2DYBA

The crystal structure of human p40(phox)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
322
structure length
297
Chain Sequence
AESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Neutrophil cytosol factor 4
publication title Full-length p40phox structure suggests a basis for regulation mechanism of its membrane binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 297
sequence length 322
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00564 PB1 PB1 domain
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dybA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dybA03
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2dybA01
2LASA 4CO7A 2KR3A 2IO1B 4AKVA 2KROA 3PPAA 2DMOA 1HD3A 4JQWC 2G4DB 4A3PA 1KM7A 1I1JA 5J18A 1BT0A 4FLHA 3NY5A 4BBNC 2JWZA 3T8MA 4ZRJA 2OJ2A 3KYDD 3TMPB 1ZSGA 4AFSC 4M8NA 5CHFA 1XD3B 4WWPA 4OVVA 1JEGA 4HCKA 2NBVB 4DHZE 5FWCA 1GCQC 2FPDA 2CR5A 2K9GA 1V80A 4E74A 4HPMB 1WJ6A 5DCNA 4CYEA 4TKNA 2RR9A 1H92A 3LDZE 1GL5A 4I6PA 2CUBA 1JQQA 3W1SA 2MP2A 2PE6B 4HCNB 2FRYA 2KFKA 2YLMA 1H3HA 4RTTA 4WAAA 2D2QA 3H7PB 2LUEA 3TIXA 2YT6A 3PZDA 4RM8A 4GDLB 1K8RB 1WY8A 5D6JB 1WXVA 1TUCA 4OMLA 2RD0A 5IXFA 2KC2A 3DCGA 2M51A 3QQ8B 2KKCA 4J9HA 1IP9A 4RTVA 3DBLI 4PS8A 2XEWA 2GGRA 1NEBA 2GTJA 4W9CA 4IWPA 3TSZA 2CSQA 1P0RA 5AZHA 4DWFA 3JYUA 1LFDA 4E71A 4JL9A 1QWFA 4FULA 1WI7A 5JZEB 3V6EB 3KW5B 1WFWA 5GJVB 4IKDA 4PQOA 1ZUKA 2DX5B 5C23A 3H0HA 2WWEA 1WXTA 2C60A 2LP5A 2I4KA 1OPKA 3AU4A 2FCNA 4HDQA 4W9KA 3EGUA 4J9DA 3QIJA 2DE0X 2AKKA 4GU2A 2CH4A 3DBRI 3C0RB 2I1JA 2OJRA 4ORZA 2R2OA 4RMAA 4F8CB 4NAWA 2PJHA 2AKLA 5HKHA 2M1MA 1Z9ZA 4FJYA 3QAQA 2R2QA 1UJYA 2K8HA 3V60A 4OMNA 4LJPB 3VUWA 1WLPB 3MTNB 4AUQC 3A4RA 2JT4B 4WJQA 1A5RA 3X23A 1GCQA 4IKBB 3IFWB 4DHJB 2EYXA 1EF5A 1WJNA 2A08A 3ZNZB 1MG8A 2KHWB 4WQOB 3WA0A 2F2WA 4CC2A 4X57B 4IKBA 1E8XA 1YX6B 4MELA 1UE9A 1LXDA 5GJWB 4MGKE 2HDAA 1WX8A 1J3TA 3RYTA 1WGDA 1V5TA 2VRRB 2JVCA 2MA9B 3HM6X 2DZJA 2FPFA 1JRUA 3L10B 1WI0A 1E90A 