA 4MSMB 2EYWA 2FRYA 3PVLA 1OCUA 3A9KB 2O2OA 2J6FA 3AI5A 1TGZB 2CUDA 1GUAB 3O65B 4WWOA 3L10B 3VS0A 1AWJA 1WM2A 2KWCA 2EVRA 2M0XA 1AWXA 1ZGUB 5C23A 5CTRC 2KNBA 2BGFA 4EZKA 5J18A 1KMDA 2DYOA 3M95A 3ZDMC 4G50A 3I35A 4N9F4 3SU8X 2LWPA 2DL7A 4GXBA 4CC7A 3ZNZB 4IKBB 3QWXX 1S1NA 4RTTA 3CF6E 2V6VA 2G45B 4TKNA 2JS2A 1OOTA 2ZCCA 4RTXA 4JPBW 2LVPA 2DBKA 1T3LA 3H6NA 1WFYA 1RLPC 4FADA 1RAXA 2RGFA 4M8MA 3LDZE 4I6NB 4MDKE 3VS7A 5JH5C 2NS5A 4LUEA 3VAWA 4JGHB 1G2BA 3QC8B 1OTRB 4GIVA 1GD5A 1WGHA 3SD5A 1KM7A 1TTNA 3PV1A 2A5UA 3VFKA 4WJNA 1PRMC 3V6EB 1WGDA 1GFDA 3T8MA 1BT0A 2FCNA 1V86A 1XOVA 4B95A 5TR5A 2W10A 3N30A 4IM3A 4NY0A 3R7QA 2GOWA 2DYMA 1V1CA 2JZZA 2N9XA 2DAJA 4FSSA 2KX0A 1GJZA 1WX8A 2NCNA 1L2NA 3HPBA 1E7UA 3IHPC 4AKVA 1H6HA 3FJ5A 1KSWA 4ON3A 4W9HA 2ZNVB 2REAA 5J17A 1CSKA 2LQWA 2DF6A 1WX9A 2N4FA 4W9EA 1S3SG 2NBWB 2LUEA 4KIKA 2PEAA 5C1ZA 1K8RB 4W9CA 3H7PB 4RM8A 1WR6E 1P9DU 3A98A 3UF4A 2J05A 1BBZA 2HEQA 3NOBA 1AD5A 2CU1A 1JO8A 2BTTA 2G4DB 2KVRA 3HIZA 1E7OA 2CDTA 3REBB 2KN5A 1TG0A 1KJTA 5KHQA 4K1RB 4A20A 2IO1B 1EUVB 3TMPB 3KVFB 4DK5A 4LUDA 3AXCA 1VYVA 1KIKA 2JM8A 4E74A 2ASQA 4KDLB 2AEHA 2CHWA 4ANVA 2DYBA 4WJOA 4ANUA 2LZ6A 3C0CA 4G0NB 2JPHA 2O6VB 5IXFA 2FPDA 1AZEA 3H7PA 4EKUA 3VS3A 4KIKB 3M63B 5G55A 1QCFA 4BKGA 4BOZB 4G11A 2OJRA 3IFWB 2KGTA 2C0TA 4KZCA 3HPCX 3WANA 1WRDB 3LUIA 4Z8AA 1WX6A 2K2MA 4X57B 2D2QA 2DNUA 2D1XA 5DPTA 4XC2A 1WXTA 3M0UA 2DL4A 2BKRB 3M0TA 2ROLA 2MBHA 3VTWA 2K79A 3VS1A 2L73A 2ZVOA 3DCGA 2KKCA 1UD7A 2KDIA 2R2QA 2K39A 2ROTA 2FCQA 4JZ4A 2DILA 3ECIA 2LGDA 2LZ6B 4IIOA 3R66C 4PYUA 2MBQA 1WYWB 2XBBC 2FPFA 3NZSA 4P2JA 2FIDA 1S1QB 2KTFA 4CC3A 2KO3A 1YX5B 1K0SA 1GL5A 2GMIC 2RPQA 3DVNV 2AKLA 2LRUA 1UHCA 3I5RA 2D10A 1WJ6A 1GCQA 2LJ5A 1ZSGA 1LM8B 4HVVA 2IO0B 3M0SA 2K8HA 4MELA 4LJOB 3ZRCA 2KRMA 1WXMA 4EUTA 4F14A 2KEAA 3L13A 3PLVA 1ZUKA 2RN8A 2CH4A 3W1SA 4M4ZA 4KSLC 1XTEA 2D07B 2GBMA 2DX1A 1SRLA 4OMPA 5G2NA 4ICVA 5CHFA 2EYZA 4TV3A 2BZYA 2MCNA 4RMAA 4AJYB 3MTNB 1Z2MA 3IBEA 5CX3A 1YJ1A 4HVBA 1JXMA 2LP5A 3M0PA 5AZHA 4XZ4A 2L76A 1M30A 1M8MA 5IHIA 4B6WA 4NQLB 2MW5A 2M1MA 3L16A 2L2PA 4OMLA 2ZZPB 4PYZA 3NS8A 3HM6X 2PTKA 1X43A 2MBEA 4IG7B 3M0RA 1NLPC 2NPTA 3QWYA 4ZNXA 3N32A 4MSQB 2WX1A 2RNAA 2V1YA 1VA7A 1E6HA 2G6FX 2KRSA 1M3BA 2MLBA 1TUDA 2KMAA 5L23A 3VS6A 1VD2A 4GBQA 5BO4B 1OEYJ 1JQQA 4ZRIA 2AR5A 4E3CA 1V5OA 2KMCA 2JVCA 2BZXA 2DL8A 1C3TA 5DPSA 1UJ0A 2KQSA 3Q3JA 1ARKA 2L0AA 2MBOA 4AFSC 2O2VA 5DPRA 3ZNGC 3B1LX 4LJPB 1I42A 2RPNA 5AEKB 1GCPA 3L54A 3ZIMA 3PLUA 3KUDB 2W9NA 1WFWA 1U3OA 2LGXA 4LN2A 4TUUA 1XQQA 4RTUA 1WXBA 2FPEA 2GBRA 3A4RA 3TCAA 2ETTA 4A63B 4DEXA 3ZTCA 3PHXB 4D8KA 3S2AA 1HSQA 1WH3A 1C1YB 3NZUA 2YUOA 2K6QA 4TQ1A 2KC2A 3QX1A 3ALBA 1E8WA 1Q1OA 3SHQA 1WZ0A 2NWMA 2LI5A 3RCZA 5D7GA 3EHRA 4J9BA 3M3JA 2A37A 2Z0EB 3I9QA 3ZLZA 2KDBA 4BFRA 2VRRB 2O88A 2D8HA 5KHOA 4AOFA 2AL3A 2RSUA 3DBHI 4RM9A 5HCKA 2CREA 3OJ3A 4K11A 1WIAA 1RLQC 1CKBA 3AU5A 1UH6A 3RYTA 4JLCA 1R4NI 2RQTA 2IBIB 2DA9A 2BYEA 4I6LB 3RZWC 2FCMA 4WJQA 4D8DA 4RTYA 3V61A 2WDTB 2IWLX 1LXDA 4E6RA 1WE6A 3QIJA 3VDZA 4G3XB 1HJDA 2PZ1A 2LGYA 2A36A 4IW0A 3A4SC 3RULA 4RUGA 1OGWA 4GLMA 2EMTA 5FWCA 4A3PA 2NBUA 4GB9A 2EPDA 1WA7A 4BVUC 1M3CA 4HJKA 4OXWA 1YWOA 3GBQA 2KE9A 5IA7A 2GTOA 2JXBA 2I1JA 4FJYA 3DVNU 2MP2A 5GMVA 4AZ9A 3FOGA 3ZUNA 2KWVB 1MV0B 2CSQA 2ECZA 4JJDA 2DVJA 4J9EA 2EBPA 4EIKA 2JS0A 1YCSB 2C9WB 3PS6A 2ZPYA 3CMMB 3EECA 2GTJA 2O6VA 2MBBB 2HCKA 1A0NB 4W9JA 3VS4A 4BKSA 2KROA 4WWPA 1XTNA 3WAOA 3HK0A 3BY4B 2HSPA 2L3QA 1EFNA 1T0JA 2KFJA 2V14A 3PRMB 4GN1A 4BBNF 4KVGB 4RTZA 1P0RA 1M94A 3ML8A 2L8JA 1FYNA 2MWSB 1SIFA 2C5LC 2ZPNA 4ZRKA 2KANA 4ZRJA 1SHFA 3NHEB 3AU4A 3JW0X 1FXTB 2BYFA 2K9GA 1PKSA 4GDKB 4ICUA 2GBJA 2KHWB 3PHWB 4MGZE 1O7KA 1E90A 1PWTA 1HE8A 3KYCD 2X3XD 3CQTA 1WYXA 5HKHA 3QAQA 2MSED 2J7IA 4EEWA 1V5TA 3EHVA 3APCA 5EC7A 2Z59B 3KYDD 2JW4A 2KJHB 1ZLMA 1U4AA 4QT7A 1AWWA 2ED0A 2M51A 4I6PA 2CS4A 1FMKA 2L3PA 1SPKA 4GU2A 4J9CA 4GDLA 4AG2C 1J0GA 4JQWC 5IAAC 4CHKA 4OMNA 2HTHA 2FAZA 1YN8A 2CT3A 1V49A 2RQWA 4II3B 5E6NA 2JMAA 5AZGA 4W9GA 2LQNA 1J3TA 1UFFA 4HDOA 3HHMA 3AULA 4EZJA 4CC2A 1IO6A 1UZXB 4MGKE 3WIMA 4HVWA 4GOCA 2F2WA 2RQRA 2L3SA 3JV3A 3H7SA 1CMXB 3PREA 4LDTD 3PRPB 2JRHA 5LXHA 2JRIB 4WJPA 4WCIA 2XK5B 2YPSA 3ZO5B 2H8HA 2N1VA 4KDIC 3A1QA 3L17A 2DAFA 2AWTA 4IKBA 2RQUA 2A08A 4WQOB 1ZW7A 2BPSA 3PE0A 4AFUC 2HDAA 4NJ6A 2V1RA 4F17A 3R6NA 4E71A 2LX7A 2D0NA 3TL5A 1GBQA 3EGUA 2NVUI 3LJ3A 4HXDA 5L83A 2KJ6A 5J2RA 3ULRB 5FW9A 1V2YA 2KZRA 4FJVB 2NR2A 2GNCA 2LVQA 1QLYA 2GGRA 3VUXA 4AFZC 1GFCA 2OOBB 1WGGA 2DZMA 4J9IA 1GRIA 2MX2A 1LFDA 2NPTB 4KZ0A 4AWJA 1PKTA 4JJCA 3V62A 4IWOA 4M0WB 1E8ZA 2D8JA 1ZX6A 2CHXA 1UJYA 2YUQA 4AFQC 3IVFA 5CHVC 2N7EA 3NPFA 2N7DA 3JSVB 1WGYA 3PZDA 4GSWA 3KUCB 1X2KA 3U8ZA 4NNJB 2DZKA 2V4LA 3M0QA 3H0HA 2KXJA 1A5RA 4BKSD 3WAMA 4ANWA 2BYVE 3VHTC 1NYGA 4HLEA 2Y5BB 3IQLA 2BF8B 2G4SA 3NY5A 1SEMA 5E6PA 3ZRFA 2UYZB 4DBGA 3JVZX 4FBJB 3B0AA 3IQ2A 2J06A 3EG1A 4J9GA 1UE9A 1YIWA 1PNJA 1NEBA 3GZNI 1J19A 2L0FA 2FCSA 2K1FA 2FO0A 4CYEA 2FRWA 1WJNA 4JZ3A 2L7RA 3VRZA 3N3KB 4HCNB 2DJQA 5LLIA 2REXA 1NG2A 2DE0X 2D11A 1GC7A 2DM1A 2LCSA 3UQBA 2DRKA 3UF8A 2I1KA 1BK2A 5IHKA 2LRWA 2ZJDA 5D94A 3EG2A 3VH4B 4W9IA 1WJUA 2KDFB 2O2VB 1U5SA 2O31A 2REDA 4RTVA 2JT4A 2DENB 2XMFA 2RAKA 3QA8A 2C0IA 2BWES 4W9LA 3RD2A 1B07A 2KLCA 3KUZA 3PVQA 1RUWA 3PPAA 1XT9B 2JMCA 4M8NA 1WY8A 4JJBA 4J9DA 2YLMA 2EGEA 3VRYA 3K9OB 2PJHA 5D2MB 3UINB 4AP4C 1TZ1A 4PQOA 2CR5A 3EFUA 3MHSD 4JIOU 1Z5SB 1Z9ZA 4JL9A 2KTRB 1LCKA 2IY0B 1T3SA 3QJZA 2ZEQA 2N9EB 2KWUB 2Z0DB 1X69A 4MH0E 2QDLA 2LXAA 3V60A 2EYYA 2LASA 4XX5A 2GBNA 1T0HA 2G3QB 3TBLD 1N5ZA 2PNIA 1UGMA 3TVTA 3ZTDA 1PHTA 2JXXA 5JHAA 4PZGA 3X0WA 2LJ1A 3ZW3A 3VTVA 1OEYA 2ABLA 2JWZA 2AZVA 3RZFA 2K6DA 2BWFA 1WI0A 4AJWA 4FHJA 3VH3B 2KFKB 2RQVA 2AYOB 2OJ2A 1V81A 2DLPA 4URKA 2RF0A 3VTUA 3KH0A 2LMJA 3UGBB 1P1AA 4HK2A 1SSHA 4PS7A 4FJZA 2LD9A 2DX5B 2I0NA 3DYTA 4FN2A 3U7DA 4AG1C 2IO2B 2L0TA 2OAWA 4DEYA 3M62B 5E6OA 5GJVB 1JEGA 2L00B 1VYUA 1Q0WB 1JRUA 3Q3FA 3T9LA 2LJ3A 4MEMA 2W0ZA 1KOTA 2FNJB 3TSWA 2AK5A 3DBRI 3B08A 1YD8U 4GDLB 4MJSB 1D3ZA 2LVOA 1ZKHA 2MQJA 5I22A 4J6IA 3QK0A 3EHQA 2KT8A 2PE9A 5IXBA 4ZYNA 1GCQC 4CO7A 4BOSC 1W1FA 1OPLA 4BBNC 4FULA 2K6DB 2KX3A 1YQBA 4NQKE 1OV3A 2HJ8A 4P2IA 1AOJA 1BU1A 1RRBA 4AUQC 1E8XA 4DHJD 2B86A 2EGAA 1E6GA 4YL8A 1E7VA 3ZDTA 4GDKA 4LCDE 3BINA 1ZUUA 1WF9A 2DHZA 2LXCA 2FG0A 3DPDA 2KYMA 2WWEA 3D32A 1P98A 1ZUYA 4DHZE 4NJ7A 2KLGA 2K8BA 3ZNID 2ESWA 4ASWC 4DHJB 5LXIB 2CUBA 4HWIB 1ISNA 3DBLI 2DMOA 3UQAA 4LNPA 1VYTA 1CKAA 1QWFA 2DRMA 4WAAA 3RT3B 4F8CB 3HM3A 4ANXA 2SEMA 3UATA 1UHFA 2DL3A 4PQPA 4OMQA 1SRMA 1KLVA 1H8KA 4OVVA 4IWQA 3P2BA 4PS3A 1F9JA 3H0IA 4EFOA 3I5SA 2AL6A 4KSKC 1BB9A 2X3WD 2L3ZA 2KD0A 2P4RA 3UIOB 2N9PC 1UECA 1UGVA 4B9KA 2MA9B 3VQIA 2DZJA 2XEWA 1KFZA 3EG0A 1AEYA 1WGRA 1K4US 5IH2A 2EMSA 2J6OA 1AVZC 4CC4B 4IKDA 3TJPA 4MGYE 2JM9A 2CSIA 2K8CA 5CHWA 1QZEA 3OLMD 2RMOA 2EGCA 2KT1A 3W1YA 3VS5A 1VCBA 4HASA 2CH4W 1GBRA 1OPKA 2PE6B 3LH5A 1YNZA 3EG3A 4IWPA 1NEGA 4IC7B 1GG3A 2K3BA 2KTRA 2ZCBA 2JZ3B 1NBFC 3K9PB 1K0XA 1Q5WB 4BGJA 4GGQA 1UELA 4J9FA 2ZVNA 1V6EA 3UA6A 1WDXA 1P3QU 3V6CB 1G6JA 1K76A 3VUWA 3RNJA 1RI9A 1LQBA 1WJ4A 2GQIA 3APFA 3QWZB 4W9FA 3UA7A 1UG1A 2C7MB 2JT4B 5JHBA 2ED1A 4HCKA 1OQYA 1IYFA 1I07A 1Y8RC 2XK5A 1YWPA 1WI7A 2IY1B 3QCAA 4DWFA 3VUYA 1JU5C 1QKWA 3H1UA 1X6GA 2QHOA 1ZBJA 3KFVA 1RFAA 4HPLB 1TBEA 2HD5B 4DDGD 1SHGA 4FA6A 2J0KA 2KXCA 4NPNA 3U30A 4X1VA 3SEMA 2JF5A 2KDEB 5FWBA 2AKKA 2VVKA 3NGPA 3RBBB 3JYUA 2K25A 1R4MI 4FHKA 1Z9QA 2YT6A 2VWFA 1RLFA 1NLOC 2N1WA 1M3AA 5IHNA 1OCSA 3U23A 2V1QA 1G83A 1X1MA 3ENEA 2CZOA 3A9KA 2NBVB 4HXJA 1H4RA 2KQ7A 2O9SA 4BKTA 4MGIE 2YUNA 4ORZA 2M8SA 2YDLA 4RTWA 2FIFA 3R3MA 4FLHA 1TUCA 4IM2A 1H8CA 1J8CA 5EDSA 2I4KA 2PPHA 3MJWA 2ENMA 1T0YA 3JSVA 1ABQA 3A9JA 4IM0A 5L95C 3SDLC 1K1ZA 1AARA 3DBSA 2O9VA 3DVGX 4IIMA 5AZFA 1EO6A 2FUHB 1IP9A 2DZIA 4MM3A 2O6VD 4NAWA 2EKHA 4Z89A 1WM3A 2NUZA 3L08A 2BKFA 3WAPA 3A1QB 1X6BA 4MJSA 2YVCA 2D3GA 3ZVVA 4F7ZA 2L05A 4OVUA 4OMOA 3ML9A 4DHZB 3L0WB 3I3TB 2JTEA 3W1SC 4R0KA 2LNHB 3VS2A 2FEIA 3NMZC 4K7WA 1UDLA 5ECAA 2CKHB 2BZ8A 1GNUA 1WX7A 3A9JB 4P7IA 3WALA 4Z88A 2A28A 2J0JA 1QWEA 2R2OA 1X2QA 3REAB 3H41A 4HCPB 2A4ZA 2RAJA 2RR9A 1WLPB 3ZL7C 4F1SA 4W9KA 1KJWA 2ZNVC 4OMMA 2JUOA 2KFKA 4Y92A 2CSKA 1I35A 2MCNB 2HE7A 1IPGA 2J6KA 3DQVA 4KV2A 2HBWA 1E8YA 1B3QA 3QHTA 2KXDA 2KNBB 4DXAB 1I0CA 3NHNA 1Y0MA 1EF5A 4EZLA 3IG3A 3TSZA 5D6JB 3VVWB 4HPMB 2KC1A 2EYXA 4EOYA 1SE9A 4DDID 3P0CA 3H9DA 1UBQA 2GBKA 4GMVA 4II2B 4LE9A 3SHWA 2MOXA 4LDTB 4TQ0A 1AZGB 1MV3A 1W6XA 1WZ3A 2KK8A 4KRTA 2LJ0A 5FR6A 3UIPB 3EC8A 2KYBA 2J7QB 2KRNA 2M17A 1WXSA 4K7UA 3PTFC 1SGHA 1K9AA 5DPWA 2KJRA 1NI2A 1M27C 4F16A 3A33B 2DBMA 3PGEA 2UWQA 2AZSA 4K7SA 1WR1A 1WXUA 2C7NB 1HD3A 2EW3A 4ESRA 2JY6A 2KOXA 1NM7A 3ONSA 2MP2B 3OAWA 2CHZA 1NDDA 3DDCB 2C0OA 1YX6B 4HDQA 2WX0A 1PQSA 1H3HA 3RUIB 5GJWB 2GBQA 1KQ6A 2IZVB 4WWNA 1OEBA 3GOEA 2C60A 1WE7A 1WMHA 3CSTA 1WXAA 3VXWA 1X27A 1V80A 2M0YA 1H92A 4IUMB 3O5ZA 2EQIA 3KW5B 4W9DA 3THKA 3ZKJC 2WWZA 2J0MA 2MRPA 1Y57A 2YSQA 2KR3A 1UBIA 1E5WA 1QKXA 1WIEA 2K7AA 1JXOA 1UUEA 1PRLC 3QQ8B 1EF1A 4ZDVA 2MIOA 1MG8A 2EKEC 1WMHB 2DL5A 2WYQA 3DOWA 2CT4A 2F2VA 4J9HA 1L7YA 2V3SA 3PT2B 1ABOA 5JZEB 1WXVA 3QARA 4NAWB 1W70A 1AWOA 2OI3A 1YP5A 3C0RB 3H0FA 2IO3B 1I1JA 3CSFA 4HVUA 1GC6A 3R7RA 3TIXA 3APDA 2IYDB 4A3OA 5DCNA 2KBTA 2VKNA 2RD0A 4PS8A 1MUZA 2C7HA 1UTIA 1XD3B 3ZNHB 3X23A 2IIMA 3PRZA 5I11A 2E5KA 2SRCA 4K81A 2YUPA 2B3AA 3DVGY 3PSEB 2RAIA
chains in the Genus database with same CATH superfamily