2AWTA 2LRUA 3DBHI 4FSSA 3NS8A 4HWIB 5JHAA 2EYYA 2PZ1A 2Z59B 3ZRFA 2MBOA 1T3SA 1Z9QA 1G83A 2DRKA 1JXOA 3C0CA 3PVLA 4B9KA 1SHGA 2GBJA 2KNBB 4W9LA 1WXSA 3NOBA 4E3CA 1WYWB 1TTNA 4G3XB 1SPKA 2ZNVB 3PREA 3VS3A 1RAXA 3RT3B 4K11A 1VYVA 2D8HA 1X1MA 1K4US 2DLPA 3V61A 2EQIA 1K1ZA 2MBEA 4RTUA 2JTEA 3O5ZA 2KNBA 4GIVA 2DL5A 1Y8RC 1GC7A 5C1ZA 2ZVOA 3QK0A 3DYTA 2C9WB 2LNHB 3REAB 5CX3A 2RAIA 2DX1A 4XX5A 1B3QA 4J9IA 2UYZB 2M8SA 1GD5A 4AWJA 2B86A 4MJSB 1NM7A 4B6WA 3EG2A 4ANUA 2VWFA 3SDLC 3EG1A 3M0SA 4JJDA 1WR6E 4LDTD 2DRMA 3ZDMC 2KQ7A 3I5RA 1SGHA 4EIKA 2J6FA 2O6VB 1J0GA 3WAMA 3I5SA 4LUDA 3ALBA 2J7IA 2J6OA 2DM1A 2DNUA 1WGYA 3ZIMA 2JXBA 3HM3A 3APDA 1ABQA 2M0XA 2BZXA 2LJ1A 3IVFA 2EGEA 4K81A 2MSED 3TCAA 2MCNB 3QHTA 3TJPA 2K6DB 3VQIA 1MV3A 5LLIA 3SHQA 3MJWA 2MW5A 4HLEA 5KHOA 2YUPA 1RUWA 1V9JA 2L00B 2CT3A 1P9DU 2JUOA 2BYVE 3M0PA 2LVOA 1RFAA 3JVZX 4FADA 1QZEA 3ZNGC 2DYBA 2MCNA 5IXBA 4AJYB 2GNCA 4FHKA 3I35A 2D11A 1E7VA 2RGFA 2KX0A 4AP4C 1RRBA 2D3GA 3VDZA 1GFDA 3LUIA 3RBBB 2NWMA 2EKEC 5JH5C 2D8JA 3ML8A 3ZKJC 2MBBB 2DL4A 2I0NA 4CHKA 4WJNA 1WMHB 1OV3A 3VS1A 2BF8B 2LI5A 2L73A 1H8KA 4BOSC 1SRLA 3UA6A 2K79A 4RUGA 3THKA 2FIDA 3DVGX 2EGAA 1WJ4A 4GDKB 1I0CA 3VXWA 1AZEA 3VS5A 1S3SG 3R7QA 3W1SC 2C5LC 1M3CA 4HASA 4HVUA 4IM2A 1GFCA 1GC6A 2YUOA 5IAAC 2HE7A 1R4MI 2LZ6B 2BTTA 2CKHB 3V6CB 2LGXA 2FG0A 2LQNA 4ZDVA 4HK2A 1UGMA 4HCPB 1M8MA 3PT2B 1NYGA 2O88A 3UF4A 1M3AA 2KDBA 4RM9A 3A9KB 2KTRA 1N5ZA 1WF9A 1NBFC 3A98A 2KLCA 1V86A 3ONSA 2KT8A 5E6OA 4FA6A 2KBTA 3P2BA 2DENB 1XQQA 2NPTA 1PKSA 3KFVA 3UQBA 4ICUA 2GBQA 3ZL7C 3PRZA 3DVGY 3ULRB 3QX1A 1L2NA 4WWOA 3KVFB 4AJWA 2C7NB 1MUZA 2KOXA 3N3KB 3QWXX 2OOBB 2KDEB 1WX9A 4DEYA 4KDLB 1OGWA 2GBNA 3M0UA 2LQWA 1WM2A 3H0FA 4W9JA 1MV0B 5D94A 5FWBA 3NZUA 3SD5A 4TUUA 2D1XA 2D0NA 2WX0A 1XT9B 2EKHA 2LXCA 4P2IA 3HHMA 3M62B 1UZXB 1SIFA 1M94A 3RD2A 1TUDA 3PV1A 2EGCA 4HJKA 4KIKB 2WDTB 2N9PC 3AXCA 4KVGB 3B1LX 4J9EA 1LQBA 2RPNA 4II3B 3KH0A 4NJ7A 1ZBJA 1R4NI 1IPGA 1LM8B 2LGDA 4P2JA 2KYMA 3M3JA 4IUMB 2W9NA 