1U06A 3B9JA 3MEVA 2RB6A 3WA0A 4M78G 3G7ZA 3OJ4B 1IBXB 1V9JA 2WXRA 2F2XA 1LGRA 2XU8A 2M4NA 1NYFA 3MFGA 4MSMB 5HK0A 4M77D 3U52E 2M1HA 2PVOD 5H92C 2EYWA 5IO9A 1VQ5T 2BBCA 3KWLA 2DPPB 2FRYA 3U7ZA 1VQ7T 1VQNQ 3PVLA 1A70A 1OCUA 2RK1A 3OMCA 3BVGA 4IUQA 2O2OA 4C5EA 3A9KB 3G4ST 2J6FA 3AI5A 2V8KA 3QPHA 4MDWA 3VUZA 1TGZB 3SFEB 2CUDA 1D09B 4A4FA 1GUAB 3O65B 3L2WA 2UU7A 3LGLA 4WWOA 3BVMA 3L10B 1C78A 5KCHA 3VS0A 1AWJA 3NRZA 1WM2A 4USAA 2KWCA 1ZQ1A 5LJ3h 2EVRA 2IPOB 1AWXA 5GMKh 2M0XA 1I4K1 1ZGUB 5KYUB 5C23A 1I4XA 3A8OB 5CTRC 2QYZA 4YTLA 2KNBA 4FW2A 1M90R 2BGFA 3S3NA 5G5HA 4EZKA 1L6UA 3QDRB 5J18A 5HKCA 3AE7B 1KMDA 2DYOA 3EFSA 3M95A 3RI7C 2MYSA 4G50A 5FROA 4O5VA 3ZDMC 4PJOG 3I35A 3J80E 4N9F4 4L23A 3CBMA 1K73C 3NZ3A 2VZKB 3SU8X 2LWPA 2DL7A 4GXBA 4CC7A 3ZNZB 4IKBB 1D1CA 2Y5CA 3QWXX 5GANd 1K8AC 1S1NA 3CD6A 4RTTA 3CF6E 2V6VA 2G45B 4TKNA 5DM7R 2JS2A 1OOTA 2ZCCA 1BIAA 4REZA 1YJNA 1D0YA 2E12A 4RTXA 4JPBW 5GAOm 2J52A 2LVPA 5DY9A 4XDCA 4M7DD 4US9A 2DBKA 4XU2A 1FX7A 1N61A 1T3LA 2LEKA 4YTPB 1I4QA 1TY2A 3H6NA 1WFYA 1RLPC 3GP8A 1SEBD 4FADA 1RAXA 4OVZA 2W82A 2M0AA 2RGFA 2INPE 3CD6Q 4N4GA 5AUIA 2QEXQ 4M8MA 2HDEA 4WF2A 4PJNA 1JWBD 1C4CA 3LDZE 4I6NB 4MDKE 4HCCA 4XQ3A 1TS2A 4NL3A 2VXFA 1W2BP 2CJNA 3VS7A 4MZPA 3W5UB 1VQLA 3AE6B 5JH5C 1F2RC 4J7IA 3UI3A 2H88B 1JRIA 1MMGA 3QDFA 2NS5A 2QC8A 3E9FA 2BE9B 2XNAC 3B2GA 5MPOA 2KY9A 4M78F 4LUEA 4RFBA 4JGHB 3VAWA 1B9RA 2RHIA 1HXDA 1YJNT 5KYUA 3GP7A 1G2BA 1JJ2S 3OYFA 1TS3A 1WGKA 5KE3A 3QC8B 4JLIA 1OTRB 4GIVA 3JRZA 1GD5A 5A0DA 3GE3C 1WHMA 1RAFB 1WGHA 4LNKA 3SD5A 4HCZA 2O01E 2BUDA 3CXCS 1KM7A 2H89B 1TTNA 3PV1A 2A5UA 2HZYA 3VFKA 4E7HA 4MM3B 4WJNA 2KK4A 1PRMC 3N9YC 4WIPA 4A6QA 4OZAA 3V6EB 2XDDA 1WGDA 1VOMA 1GFDA 3T8MA 1C1AA 1BT0A 3VUBA 2FCNA 1PGXA 1V86A 2N9KA 1ZE3D 2ZPBB 1XOVA 4B95A 5TR5A 1Y71A 2QG9B 2W10A 2WSFE 3N30A 4IM3A 4NY0A 3R7QA 2GOWA 2DYMA 2I38A 1V1CA 2JZZA 2N9XA 2COWA 2XHCA 2ON8A 4N58A 4OVAA 2DAJA 4FSSA 2KX0A 1GJZA 3DHGC 1WX8A 2NCNA 4J3OD 1NI3A 1L2NA 1V97A 2XG8D 1ET6A 3P4QB 3HPBA 1E7UA 3EG9A 1VR9A 1AYFA 1NZ9A 3IHPC 3IT6B 4AKVA 1LNXA 1VQ9A 3V3XA 1D5ZC 1WNLA 2WXKA 2WXLA 1YN5A 3SFMA 5AYFA 3FJ5A 1KSWA 1YMHE 1H6HA 4W9HA 4ON3A 2ZNVB 2REAA 2CP3A 3V8KA 1CSKA 1M90C 5J17A 2QQAA 2LQWA 1T0RC 2DF6A 5GAOr 2LGIA 2DXUA 4L2YA 4F04B 1YITT 1KLUD 3X28B 1WX9A 2N4FA 2WXQA 4W9EA 1S3SG 2NBWB 2LUEA 4KIKA 3J9CA 1TKGA 2OTLQ 4OZCA 2HSEB 2PEAA 5C1ZA 1K8RB 3CMEQ 4W9CA 3H7PB 2BW2A 3HKSA 1WR6E 4RM8A 3OA6A 5KCOA 4QQDA 3AE9B 1PSFA 4B9XA 1M1KU 4C0ZA 3A98A 1P9DU 3UF4A 1ESFA 2J05A 3OB9A 4M75A 1KTKA 1BBZA 2HEQA 3NOBA 4IDIA 3RNAC 1VQ9T 1AD5A 4FU6A 2QXFA 2CU1A 5HFYA 3GNFB 1JO8A 2BTTA 2MF2A 1HTOA 3NS1A 2VGNA 2RJCA 4DBHA 4NL2A 3G71T 2G4DB 2ZAEA 2KVRA 1OQQA 2KVZA 4BDYA 3HIZA 3CC4Q 1E7OA 3J7AF 1L4ZB 2CDTA 1W4SA 1NE8A 1OYXA 3REBB 2KN5A 1TG0A 1KJTA 5KHQA 4K1RB 1ZBXA 4A20A 4C92C 2IO1B 2AQ1B 3I63C 1EUVB 3NVVA 3TMPB 4A53A 3KVFB 4DK5A 2XIDA 2CKKA 4LUDA 3AXCA 1VYVA 1MMAA 1KIKA 2JM8A 4DBRA 4E74A 4BE1A 1J7AA 3RKYA 2ASQA 2LCCA 3RR6A 2DTIA 3CCSQ 4J83A 1YQ3B 4KDLB 2AEHA 2CHWA 1YJNQ 4NOYA 5KYXA 4ANVA 2LRQA 4KGXB 1EWYC 1TZOA 2DYBA 4WJOA 4H2AA 1R4MB 2R58A 4ANUA 2LZ6A 3C0CA 2DD4A 4IKFA 4G0NB 3RNGC 2JPHA 4JPSA 2O6VB 2LT4A 2HMAA 2FPDA 5IXFA 4M7AE 4B6MA 1AZEA 3H8ZA 1SF0A 3H7PA 1WJRA 3CCSA 4EKUA 3GS2A 3VS3A 5C0MA 3BE3A 1YBYA 1TKYA 4KIKB 3M63B 5G55A 1QCFA 4E7ZA 4RH6A 4M75B 4OW0A 4HPPA 1QQJA 4V2SA 4BKGA 1UGSB 4BOZB 5CQYA 1Q7YC 4G11A 3N20C 1MHNA 3RMKC 2OJRA 3IFWB 2EAYA 5HI1A 4YTNB 2KGTA 3PIPA 3G4SQ 2MHJA 2C0TA 4KZCA 3H6ZA 4OZBA 3LWIA 1YN3A 1I4RA 3HPCX 1VQ7Q 1VQNT 3WANA 3FC3A 3AE1B 1WRDB 3SR6A 3LUIA 3V05A 4Z8AA 3NVWA 2JNGA 1WX6A 4M77B 2K2MA 5IOIA 3TEWA 4X57B 5GAN7 2DNUA 4C5IA 2D2QA 2D1XA 3P4SB 4Z02A 2CU3A 4XC2A 1WXTA 5DPTA 3M0UA 1PDXA 4PJOF 2DL4A 2RJDA 2BKRB 1G3TA 1WHHA 3M0TA 2ROLA 5GAOn 2MBHA 3EH2A 3VTWA 1R77A 2K79A 1L4DB 2KSSA 3VS1A 2SAKA 3LYYA 3D7SB 2L73A 1CZPA 2RHZA 2KKCA 2XN9C 2ZVOA 3DCGA 2BE7D 1UD7A 4JRPA 2QJLA 2KDIA 2R2QA 2X51A 2ROTA 2K39A 2RH2A 2FCQA 4JZ4A 2DILA 3ECIA 2LGDA 2LZ6B 2JOYA 2D9TA 4IIOA 3R66C 2MBQA 1Q7YR 1WYWB 4LDVA 4PYUA 1EU3A 2XBBC 2FPFA 3NZSA 1KD1C 4P2JA 2EIFA 4CRIA 2FIDA 5J39A 2WLBA 3RNBC 3OS1A 1S1QB 3FDRA 2KTFA 2KWDA 4RCBA 4CC3A 2KO3A 1YX5B 3LX7A 2E65A 3E9SA 2EJ9A 1K0SA 1GL5A 3OMGA 2GMIC 2RPQA 3VR9B 1YJ9A 3DVNV 3MC0B 2D3AA 2AKLA 2F1LA 1KC8U 5HHDG 2LRUA 1UHCA 1Q82C 1RWSA 1D5MC 2WXPA 3TEYA 1VZ8A 3HP9A 2FZGB 3I5RA 1TIFA 2D10A 1B1ZA 3UWNA 1WJ6A 3MP6A 1U8RA 1DGJA 1GCQA 4YSZB 2LJ5A 1ZSGA 1LM8B 4HVVA 2IO0B 2RD1A 1W2BS 1HTQA 3M0SA 2K8HA 4MELA 2RHYA 2WXMA 4ANJA 1WHLA 4ZHPA 4LJOB 1QCNA 1FRDA 3ZRCA 2KRMA 1Q81C 4QQ6A 2JUFA 1WXMA 4EUTA 4M7DA 4F14A 2N9LA 3LYIA 2NLUA 2KEAA 1RAIB 1TU0B 1XXGA 3EGDA 3L13A 3PLVA 1ZUKA 3RUXA 4QVZA 1KLGD 2GB1A 2INCC 2RN8A 4BI3A 3TSSA 2CH4A 2E6NA 3EFOA 4D6WA 3CC2A 3W1SA 4M4ZA 4KSLC 4JE3B 4K3BA 1XTEA 1WGSA 2D07B 1XTDA 5BMGA 5LJ3e 2GBMA 3OW2A 2ACZB 4GLKA 1M2VB 1IREB 5DLQE 2DX1A 1U1TA 2L8DA 4E2FB 1SRLA 4DBFA 4XYCA 2QIEB 2LHEA 2V8JA 3F70A 4OMPA 2KYWA 1QOFA 5G2NA 3ABVB 3SFDB 4M75D 3CC2Q 3FB9A 4ICVA 5CHFA 5GMKm 2EYZA 4TV3A 3HSBA 2BZYA 2MCNA 2GFUA 3GPLA 4RMAA 4GY5A 3R2IA 4AJYB 3MTNB 1Z2MA 2NUPB 3IBEA 3MO8A 1T0SC 5CX3A 1XLQA 1YJ1A 3N1XC 3AEBB 4HVBA 1JXMA 4KGZB 1M1FA 1WZOA 2LP5A 3M0PA 5AZHA 3HUIA 4N4IA 4XZ4A 4BUGA 2L76A 1M30A 2KDMA 4B0EA 1M8MA 5IHIA 2EQJA 2W3RA 1FD6A 2E4HA 5D6XA 4ZN3A 4ATOA 2M02A 5EE0A 4B6WA 3WVEB 1D0XA 1Y56A 4NQLB 1R0BG 3AV8A 3GE8C 2MW5A 1JCKB 3OS0A 1TJEA 2M1MA 3L16A 2L2PA 4OMLA 2WDRB 3MPUB 3TREA 2ZZPB 4PYZA 3NS8A 3ZBDA 2ZGWA 4JS5A 3RERA 3HM6X 2PTKA 1X43A 4HROA 4RCCA 1D6EC 1N8RU 2MBEA 3U2SC 4IG7B 3M0RA 4ZTFA 3M55A 1NLPC 2NPTA 3CXCP 3QWYA 4ZNXA 1VQOT 3N32A 4AMCA 4MSQB 2WX1A 2RNAA 1SE2A 2V1YA 1VA7A 5CR2A 1F0ZA 1E6HA 2QMTA 1OU8A 2G6FX 2KRSA 3QXEB 5IAYA 2BS4B 3NVZA 3CMET 1M3BA 5KH6A 1ZSZC 2MLBA 1TUDA 2V3PA 4O1NA 2KMAA 5L23A 3VYGA 2QGGA 3VS6A 2HD0A 1VD2A 3ZXRA 3V8JA 2X4XA 4GBQA 3I55T 1T6BX 2NUTB 4J6YA 3ZJUA 5BO4B 4PJJA 1OEYJ 1JQQA 2C06A 4E7KA 3ZJTA 4ZRIA 3UDCA 3JCMJ 4E3CA 2AR5A 1VQOA 3RIRA 3HRTA 1I8FA 1FNVA 2L3RA 4TVRA 1JWMD 1V5OA 2KMCA 1IBXA 1T5XD 2JVCA 3BWUD 5IN7A 2BZXA 2DIQA 2L1AA 1AN8A 2DL8A 1C3TA 1RABB 2DERA 4XE0A 1QMCA 5DPSA 1UJ0A 3KQ4A 5GAN8 2KQSA 3Q3JA 2PW9A 3BK1A 1ARKA 4WQMA 2L0AA 4A4KA 2MBOA 4AFSC 4RF0A 2O2VA 1QW1A 5DPRA 3ZNGC 3B1LX 4LJPB 1I42A 2RPNA 1ACMB 1FXAA 2DVEA 5AEKB 3QSUA 1GCPA 3HPWA 3QJYA 1M4VA 2HJ1A 3L54A 3PLUA 3ZIMA 2CZ7B 3RMSA 3DB3A 5DCNA 1YJJA 1R7SA 2W9NA 3KUDB 1WFWA 3HTRA 1U3OA 3C8YA 2W3SA 2LGXA 1BI2A 4LN2A 1VQ9Q 4PFPA 4TUUA 1XQQA 2K3UA 1Q81R 1UNSA 4RTUA 3RFZB 1WXBA 4HKEA 2FPEA 2GBRA 3A4RA 3P4RB 3TCAA 2ETTA 2D3CA 2K2VA 3LLRA 1L0YB 2QK0A 4A63B 4DEXA 2DBYA 5A2QE 5CO7A 1IRXA 3ZTCA 3PHXB 4D8KA 3C19A 3S6WA 3EUB2 3S2AA 4ZGJB 3JCMV 1HSQA 1WH3A 1C1YB 3NZUA 1M2VA 1X6OA 4M77A 2YUOA 2L52A 1YITQ 4WTOB 2K6QA 1C4PA 4OB1B 4TQ1A 1GAQB 2DK3A 2EWNA 3BIID 2KC2A 3QX1A 1OZ3A 2X8XX 4BE2A 3DLMA 3ALBA 3MKDA 1M8VA 1E8WA 1Q1OA 3EGDB 3SHQA 1WZ0A 4LD9K 2NWMA 2LI5A 3RCZA 1UB4A 3QKJA 4IUUA 1NYRA 5D7GA 3CC7T 1K9MR 2BVCA 2YRDA 2WNMA 3EHRA 1BKBA 1VQOQ 3AN1A 4DA4A 4J9BA 3M3JA 2A37A 5FK9C 2Z0EB 1UGRB 2SEBD 3RESA 3WCQA 1TXQA 3I9QA 3ZLZA 2KDBA 4BFRA 2VRRB 2O88A 2W55A 2D8HA 3CCQQ 5KHOA 1JRPA 3A8HB 5GAMf 4LK0M 5CAIA 2INDC 4BD3A 1JWSD 1TOVA 2AL3A 4AOFA 1DJ7B 3M59A 4FSXA 3IXSA 2RSUA 3DBHI 1TTHB 3DBHB 4RM9A 5HCKA 2CREA 1ZA1B 2WXGA 3OJ3A 3NTKA 1N9SA 1BCMA 4K11A 1WIAA 1RLQC 3R2TA 4RG8A 1CKBA 3AU5A 4L1BA 2RDBC 2VASA 1UH6A 2AQ2B 3QHSA 5FLXE 3RYTA 4JLCA 1R4NI 2RQTA 3UPUA 3WXMB 2IBIB 2DA9A 2BYEA 2RI2A 3JB9D 4I6LB 3RZWC 3PIOA 2HAXA 2FCMA 2JZPA 1P92A 1QCOA 1JALA 3Q8CA 3CBPA 4KKIA 4WJQA 4D8DA 2F5KA 2JJ9A 4RTYA 3V61A 2WDTB 3BDLA 2IWLX 4TSSA 1LXDA 1RAEB 1UGJA 4E6RA 5GMKj 1WE6A 3QIJA 3VDZA 4FYXB 4YT0B 4G3XB 1VQ5Q 1HJDA 2V8IA 1UGQB 3NTHA 5D3IB 2PZ1A 1HZ5A 4C5HA 2LGYA 2A36A 4IW0A 3A4SC 3RULA 4RUGA 3OYCA 1OGWA 2DYIA 2LJIA 4GLMA 2EMTA 1Q86R 5FWCA 1PD0A 3OW2P 4A3PA 1VIEA 3HVDA 2NBUA 5GAN2 3URYA 4GB9A 2EPDA 1WA7A 4M7AC 1EWCA 4BVUC 1M3CA 4HJKA 1HEZE 4HKZE 2OTLA 1M5Q1 1YWOA 2XI9A 2YWWA 1QVFA 2PKOA 3GBQA 4OXWA 2KE9A 1Y96A 2D0QB 2LGSA 5IA7A 2GTOA 2JXBA 5BYSA 1PYWD 2I1JA 5GAMe 2WXIA 4FJYA 3DVNU 2E10A 3KUFA 1BXTA 4BZAA 2MP2A 3C94A 4IUPA 5GMVA 4AZ9A 3AEEB 3FOGA 1UEBA 1XCQL 2AHJB 1KK7A 1VQLQ 3ZUNA 3L1AA 2KN4A 2KWVB 5GAMg 1MV0B 3GOXA 5EE9A 2CSQA 2ECZA 2Z8LA 1F1BB 4JJDA 4KH1B 2DVJA 2DWQA 3Q3OC 4M77F 4J9EA 2WXOA 3DBRB 4C00A 2Z0WA 2EBPA 4EIKA 1QOGA 4PK4A 1LVKA 1YCSB 2JS0A 2C9WB 4LDYA 1N6ZA 3PS6A 4LDUA 2K3YA 3CC7Q 2PU9B 2DXTA 2ZPYA 3CMMB 2P0QA 3A1PA 1MHHE 2GTJA 3EECA 2O6VA 4HRSA 2MBBB 2HCKA 3SD4A 4M7AG 1A0NB 1FEHA 4W9JA 1RAGB 3VS4A 2R57A 4BKSA 4FT4A 2KROA 4WWPA 1XTNA 2GFAA 3WAOA 3H9NA 3HK0A 4M75F 2PVDB 1LO5D 1VUBA 2HSPA 3AH7A 2L3QA 3MEUA 1NYQA 3BY4B 2QA4T 1EFNA 1NBEB 1T0JA 2IJ0A 2KFJA 2E6ZA 1VQMA 2RHXA 2V14A 2D5GA 3PRMB 4GN1A 3E56A 4BBNF 4E7LA 1SE3A 4RTZA 2ZW1A 4KVGB 1VQ8Q 1P0RA 1MMDA 1P7EA 1M94A 1K73U 3ML8A 5I4DA 2L8JA 4PT5A 1FYNA 3CCVQ 4R3DA 1FO4A 1VQKQ 2MWSB 1SIFA 1Q10A 4E7IA 3CCST 2C5LC 3OBWA 2ZPNA 3KXTA 3V7SA 2DTHA 4PL6A 4ZRKA 4ARIA 2WXFA 2GLSA 2KANA 5CKDA 4ZRJA 4CQNA 1SHFA 3NHEB 1WRIA 2LDMA 3G6EA 2XICA 3AU4A 3CCUQ 3AEDB 4HJGE 2CZ1B 2R5MA 3JW0X 2P0KA 4OB3B 1FXTB 2BYFA 2RJEA 5GMKe 2K9GA 2QA4A 1PKSA 4GDKB 4ICUA 4A8XC 2GBJA 3Q3NC 2KHWB 3PHWB 4MGZE 4BY6C 1O7KA 3DBLB 4E7SA 2X4YA 1E90A 1PWTA 1HE8A 4M7DG 2RDHA 1LOJA 4EMHA 1CJEA 1WXQA 3KYCD 2X3XD 3CQTA 4JDSA 4Q2JA 1WYXA 4N4HA 2DETA 1RACB 2L83A 3QAQA 3OYBA 4PFOA 5HKHA 5LJ5e 2Y4XA 3GLXA 1RFKA 1TS4A 1HYOA 2MSED 3MCAB 2J7IA 3QJ6A 1ACCA 4EEWA 3CCLT 1SSFA 2I2LA 1V5TA 3EHVA 3FC4A 1RAHB 2KMTA 5HY6A 2EQMA 2WU5B 3APCA 3Q8BA 5EC7A 2Z59B 2VH2A 2KQ4X 3KYDD 2JW4A 2KJHB 1ZLMA 1U4AA 4QT7A 1BUIC 1GB4A 4QQGA 4PJOE 2Y3AA 1AWWA 2QASA 2ED0A 2M51A 5DLOA 3E19A 3RKXA 4I6PA 2CS4A 2RI3A 1Q86C 4LNOA 4M0WA 1YJ9Q 1IUEA 3DKMA 1FMKA 2EKIA 2L3PA 2X4WA 6AT1B 1SPKA 2R61A 4GU2A 4J9CA 4RCOA 4GDLA 4AG2C 3VKIA 1J0GA 1MPEA 4JQWC 2RMMA 1YJ9T 3WVDB 4OGCA 5IAAC 2E41A 2J53A 2HNIA 4CHKA 1F77A 4OMNA 2HTHA 2FAZA 3QUIA 3AECB 1STEA 3Q8AA 1YN8A 3ASKA 5HG2A 2CT3A 1V49A 2RQWA 2MPXC 4C0GA 1YIJQ 4PJOB 1JROA 1R0CB 4II3B 5E6NA 2QQBA 1D3BB 5I2MA 3MEAA 2DZCA 2JMAA 5AZGA 4DXGA 5GAMj 1CK1A 4W9GA 4TMAB 4NJCA 4YTMB 2LQNA 1J3TA 2FUG1 1UFFA 1ROEA 3L2UA 4HDOA 2BYTA 3HHMA 4L5GA 3AULA 4EZJA 4CC2A 2BB5A 5D6YA 4RGTA 3B2FA 1IO6A 5CKEA 1UZXB 3NTIA 4MGKE 3WIMA 3CCRA 1VQ7A 2L89A 4HVWA 3MHZA 4C8QF 4GOCA 2F2WA 4KBMB 1ZSZA 2L3SA 2RQRA 3JV3A 3H7SA 1CMXB 3PREA 4IKGA 3C12A 1QVGA 4LDTD 3PRPB 1K8AR 5LJ3f 3OYDA 3FJPA 2JRHA 5LXHA 3I55A 2JRIB 3CCMT 2FVUA 2EFIA 