2NR2A 2L2PA 3L54A 2FCQA 3R6NA 2EYZA 1NDDA 5IHIA 3PS6A 1UGVA 3D32A 2VKNA 3QCAA 2GTOA 2DL8A 4DHJD 1AWXA 1SEMA 1OEYJ 3APCA 3OLMD 4F17A 4AFQC 2BZYA 3ZNID 1GCPA 1E8WA 2K1FA 2ZJDA 3OJ3A 4JZ3A 2AYOB 1P1AA 2EMTA 1YN8A 1YIWA 2GBMA 1KJWA 3H7PA 3RZFA 2JXXA 1SRMA 1WRDB 2KXJA 1WR1A 4GDLA 1ABOA 3VRYA 3SU8X 1V1CA 2HJ8A 4M0WB 3H6NA 1RLQC 1IYFA 3WANA 3OAWA 4YL8A 2K25A 2FPEA 3ECIA 1YP5A 1AWJA 3VS4A 3IG3A 5ECAA 3H9DA 3IBEA 2ASQA 1AD5A 4JPBW 1GUAB 1WXAA 2N9EB 4GXBA 1Z2MA 1OCUA 1QKWA 4DDID 2FAZA 2VVKA 3UIOB 1WX7A 3N30A 2JM8A 4E6RA 2CUDA 2XK5B 2CSIA 2P4RA 2KRSA 1HJDA 2ZNVC 2IIMA 5L23A 4X1VA 2K8CA 4Y92A 4I6LB 1ZLMA 4J9GA 2RN8A 2CU1A 1XTNA 2DZKA 1B07A 3NGPA 2NBUA 4KV2A 2DAJA 2V3SA 1O7KA 3M95A 2KWUB 4AG1C 1VCBA 4D8KA 2LXAA 1PKTA 3AU5A 2L7RA 2L8JA 1WM3A 4JJBA 3PHWB 1ZUYA 2AZVA 3UIPB 2X3XD 2WX1A 2A36A 4W9IA 2MRPA 4W9DA 2BYFA 1UHCA 3QWYA 2A4ZA 2KGTA 1AVZC 2IO3B 1V49A 3KUCB 1WDXA 2MWSB 4HXDA 4AFUC 2AL3A 2KDFB 4IIMA 3NMZC 2ZCBA 2KWVB 2BKRB 3ML9A 2L05A 2BWES 1RLPC 4MM3A 3AULA 2JT4A 2G4SA 3DDCB 2DBMA 1E8YA 4IW0A 4A3OA 4PS3A 4K1RB 5D7GA 5EC7A 2O6VD 2PTKA 1ZKHA 4ZYNA 5D2MB 2A28A 2KTFA 2DF6A 2KANA 3LH5A 1K0SA 2O2VB 3PSEB 2RPQA 3EECA 2B3AA 2O9SA 2ROLA 2N9XA 3W1YA 3EC8A 1HSQA 2UWQA 4KDIC 4G0NB 3N32A 4NPNA 2XMFA 1JXMA 3A33B 3PGEA 1JO8A 2CZOA 2IY1B 3QC8B 2HCKA 3BINA 4IIOA 2V1QA 1ARKA 2K39A 4BKGA 4ON3A 2ETTA 4IWOA 4GBQA 3BY4B 2KK8A 2CS4A 1QWEA 2KJHB 5L83A 4DDGD 1QKXA 4FBJB 2IBIB 2W10A 5TR5A 4WCIA 3K9OB 2CDTA 1E6HA 5IHNA 2REAA 2MIOA 2BPSA 5IHKA 2DYMA 2KX3A 3UF8A 2J0JA 4XC2A 2L3QA 1RLFA 2D07B 4J6IA 1AEYA 2MQJA 4G11A 3CMMB 1WH3A 2V1RA 2N7DA 3ZDTA 2HBWA 5CHWA 1GNUA 4GOCA 5HCKA 4KSLC 2KRMA 2MOXA 3L13A 1WE7A 1ZW7A 5J17A 3L16A 2KMCA 3VHTC 4ANXA 4EZLA 2L3ZA 1W70A 3DPDA 3H41A 2CHZA 2FRWA 3TBLD 3VS2A 1U4AA 2RQVA 4FN2A 3FOGA 4AFZC 4MJSA 5FW9A 3A1QB 4BBNF 1OOTA 2JZ3B 3V62A 4BGJA 4F1SA 1X27A 5AEKB 2RQRA 4MGYE 3ZO5B 1U3OA 2F2XA 1YCSB 3EG3A 4Z89A 2O6VA 5GMVA 2A5UA 1C3TA 4XZ4A 2OI3A 2L3SA 3UATA 1UUEA 3H1UA 4RTYA 4LE9A 1AARA 3DVNV 