1FFVA 3OYIA 4WJPA 4WCIA 2XK5B 3OBYA 2YPSA 4FIBA 2J4XA 3ZO5B 3I5JC 2H8HA 2JWUA 3Q8FA 1VQ4Q 2N1VA 4KDIC 4F7UB 2LCLA 3A1QA 4A54A 2DAFA 3L17A 1GB1A 4EMKA 2AWTA 4IKBA 2QEJC 2DKGA 3CXCA 1WJQA 4HT8A 2RQUA 2A08A 1K51A 4WQOB 1ZW7A 2BPSA 2BT6A 4XTVA 3PE0A 4AFUC 2HDAA 1WPYA 1T0QC 4NJ6A 3ZGZA 2V1RA 4F17A 1XQHA 3OYJA 1VQ8T 1HXYD 2WGSA 2CYZB 3R6NA 4E71A 2LX7A 2MJ3A 2D0NA 1YI2T 1FXIA 3TL5A 1GBQA 1FXXA 3EGUA 1IHWA 2NVUI 3EGXA 3QBYA 3LJ3A 1Y7XA 4HXDA 5L83A 2KJ6A 2G1EA 5J2RA 3ULRB 5FW9A 1V2YA 3HRSA 4KUDK 2KZRA 4FJVB 2MJEA 2NR2A 5D3DA 2GNCA 2LVQA 3JCMb 3Q14C 1QLYA 1FCCC 3BYYB 2WDVB 3CCEQ 2GGRA 3CIRB 2WU2B 4AFZC 1N5XA 1GFCA 1V76A 2NTSA 2OOBB 3VUXA 1WGGA 3SWNB 1QOBA 2WQYB 1UGPB 1GPXA 3SEBA 1JQ4A 2P4TA 2DZMA 3OQ5A 4J9IA 2OTJT 3SWNC 1XLNA 1XLOA 4XU0A 7AT1B 1GRIA 1VQLT 2MX2A 4N0AC 1LFDA 1MFWA 2NPTB 4ZTJA 4KZ0A 1MMNA 1R8OB 3CC4A 3AEFB 3M4YA 3PGGA 4XU3A 4AWJA 2V0GA 1PKTA 4JJCA 3V62A 2WHIA 5LNK1 4B9WA 4IWOA 4M0WB 2XD0A 1E8ZA 4A4EA 2D8JA 4C92F 1ZX6A 2CHXA 1UJYA 4KX6B 1KQ1A 1F1HA 2YUQA 4AFQC 1WHJA 4MDXA 3P8BB 3IVFA 3E9GA 5CHVC 2N7EA 1O9SA 3NPFA 3JCMf 2CZ0B 4YSYB 3BK2A 4M01A 1BYMA 2B8AA 4EE2A 4R56A 5CKFA 2N7DA 1D4BA 3V7RA 3JCMg 3JSVB 1WGYA 3PZDA 4VUBA 2OTJA 4GSWA 3KUCB 4M7AA 3IT4B 4P5NA 3OS5A 1VRAB 4HT9A 1PD1A 1X2KA 5J26A 3U8ZA 1N60A 4NNJB 2HQXA 2I2YA 4OMFB 5GANj 2DZKA 2PLPA 2X4JA 1KHCA 4HEA1 2V4LA 3M0QA 1B7TA 3H0HA 2KXJA 1A5RA 5FU7B 2E1HA 4BKSD 3I56T 1JW9D 1G3WA 3WAMA 3QO3A 4ANWA 2OHFA 3T9NA 2BYVE 3GIBA 5GAMd 1NYGA 1G5VA 3VHTC 2GF7A 4X34A 2WACA 5LJ3j 4HLEA 2Y5BB 1HZ6A 3IQLA 4EDUA 2BF8B 2G4SA 1IGUA 2LNVA 3KBGA 4EMGA 3NY5A 1SEMA 4PLIA 1B34B 2RA2A 4JJNK 3OYYA 5E6PA 4ZRQA 5CVIA 3ZRFA 4ACFA 2HQHA 2UYZB 4DBGA 2E64A 2RK2A 1L6VA 4RGNA 3JVZX 4FBJB 3CPWA 3B0AA 2W54A 5GANg 2KVQG 2JQRB 5KYNA 3IQ2A 2J06A 3EG1A 4J9GA 4M7DB 1UE9A 2KAFA 1KD1R 1YIWA 1MGQA 4PJMA 1FFUA 1SXTA 5CKBA 1NPRA 2QGFB 1Q81U 4P6VF 5GAOl 1PNJA 1NEBA 3HHTB 2LQ8A 3GZNI 3JCMc 1J19A 2RO0A 2EQKA 4Q5WA 2L0FA 2FCSA 2K1FA 4FT2A 4C4VA 2FO0A 4M75G 4CYEA 2FRWA 2Y90A 3O13A 1WJNA 4KKJA 3CCJA 4JZ3A 2L7RA 3VRZA 2RHUA 4C5GA 2DJQA 3N3KB 4HCNB 5LLIA 1KQSS 1XF5L 1XJWB 5FU7C 3ZQ4A 2EJGA 4F7UE 2HL3A 5T8IA 3CC7A 2REXA 3JB9F 1NG2A 2DE0X 3G71A 2K3XA 2WSCE 1FM0D 2D11A 2V9HA 1GC7A 3H8HA 4IOIE 1FWZA 1K9MU 1MNEA 2DM1A 1QF6A 2LCSA 9ATCB 1VQ4T 2CJOA 3Q8EA 3UQBA 2DRKA 3CCET 3UF8A 4M78B 2I1KA 1BK2A 1VLBA 5IHKA 4C0FA 2LRWA 5GAN3 1QP3A 2ZJDA 4ZRPA 5D94A 3EG2A 1S72Q 4N59A 3M58A 3VH4B 4RGOS 4DOVA 4W9IA 1WJUA 1VQPA 2NMQA 3HRUA 2KDFB 2O2VB 2QCZA 3CCLQ 1U5SA 1I4PA 2O31A 4LNIA 2JU6X 2M0OA 1VQKA 2REDA 4RTVA 2PIAA 2FYKA 2JT4A 2CZ6B 2DENB 2XMFA 1TH7A 1YI2Q 3QA8A 2C0IA 4IUVA 2BWES 2RAKA 4NZLB 3CBOA 4W9LA 2JZ2A 1TS5A 3RD2A 4ELYC 1B07A 1Q82R 4C92B 2KLCA 1SBBB 1I81A 4XDDA 3PNWC 3KUZA 3PVQA 3ZYYX 3CCEA 1RUWA 2DEUA 3NUHB 3PPAA 1XT9B 5BYQA 2JMCA 4M8NA 3CMAQ 1WY8A 4JJBA 3BDUA 3JB9J 4J9DA 3SB2A 2YLMA 1QLBB 2EGEA 3VRYA 5IKCM 3JB9I 2M56B 2AQ3B 3K9OB 3JCMQ 2PJHA 5D2MB 3UINB 4AP4C 1SG5A 1TSFA 2ATCB 4XK8E 1TZ1A 4PQOA 3OYNA 2CR5A 3EFUA 4C92D 3LW5E 3MHSD 3OWEB 4A55A 2DO3A 1Z5SB 4JIOU 4C7ZA 1Z9ZA 4JL9A 2KTRB 1LCKA 2IPKD 2IY0B 2MWOA 2XK0A 2PQWA 1T3SA 1KQSA 3QJZA 5CKHA 4F7UF 3HL8A 2ZEQA 2N9EB 1IB8A 2KWUB 2Z0DB 3GB1A 2OTLT 3S3MA 3FKYA 5KYWA 2O4XA 4RGMA 1X69A 1DYQA 4Y28E 3P8HA 4KGRA 3DB4A 4MH0E 2QDLA 3RMQA 1C4AA 3PO0A 4C8QC 4KULA 2LXAA 3CCUA 3OYGA 3AM9A 4M7AB 4C8QE 3V60A 2EYYA 2LASA 4XX5A 2CP2A 2JSVX 4RMOA 3FLGA 2QA4Q 2XDBA 2GBNA 5H8YE 4BAXA 1T0HA 5LL6S 2G3QB 3TBLD 3EG9B 1TKEA 4ME7A 1N5ZA 4IUTA 1QVGP 1AT1B 5AT1B 2A7YA 2PNIA 3MJXA 1UGMA 3TVTA 3ZTDA 1PHTA 5GAOp 2JXXA 2X9HA 4WURA 5JHAA 4PZGA 1JWAD 3N5BB 2CGHA 2E70A 3X0WA 5L8RE 4LDXA 4BDZA 3ZXVA 1D1AA 4BB7A 2LJ1A 3EH1A 1YJWA 2D6FA 3ZW3A 3VTVA 3P8DA 1OEYA 1Q95G 2ABLA 2AZVA 2JWZA 3RZFA 8ATCB 3P42A 2K6DA 2BWFA 1I4HA 4J7FA 2VC8A 1IGCA 4ZOHC 1WI0A 2G3RA 1OZ2A 2COZA 1YHQT 4AJWA 3JB9G 1ZXHA 4XWWA 4FHJA 1ZA2B 4PK1A 3V8LA 1QP2A 3VH3B 1VIFA 1H3ZA 2KFKB 2RQVA 2AYOB 3L42A 3X26B 4PJOA 2OJ2A 2N7JA 2A0FB 2ZPIB 1V81A 2BTEA 2DLPA 1YOVB 4URKA 1QVGS 2RF0A 1TS9A 3VTUA 2YEPF 3KH0A 3S3OA 1N63A 4X9DA 2LMJA 4XGAB 1ZPSA 3UGBB 2E3IA 1P1AA 4HK2A 1SSHA 4PS7A 4MMKA 4FJZA 1EIFA 2K0PA 1HA5A 4BI8B 1JWUD 2WXJA 2JX5A 3CCRQ 2LD9A 5FR3A 2DX5B 1WWTA 3EGXB 5CQXA 1JMLA 2I0NA 4F7UA 3DYTA 4FN2A 3U7DA 4AG1C 1KQSP 2OX7A 2P84A 2IO2B 2PMVA 2L0TA 3CC2T 2E3TA 2OAWA 4JLGA 4DEYA 2BQQA 3M62B 3A8GB 5E6OA 2QQ9A 2AIRB 4KH0B 4QAYA 1TYGB 3QYHB 5GJVB 3TQ7P 3I55Q 1JEGA 2L00B 1VYUA 3OG5A 2HBPA 4BACA 4RKUE 1Q0WB 1Q7YU 5C6SA 2LX9A 4C0DB 1TT5B 1VZ6A 1JRUA 4C8QA 2GRIA 3Q3FA 3PZ7A 5C2TB 3T9LA 3M5AA 4JS4A 1OFFA 3AT1B 1PFDA 2LJ3A 4P16A 3QZ5B 4MEMA 1E10A 4FW1A 2W0ZA 1KOTA 2FNJB 3TSWA 1TUGB 3X25B 5J3BA 4HCBA 2AK5A 1K52A 3N1ZC 1OULA 3DBRI 3B08A 1YD8U 2FZCB 1KG1A 4GDLB 2QTXA 2K57A 4MJSB 1RI0A 1YJWQ 1D3ZA 2LVOA 1ZKHA 1C6VX 2MQJA 1YCYA 2LVMA 4A90A 1IXDA 4J8OA 1J7BA 5FKAC 4M77E 5I22A 4J6IA 4KT0E 1WYGA 3QK0A 4M78E 3EHQA 1WJSA 2KT8A 2J42A 3CCMA 2PE9A 4C92G 4LTUA 5IXBA 4OP0A 1FNUA 1GCQC 2DXCA 1SSNA 2YEPB 4ZYNA 4CO7A 2GQVA 5LJ3d 4MH8A 1G3SA 4BOSC 1W1FA 1OQRA 2NYSA 1OPLA 3Q3MC 4BBNC 4FULA 2K6DB 2ZPEB 2KX3A 3M4GA 4JRKA 4OB0B 4XTWA 1KF6B 1YQBA 3LB8C 4NQKE 1OV3A 2L32A 4ZGEB 1NJIR 3I56Q 2HJ8A 3OW2S 3PTAA 2FBWB 4P2IA 1VQ8A 1YIJA 1AOJA 1BU1A 2R5AA 1RRBA 2WSEE 4AUQC 3TU4K 1E8XA 3MC9A 4QVCA 2AT1B 1N8RR 2FE8A 4EPCA 2B86A 4DHJD 3UT1A 1SB3C 4AT1B 4WAFA 2EGAA 1E6GA 4LNNA 1RM6C 2LC4A 4YL8A 2TSSA 3OYKA 4YXDB 1E7VA 2CS7A 3ZDTA 3RDVA 2LHDA 4GDKA 3DWMA 1NVID 4LCDE 1V1PA 3BINA 3TEZA 2QSDA 4HKQA 2EELA 1ZUUA 1WF9A 1QKZA 3LXFA 2DHZA 1W2BA 2LXCA 1BI0A 2FG0A 2OAUA 4PKCC 3DPDA 4GLSC 2QTVA 3VRAB 1I5OB 4XWTA 2QDFA 1U1SA 2KYMA 4J5YA 2WS3B 1ZP0B 2WWEA 1NENB 1P98A 3D32A 4P1BC 2DJZA 4MACA 1ZUYA 4DHZE 3DLLA 4NJ7A 3M53A 1QOAA 3L2RA 2KLGA 4RNAA 2K8BA 5LJ5d 3ZNID 3NFCA 2ZPGB 2ESWA 3HVZA 4ASWC 4DXFA 3FILB 3RNCC 4F7UG 2HKQB 3CC4T 4DHJB 4M7AF 2H3JA 5LXIB 2CUBA 3R6OA 4M02A 4HWIB 3CPFA 1ISNA 2AX5A 3DBLI 2DMOA 3EFCA 3UQAA 1IHVA 1IGDA 1KC8C 1JBMA 1ZUD2 3PMTA 4II1A 4LNPA 1VYTA 3CCMQ 3A8MB 1CKAA 2ICIA 5TSSA 4A9AA 1F2RI 1QWFA 1C9FA 4M78A 2DNFA 1H641 1DOYA 2DRMA 2LQKA 3MJ5A 4WAAA 1FMVA 3RT3B 4F8CB 2QEXA 2BIVA 3HM3A 4J6XA 4C8QG 1K53A 3E2UA 4ANXA 2K5LA 5GANe 2SEMA 1GOZA 3UATA 3JSCA 1UHFA 1VQNA 1YNTE 2DL3A 3JCMd 5I2SA 2HTME 4JWSC 1RAAB 4OMQA 1SRMA 1JJ2A 4PQPA 1KLVA 2LFIA 1H8KA 5A0LA 3OYLA 1ENFA 1BCOA 2IGHA 4LLGM 5GMKl 1AWDA 3IAS1 3P2BA 4IWQA 4OVVA 3SDZA 5BMIA 5GAN5 2IVWA 1N27A 3DHHC 4PS3A 5LJ5h 1KH0A 5E6JA 1VQ6A 3H0IA 1F9JA 4EFOA 4D2KA 1QVPA 3I9V1 4JWUC 1RL2A 3I5SA 2AL6A 4QVDA 4KSKC 1BB9A 3KWVA 2X3WD 2L3ZA 4B0MA 3OSSC 2V4IB 5M9OA 2KD0A 1GXIE 2P4RA 3UIOB 4LXCA 2N9PC 3CCQT 2P0PA 4FYWB 1UECA 4S0RA 4C92A 5GXGB 3ER0A 4ZGDB 3DHIC 1UGVA 3RKWA 2Y5PA 4B9KA 2MA9B 4R55A 3VQIA 2DZJA 2XEWA 1KFZA 3EG0A 1AEYA 1WGRA 1K4US 5IH2A 2EMSA 2J6OA 1AVZC 4MT5A 3VYHB 4CC4B 2IDYA 4IKDA 4MZMA 2RI5A 3MP9A 1VJKA 3Q69A 3W5VB 3TJPA 2FB7A 5GANh 1M1KR 2JM9A 4MGYE 1OQKA 2CSIA 1BMLC 1VQPQ 2K8CA 2CP0A 1QZEA 5CHWA 3G1JA 4DQ2A 1K73R 1D5XC 3OLMD 1X75C 2JTFA 5KYYB 3VJPA 3HRDD 2DTOA 1M2OA 3AHUA 2RMOA 2EGCA 2KT1A 4MZTA 2K9XA 3GNGA 4N0AA 3VS5A 1VCBA 3W1YA 4HASA 3TUOA 5LJ3g 2CH4W 1XO3A 2WP9B 1FNWA 4XTZA 1GBRA 1OPKA 2PE6B 3T3NA 3QG1A 3CPWS 1LJOA 2M19A 3LH0A 1C79A 2DFUA 3LH5A 1YNZA 3EG3A 4IURA 3PFSA 4QW2A 4IWPA 5BYRA 1NEGA 4IC7B 1GG3A 2K3BA 2KTRA 2ZCBA 2JZ3B 1M4ZA 1NBFC 2PVGC 3K9PB 2Q5WD 1OX9A 3CCVA 1K0XA 1Q5WB 2DIGA 2BS3B 1DOIA 1Y96B 2PVGB 2LUMA 3A5ZB 3TCJA 1R4NB 3EAEA 3PZ8A 4GGQA 4C4VB 4BGJA 3LGFA 2F69A 3JB9H 1UELA 1NEKB 4M7DF 5EE1A 2KQWA 4J9FA 5A0GA 1PSEA 3RPFC 2ZVNA 2M9UA 1V6EA 2PVOB 3JCMh 1VQ5A 4HA8A 4NS5A 3UA6A 1VQPT 1WDXA 1XEEA 4PJOD 3M56A 1QQRA 1P3QU 3V6CB 1G6JA 3DWGC 3X20B 2K5IA 2YRVA 2M16A 1YHQQ 1K76A 2ZZDA 3VUWA 3RNJA 4AS1A 1RI9A 4M75E 4FCYA 5FU6B 1L5PA 1LQBA 4L59A 3P1MA 1WJ4A 2GQIA 3APFA 1KQ2A 3QWZB 4UDUC 4W9FA 3UA7A 1UG1A 2C7MB 2QDYB 1HQRD 4A4HA 5FU6C 2JT4B 5JHBA 2ED1A 5D6WA 3FAHA 1B34A 4HCKA 2BB6A 2MJDA 1MG4A 3ETRA 1C76A 1M1GA 2QQRA 1OQYA 1SIJA 4FYVB 2EJFA 1Q82U 2LMCA 1IYFA 4C92E 1WHKA 1IGQA 1I07A 3VU3C 2KAJA 1FPYA 4M7AD 4ITKA 1Y8RC 2XK5A 1YJIA 1YWPA 1WI7A 2IY1B 1BI3A 3QCAA 4DWFA 3VUYA 1OX8A 1JU5C 1QKWA 3CCJT 1E7PB 3AE5B 1X6GA 4O6JA 3H1UA 2MI6A 4OGEA 1CQVA 2QHOA 2QILA 2BS2B 1ZBJA 3KFVA 2X38A 1RFAA 4HPLB 1TBEA 4PNOA 2HD5B 2LTOA 4DDGD 1SHGA 2V3NA 2COYA 4FA6A 5IT9E 2KXCA 5I21A 1MI0A 2J0KA 4WH4A 4NPNA 3U30A 5BMHA 1AHJB 1VQ4A 5CK9A 3AMZA 4X1VA 3SEMA 2JF5A 1SKUB 3FEOA 2KDEB 5FWBA 2NUPA 4K3CA 1PGBA 1UF0A 2AKKA 2VVKA 3NGPA 3RBBB 3CCUT 2B76B 3JYUA 4XTYA 1TY0A 3M54A 1F52A 3CPWP 2K25A 1R4MI 1KFYB 4FHKA 1Z9QA 2YT6A 3C4SA 2NUTA 3JCMe 2RJFA 2VWFA 1RLFA 1NLOC 4BI4A 3CMEA 2N1WA 4S17A 1M3AA 5IHNA 3G4SA 1OCSA 3JCMP 1M1KC 3RNFC 3U23A 2YHTA 2V1QA 1VQKT 1G83A 1X1MA 3ENEA 2JYTA 2CZOA 3A9KA 2NBVB 3JAME 2MMPA 4AQ7A 4HXJA 1FIQA 1H4RA 2KMMA 3SWNA 1YJWT 3A8LB 2KQ7A 1YQ4B 1KRHA 1FRRA 2O9SA 2MK5A 4EMKB 5G5GA 1E6EB 2K5PA 4BKTA 4KGSA 1M90U 1SE4A 3V7CA 3N1YC 3VR8B 5IN1A 4MGIE 2YUNA 5HK3A 1NJIC 1L0VB 1PG5B 2YXYA 4ORZA 3Q2AC 4BY6B 2YDLA 2M8SA 1FMAD 4RTWA 2FIFA 3R3MA 4FLHA 4C7YA 3OSVA 1EZZB 1TUCA 2CP5A 4CI0C 3BW1A 4IM2A 3NVYA 1H8CA 2VGMA 3OYEA 2E6XA 1J8CA 2VXEA 5EDSA 1N9RA 1KHIA 5GANf 1I4GA 2A3LA 4DOWA 2I4KA 1V8CA 2PPHA 4FYYB 3MC8A 3MJWA 2ENMA 1T0YA 2MWPA 3MHXA 4XTXA 3JSVA 2K22A 1ABQA 1TWBA 3CD6T 2PUKB 3A9JA 1I5LA 4IM0A 5L95C 2IGDA 3SDLC 2FL7A 1K1ZA 3QZ9B 1AARA 4RF1A 1XNIA 4ZYSA 1WQWA 3DBSA 1DOXA 2O9VA 3DVGX 4IIMA 5AZFA 1SF9A 1VDVA 1EO6A 2G9HD 2FUHB 1IP9A 2DZIA 3CCLA 4MM3A 3PT9A 2O6VD 4NAWA 2PUOB 3ZFJA 2EKHA 2VV5A 1FMWA 4PJLA 2KI7A 4JRIA 4FL6A 4Z89A 2NUZA 1RYJA 1WM3A 1QT9A 4EMKC 2BKFA 3L08A 4JX1C 3A1QB 3WAPA 4C80A 1X6BA 4MJSA 3BFMA 2YVCA 3L2VA 2CP6A 3MP1A 2D3GA 5FRNA 4YWGG 4C8QB 3ZVVA 4F7ZA 2O4XB 3ZEHA 2L05A 4OVUA 4OMOA 2RDGA 3ML9A 4DHZB 1ZDVA 3I3TB 2JTEA 3L0WB 3W1SC 4R0KA 2LNHB 2EYQA 4OB2B 3VS2A 3TEEA 4E47A 2FEIA 3NMZC 3OS2A 1UDLA 4K7WA 1IZ6A 2HKNA 2H3EB 3LWHA 1QILA 5ECAA 1YITA 2CKHB 2K4YA 2BZ8A 4PFZA 4ELZC 1GNUA 1G8XA 1WX7A 3A9JB 4M7DC 1K50A 4M7DE 3AEGB 4P7IA 3WALA 3E1SA 4Z88A 2A28A 2J0JA 1QWEA 5GAMh 1YHQA 3G6EQ 5CIUA 2JN0A 2R2OA 3T3OA 1EM7A 1C0MA 1KC8R 1X2QA 3REAB 3H41A 3Q1JA 1M9SA 4HCPB 3INZA 1RADB 2A4ZA 2RAJA 1D3BA 2RR9A 1WLPB 3ZL7C 4LNFA 4F1SA 4W9KA 2ZPHB 1T3QA 4KGVB 1XLPA 1N62A 2PTLA 1KJWA 4FXCA 1SJED 2ZNVC 1NJIU 2GCXA 4OMMA 2VB6A 2JUOA 2KFKA 4Y92A 5EG2A 3AE4B 2CSKA 4J6WA 3CCJQ 1V1OA 2OEDA 1I35A 2MCNB 3BZDB 5LJ5g 2HE7A 4M00A 2GI9A 1IPGA 2J6KA 3DQVA 3OYAA 3CCRT 4KV2A 2HBWA 4L6V5 1HK9A 1E8YA 1B3QA 2DAQA 2MAMA 3GZNB 3QHTA 1YIJT 2KXDA 4FM4B 2ZCFB 1X01A 4OF1A 2DXBA 4PJOC 1PUTA 1UUPA 1ZXIA 2KNBB 4JRQA 1D1BA 2XDPA 4DXAB 5KYWB 1I0CA 2MH7A 3NHNA 1Y0MA 1EF5A 1ZOYB 5GAOq 1UWXA 3U4EG 4EZLA 3IG3A 3TSZA 3C95A 5D6JB 3VVWB 2RPVA 1N8RC 2KC1A 4HPMB 2IG0A 1S72A 3L2QA 2VH1A 2DZ9A 2EYXA 1Q86U 1BIBA 1SE9A 4EOYA 2YLCA 3HFNA 4DDID 3P0CA 3H9DA 3O8VA 3MP8A 1UBQA 2GBKA 4GMVA 4II2B 5AUKA 2NTTA 1C77A 4LE9A 3SHWA 2MOXA 5GAN6 4LDTB 4TQ0A 1AZGB 1MV3A 1W6XA 1WZ3A 2KK8A 1WSPA 4KRTA 3VRBB 1UWMA 3AE2B 4OHJA 4ZN1A 3W9CB 3EFOB 1VQMQ 1JB0E 4E7JA 2HQEA 2LJ0A 1YI2A 2KDSA 1OI1A 5FR6A 3UIPB 4XTUA 4A4GA 4WWMA 2FZKB 3EC8A 2KYBA 5LJ5f 2J7QB 3L4PA 2KRNA 2M17A 5GMKi 2CP7A 1WXSA 4K7UA 4N6EB 1S72T 3PTFC 2WXNA 1SGHA 1K9AA 1O75A 2KJRA 5DPWA 3RN9C 1NI2A 2RM4A 3P4PB 3CMAA 5EE3A 3FIFA 3URGA 3AB5A 1M27C 5LJ5j 4C8QD 4F16A 3A33B 3RNEC 2DBMA 4XU1A 5KYYA 2EQUA 3PGEA 4JUVA 2UWQA 2FHDA 1N6AA 2AZSA 3BYTB 4K7SA 3W2DA 2JTMA 1AW7A 1WR1A 1WXUA 1NPPA 2C7NB 1D0ZA 1HD3A 2EW3A 3G71Q 4DBQA 5KYXB 2XKOC 4ESRA 2JY6A 2KOXA 1LPLA 1NM7A 4LDWA 3ONSA 2VYTA 4ARCA 4M77G 2KT7A 2LT1A 2MP2B 3OAWA 1WQ7A 2X35A 2CHZA 1OU9A 1BI1A 3EA6A 3PMIA 1NDDA 3DDCB 2C0OA 1PM3A 1YX6B 4HDQA 3M9QA 3X24B 1ZDXA 2WX0A 1PQSA 1H3HA 3RUIB 3I57A 3CMAT 5GJWB 2QQSA 3BVZA 2JYEA 2GBQA 1KQ6A 2IZVB 3CCQA 1EX4A 2ONQA 4WWNA 5GAN4 1OEBA 3GOEA 2C60A 4P1CC 2YRCA 3JCMX 1QVFS 1N5WA 4MMLA 2E3HA 1WHGA 1WE7A 3KLSX 4M75C 1VQMT 3TEXA 1MJDA 2MEKA 4Y91A 1WMHA 3CSTA 4X9CA 1J7CA 1VZ7A 5JXVA 3AE3B 1WXAA 5IP4D 1L0XB 3VXWA 1X27A 1V80A 2KACA 2M0YA 2N0SB 3CWIA 4KGTA 1H92A 1PGAA 2VUBA 4PLLA 3ZJVA 3I56A 1I7HA 3META 2WDQB 4IUMB 3O5ZA 4M77C 2EQIA 4RG2A 3KW5B 4W9DA 3THKA 2E5QA 3ZKJC 5FRMA 2WWZA 1MNDA 1P7FA 2J0MA 2MRPA 1YFNA 1Y57A 2K5FA 2YSQA 3G6ET 3JCMW 2KR3A 1MHXA 1MVKA 1E5WA 1UBIA 1QKXA 1ET9A 1WIEA 2K7AA 2QEXT 2DEQA 4C56C 1K8AU 1JXOA 3L2ZA 4NAMA 2D3BA 5CCAA 4KUIA 1PC0A 1UUEA 3OYHA 3EFRA 4C0DC 1PRLC 2VZKD 1SJHD 3M57A 1FCLA 3FILA 2DD5A 1ZHIA 3CEYA 2EKOA 1VQ6T 3OYMA 1E9MA 1EF1A 3QQ8B 5C3JB 4ZDVA 2QI2A 3QIIA 3NG0A 2YLBA 2MIOA 3BY7A 1MG8A 5D7UA 1XCTL 2EKEC 2JXTA 1WMHB 2DL5A 2F5TX 3MEWA 1JJ2P 2WYQA 3Q6BA 2V26A 3DOWA 3GF5A 2CT4A 2IGGA 1YN4A 2F2VA 3AE8B 4J9HA 2OTJQ 4M78C 1K9MC 1L7YA 2QAZA 4BE0A 1V1PB 2V3SA 3PT2B 2JVVA 1ABOA 3AEAB 5JZEB 4XAXB 1WXVA 4M78D 3QARA 4NAWB 3ME9A 1W70A 1AWOA 2OI3A 1YP5A 2L5QA 4ZHOA 1ZSZB 4YSXB 3C0RB 3HFOA 3H0FA 5KE2A 2WXHA 2IO3B 3VV0A 1QVFP 1I1JA 3CSFA 2OJWA 4HVUA 1GC6A 3R7RA 3QYGB 3TIXA 3APDA 2IYDB 4A3OA 3R8BA 1Y07A 1V29B 2KBTA 2VKNA 2ZPFB 4UC4A 1KD1U 2INNE 1MUZA 2RD0A 4PS8A 2C7HA 2Y4YA 3NJTA 1G3YA 3J81E 1EU4A 1UTIA 1XD3B 3ZNHB 2HL5C 2IIMA 2BKDN 3X23A 1E0ZA 2ZW0A 3IAM1 3PRZA 5I11A 1PCXA 2E5KA 2DLBA 2SRCA 4QKUA 3EGRA 3FRNA 8AT1B 4K81A 2YUPA 1VQ6Q 4LD6A 2B3AA 3DVGY 3PSEB 4US8A 3P63A 3CCVT 3OY9A 2RAIA 4DQOC
chains in the Genus database with same CATH topology
1U06A 3WA0A 3OJ4B 1V9JA 2F2XA 2M4NA 1NYFA 4MSMB 2EYWA 2FRYA 3PVLA 1OCUA 3A9KB 2O2OA 2J6FA 3AI5A 1TGZB 2CUDA 1GUAB 3O65B 4WWOA 3L10B 3VS0A 1AWJA 1WM2A 2KWCA 2EVRA 2M0XA 1AWXA 1ZGUB 5C23A 5CTRC 2KNBA 2BGFA 4EZKA 5J18A 1KMDA 2DYOA 3M95A 3ZDMC 4G50A 3I35A 4N9F4 3SU8X 2LWPA 2DL7A 4GXBA 4CC7A 3ZNZB 4IKBB 3QWXX 1S1NA 4RTTA 3CF6E 2V6VA 2G45B 4TKNA 2JS2A 1OOTA 2ZCCA 4RTXA 4JPBW 2LVPA 2DBKA 1T3LA 3H6NA 1WFYA 1RLPC 4FADA 1RAXA 2RGFA 4M8MA 3LDZE 4I6NB 4MDKE 3VS7A 5JH5C 2NS5A 4LUEA 3VAWA 4JGHB 1G2BA 3QC8B 1OTRB 4GIVA 1GD5A 1WGHA 3SD5A 1KM7A 1TTNA 3PV1A 2A5UA 3VFKA 4WJNA 1PRMC 3V6EB 1WGDA 1GFDA 3T8MA 1BT0A 2FCNA 1V86A 1XOVA 4B95A 5TR5A 2W10A 3N30A 4IM3A 4NY0A 3R7QA 2GOWA 2DYMA 1V1CA 2JZZA 2N9XA 2DAJA 4FSSA 2KX0A 1GJZA 1WX8A 2NCNA 1L2NA 3HPBA 1E7UA 3IHPC 4AKVA 1H6HA 3FJ5A 1KSWA 4ON3A 4W9HA 2ZNVB 2REAA 5J17A 1CSKA 2LQWA 2DF6A 1WX9A 2N4FA 4W9EA 1S3SG 2NBWB 2LUEA 4KIKA 2PEAA 5C1ZA 1K8RB 4W9CA 3H7PB 4RM8A 1WR6E 1P9DU 3A98A 3UF4A 2J05A 1BBZA 2HEQA 3NOBA 1AD5A 2CU1A 1JO8A 2BTTA 2G4DB 2KVRA 3HIZA 1E7OA 2CDTA 3REBB 2KN5A 1TG0A 1KJTA 5KHQA 4K1RB 4A20A 2IO1B 1EUVB 3TMPB 3KVFB 4DK5A 4LUDA 3AXCA 1VYVA 1KIKA 2JM8A 4E74A 2ASQA 4KDLB 2AEHA 2CHWA 4ANVA 2DYBA 4WJOA 4ANUA 2LZ6A 3C0CA 4G0NB 2JPHA 2O6VB 5IXFA 2FPDA 1AZEA 3H7PA 4EKUA 3VS3A 4KIKB 3M63B 5G55A 1QCFA 4BKGA 4BOZB 4G11A 2OJRA 3IFWB 2KGTA 2C0TA 4KZCA 3HPCX 3WANA 1WRDB 3LUIA 4Z8AA 1WX6A 2K2MA 4X57B 2D2QA 2DNUA 2D1XA 5DPTA 4XC2A 1WXTA 3M0UA 2DL4A 2BKRB 3M0TA 2ROLA 2MBHA 3VTWA 2K79A 3VS1A 2L73A 2ZVOA 3DCGA 2KKCA 1UD7A 2KDIA 2R2QA 2K39A 2ROTA 2FCQA 4JZ4A 2DILA 3ECIA 2LGDA 2LZ6B 4IIOA 3R66C 4PYUA 2MBQA 1WYWB 2XBBC 2FPFA 3NZSA 4P2JA 2FIDA 1S1QB 2KTFA 4CC3A 2KO3A 1YX5B 1K0SA 1GL5A 2GMIC 2RPQA 3DVNV 2AKLA 2LRUA 1UHCA 3I5RA 2D10A 1WJ6A 1GCQA 2LJ5A 1ZSGA 1LM8B 4HVVA 2IO0B 3M0SA 2K8HA 4MELA 4LJOB 3ZRCA 2KRMA 1WXMA 4EUTA 4F14A 2KEAA 3L13A 3PLVA 1ZUKA 2RN8A 2CH4A 3W1SA 4M4ZA 4KSLC 1XTEA 2D07B 2GBMA 2DX1A 1SRLA 4OMPA 5G2NA 4ICVA 5CHFA 2EYZA 4TV3A 2BZYA 2MCNA 4RMAA 4AJYB 3MTNB 1Z2MA 3IBEA 5CX3A 1YJ1A 4HVBA 1JXMA 2LP5A 3M0PA 5AZHA 4XZ4A 2L76A 1M30A 1M8MA 5IHIA 4B6WA 4NQLB 2MW5A 2M1MA 3L16A 2L2PA 4OMLA 2ZZPB 4PYZA 3NS8A 3HM6X 2PTKA 1X43A 2MBEA 4IG7B 3M0RA 1NLPC 2NPTA 3QWYA 4ZNXA 3N32A 4MSQB 2WX1A 2RNAA 2V1YA 1VA7A 1E6HA 2G6FX 2KRSA 1M3BA 2MLBA 1TUDA 2KMAA 5L23A 3VS6A 1VD2A 4GBQA 5BO4B 1OEYJ 1JQQA 4ZRIA 2AR5A 4E3CA 1V5OA 2KMCA 2JVCA 2BZXA 2DL8A 1C3TA 5DPSA 1UJ0A 2KQSA 3Q3JA 1ARKA 2L0AA 2MBOA 4AFSC 2O2VA 5DPRA 3ZNGC 3B1LX 4LJPB 1I42A 2RPNA 5AEKB 1GCPA 3L54A 3ZIMA 3PLUA 3KUDB 2W9NA 1WFWA 1U3OA 2LGXA 4LN2A 4TUUA 1XQQA 4RTUA 1WXBA 2FPEA 2GBRA 3A4RA 3TCAA 2ETTA 4A63B 4DEXA 3ZTCA 3PHXB 4D8KA 3S2AA 1HSQA 1WH3A 1C1YB 3NZUA 2YUOA 2K6QA 4TQ1A 2KC2A 3QX1A 3ALBA 1E8WA 1Q1OA 3SHQA 1WZ0A 2NWMA 2LI5A 3RCZA 5D7GA 3EHRA 4J9BA 3M3JA 2A37A 2Z0EB 3I9QA 3ZLZA 2KDBA 4BFRA 2VRRB 2O88A 2D8HA 5KHOA 4AOFA 2AL3A 2RSUA 3DBHI 4RM9A 5HCKA 2CREA 3OJ3A 4K11A 1WIAA 1RLQC 1CKBA 3AU5A 1UH6A 3RYTA 4JLCA 1R4NI 2RQTA 2IBIB 2DA9A 2BYEA 4I6LB 3RZWC 2FCMA 4WJQA 4D8DA 4RTYA 3V61A 2WDTB 2IWLX 1LXDA 4E6RA 1WE6A 3QIJA 3VDZA 4G3XB 1HJDA 2PZ1A 2LGYA 2A36A 4IW0A 3A4SC 3RULA 4RUGA 1OGWA 4GLMA 2EMTA 5FWCA 4A3PA 2NBUA 4GB9A 2EPDA 1WA7A 4BVUC 1M3CA 4HJKA 4OXWA 1YWOA 3GBQA 2KE9A 5IA7A 2GTOA 2JXBA 2I1JA 4FJYA 3DVNU 2MP2A 5GMVA 4AZ9A 3FOGA 3ZUNA 2KWVB 1MV0B 2CSQA 2ECZA 4JJDA 2DVJA 4J9EA 2EBPA 4EIKA 2JS0A 1YCSB 2C9WB 3PS6A 2ZPYA 3CMMB 3EECA 2GTJA 2O6VA 2MBBB 2HCKA 1A0NB 4W9JA 3VS4A 4BKSA 2KROA 4WWPA 1XTNA 3WAOA 3HK0A 3BY4B 2HSPA 2L3QA 1EFNA 1T0JA 2KFJA 2V14A 3PRMB 4GN1A 4BBNF 4KVGB 4RTZA 1P0RA 1M94A 3ML8A 2L8JA 1FYNA 2MWSB 1SIFA 2C5LC 2ZPNA 4ZRKA 2KANA 4ZRJA 1SHFA 3NHEB 3AU4A 3JW0X 1FXTB 2BYFA 2K9GA 1PKSA 4GDKB 4ICUA 2GBJA 2KHWB 3PHWB 4MGZE 1O7KA 1E90A 1PWTA 1HE8A 3KYCD 2X3XD 3CQTA 1WYXA 5HKHA 3QAQA 2MSED 2J7IA 4EEWA 1V5TA 3EHVA 3APCA 5EC7A 2Z59B 3KYDD 2JW4A 2KJHB 1ZLMA 1U4AA 4QT7A 1AWWA 2ED0A 2M51A 4I6PA 2CS4A 1FMKA 2L3PA 1SPKA 4GU2A 4J9CA 4GDLA 4AG2C 1J0GA 4JQWC 5IAAC 4CHKA 4OMNA 2HTHA 2FAZA 1YN8A 2CT3A 1V49A 2RQWA 4II3B 5E6NA 2JMAA 5AZGA 4W9GA 2LQNA 1J3TA 1UFFA 4HDOA 3HHMA 3AULA 4EZJA 4CC2A 1IO6A 1UZXB 4MGKE 3WIMA 4HVWA 4GOCA 2F2WA 2RQRA 2L3SA 3JV3A 3H7SA 1CMXB 3PREA 4LDTD 3PRPB 2JRHA 5LXHA 2JRIB 4WJPA 4WCIA 2XK5B 2YPSA 3ZO5B 2H8HA 2N1VA 4KDIC 3A1QA 3L17A 2DAFA 2AWTA 4IKBA 2RQUA 2A08A 4WQOB 1ZW7A 2BPSA 3PE0A 4AFUC 2HDAA 4NJ6A 2V1RA 4F17A 3R6NA 4E71A 2LX7A 2D0NA 3TL5A 1GBQA 3EGUA 2NVUI 3LJ3A 4HXDA 5L83A 2KJ6A 5J2RA 3ULRB 5FW9A 1V2YA 2KZRA 4FJVB 2NR2A 2GNCA 2LVQA 1QLYA 2GGRA 3VUXA 4AFZC 1GFCA 2OOBB 1WGGA 2DZMA 4J9IA 1GRIA 2MX2A 1LFDA 2NPTB 4KZ0A 4AWJA 1PKTA 4JJCA 3V62A 4IWOA 4M0WB 1E8ZA 2D8JA 1ZX6A 2CHXA 1UJYA 2YUQA 4AFQC 3IVFA 5CHVC 2N7EA 3NPFA 2N7DA 3JSVB 1WGYA 3PZDA 4GSWA 3KUCB 1X2KA 3U8ZA 4NNJB 2DZKA 2V4LA 3M0QA 3H0HA 2KXJA 1A5RA 4BKSD 3WAMA 4ANWA 2BYVE 3VHTC 1NYGA 4HLEA 2Y5BB 3IQLA 2BF8B 2G4SA 3NY5A 1SEMA 5E6PA 3ZRFA 2UYZB 4DBGA 3JVZX 4FBJB 3B0AA 3IQ2A 2J06A 3EG1A 4J9GA 1UE9A 1YIWA 1PNJA 1NEBA 3GZNI 1J19A 2L0FA 2FCSA 2K1FA 2FO0A 4CYEA 2FRWA 1WJNA 4JZ3A 2L7RA 3VRZA 3N3KB 4HCNB 2DJQA 5LLIA 2REXA 1NG2A 2DE0X 2D11A 1GC7A 2DM1A 2LCSA 3UQBA 2DRKA 3UF8A 2I1KA 1BK2A 5IHKA 2LRWA 2ZJDA 5D94A 3EG2A 3VH4B 4W9IA 1WJUA 2KDFB 2O2VB 1U5SA 2O31A 2REDA 4RTVA 2JT4A 2DENB 2XMFA 2RAKA 3QA8A 2C0IA 2BWES 4W9LA 3RD2A 1B07A 2KLCA 3KUZA 3PVQA 1RUWA 3PPAA 1XT9B 2JMCA 4M8NA 1WY8A 4JJBA 4J9DA 2YLMA 2EGEA 3VRYA 3K9OB 2PJHA 5D2MB 3UINB 4AP4C 1TZ1A 4PQOA 2CR5A 3EFUA 3MHSD 4JIOU 1Z5SB 1Z9ZA 4JL9A 2KTRB 1LCKA 2IY0B 1T3SA 3QJZA 2ZEQA 2N9EB 2KWUB 2Z0DB 1X69A 4MH0E 2QDLA 2LXAA 3V60A 2EYYA 2LASA 4XX5A 2GBNA 1T0HA 2G3QB 3TBLD 1N5ZA 2PNIA 1UGMA 3TVTA 3ZTDA 1PHTA 2JXXA 5JHAA 4PZGA 3X0WA 2LJ1A 3ZW3A 3VTVA 1OEYA 2ABLA 2JWZA 2AZVA 3RZFA 2K6DA 2BWFA 1WI0A 4AJWA 4FHJA 3VH3B 2KFKB 2RQVA 2AYOB 2OJ2A 1V81A 2DLPA 4URKA 2RF0A 3VTUA 3KH0A 2LMJA 3UGBB 1P1AA 4HK2A 1SSHA 4PS7A 4FJZA 2LD9A 2DX5B 2I0NA 3DYTA 4FN2A 3U7DA 4AG1C 2IO2B 2L0TA 2OAWA 4DEYA 3M62B 5E6OA 5GJVB 1JEGA 2L00B 1VYUA 1Q0WB 1JRUA 3Q3FA 3T9LA 2LJ3A 4MEMA 2W0ZA 1KOTA 2FNJB 3TSWA 2AK5A 3DBRI 3B08A 1YD8U 4GDLB 4MJSB 1D3ZA 2LVOA 1ZKHA 2MQJA 5I22A 4J6IA 3QK0A 3EHQA 2KT8A 2PE9A 5IXBA 4ZYNA 1GCQC 4CO7A 4BOSC 1W1FA 1OPLA 4BBNC 4FULA 2K6DB 2KX3A 1YQBA 4NQKE 1OV3A 2HJ8A 4P2IA 1AOJA 1BU1A 1RRBA 4AUQC 1E8XA 4DHJD 2B86A 2EGAA 1E6GA 4YL8A 1E7VA 3ZDTA 4GDKA 4LCDE 3BINA 1ZUUA 1WF9A 2DHZA 2LXCA 2FG0A 3DPDA 2KYMA 2WWEA 3D32A 1P98A 1ZUYA 4DHZE 4NJ7A 2KLGA 2K8BA 3ZNID 2ESWA 4ASWC 4DHJB 5LXIB 2CUBA 4HWIB 1ISNA 3DBLI 2DMOA 3UQAA 4LNPA 1VYTA 1CKAA 1QWFA 2DRMA 4WAAA 3RT3B 4F8CB 3HM3A 4ANXA 2SEMA 3UATA 1UHFA 2DL3A 4PQPA 4OMQA 1SRMA 1KLVA 1H8KA 4OVVA 4IWQA 3P2BA 4PS3A 1F9JA 3H0IA 4EFOA 3I5SA 2AL6A 4KSKC