3I9QA 3K9PB 1YNZA 1WXUA 2RQUA 2EVRA 2BWFA 2ABLA 1UBIA 1EF1A 2N1WA 5LXHA 2LMJA 2Z0DB 1WX6A 2K6DA 2IZVB 2BKFA 1EUVB 1NYFA 4NQKE 4OMPA 4F16A 1K9AA 2FCSA 1S1QB 2O2OA 1QLYA 3ZUNA 2DZIA 1G6JA 1U5SA 4LUEA 2WYQA 1X43A 1V5OA 2N4FA 3NPFA 1Q0WB 1Q5WB 1X6BA 1ISNA 1KMDA 1Z5SB 5KHQA 2IO0B 2K6QA 3ZLZA 3U8ZA 3RCZA 2GBRA 2EBPA 2CREA 2LRWA 3PRMB 3R3MA 1NG2A 3A9JB 2EMSA 3HIZA 2J6KA 5E6PA 2MX2A 1UTIA 2FO0A 1WMHA 4II2B 2GMIC 4AG2C 3ZNHB 4DHZB 2YPSA 2M0YA 1Y0MA 1M3BA 4JGHB 1UELA 3ZRCA 3TVTA 2Y5BB 1K0XA 4LDTB 3A9JA 3QWZB 4GDKA 1VYTA 2YDLA 3JV3A 2RAJA 2HD5B 4BKTA 2EYWA 3GBQA 2ZPNA 2MBHA 2ZZPB 4IC7B 1P98A 3H0IA 1V2YA 2L0TA 1X2QA 2IWLX 3UINB 4URKA 5CHVC 2GOWA 2ESWA 3EFUA 1GBRA 1UECA 4ANWA 2LZ6A 1AWWA 2KXCA 4LN2A 3VH4B 3KUDB 2N7EA 1E7UA 2HSPA 1WZ3A 1BK2A 2JW4A 4OMMA 2W0ZA 2REXA 1NLOC 4LJOB 4DK5A 1E5WA 2DYOA 5DPSA 3VTUA 3A9KA 4OXWA 1BU1A 1EO6A 3Q3JA 2KC1A 2BZ8A 4KZCA 1CMXB 5I11A 1BB9A 1WE6A 2CHWA 1LCKA 3M0RA 1GRIA 1GBQA 1F9JA 2JMAA 2Z0EB 1TG0A 4PYZA 3VS0A 3WAPA 2KFJA 3APFA 1T0HA 2ED1A 1UD7A 4ICVA 3RZWC 1H8CA 3QJZA 1CSKA 3TSWA 4WJPA 1HE8A 1J8CA 2NS5A 2PNIA 1UBQA 3Q3FA 1Y57A 1OEYA 1NI2A 5AZFA 2LGYA 3GOEA 1CKAA 5CTRC 1AWOA 1E6GA 1KFZA 2FCMA 3EHVA 2JRHA 2O9VA 1FYNA 3WAOA 2DHZA 3VS6A 1PWTA 1AZGB 1FMKA 5J2RA 1WGRA 1AOJA 4ANVA 3NHEB 2REDA 3L08A 3ZTDA 2CH4W 1V6EA 4MDKE 3WIMA 2KT1A 4TQ0A 4HVVA 1XOVA 3M0TA 1U06A 4HPLB 3RULA 1UJ0A 1X2KA 2C0TA 4KIKA 2MP2B 2DILA 2KFKB 2AK5A 4PYUA 3B0AA 1NEGA 4EZJA 2DL3A 2EW3A 1VYUA 1ZUUA 4GGQA 2J0MA 5E6NA 1UG1A 5FR6A 1P3QU 1WIAA 2KLGA 1WZ0A 2ZPYA 4MEMA 4IG7B 2MBQA 2NUZA 4B95A 4HVBA 2C0IA 2L0AA 2LX7A 1Q1OA 5BO4B 1YD8U 3VFKA 2ZEQA 2FUHB 4LNPA 4BOZB 1CKBA 2AEHA 2FIFA 3IHPC 4FJZA 4I6NB 4KZ0A 2H8HA 2PE9A 2CHXA 4J9CA 1WJUA 4IM3A 4HXJA 5G55A 2IO2B 2L0FA 4W9EA 3DOWA 4NNJB 3M0QA 1PNJA 2JS2A 2KWCA 2D10A 4PQPA 3CF6E 4J9BA 2C7HA 1H6HA 1GJZA 3PVQA 4J9FA 2ECZA 4BKSA 3ZTCA 4ZRIA 1GG3A 1M27C 3UQAA 1OQYA 4M4ZA 4JZ4A 4HDOA 4GSWA 3DQVA 2YUQA 3ENEA 4IM0A 3S2AA 4JIOU 2JM9A 1OCSA 1X69A 1JU5C 2L76A 1TZ1A 3L0WB 2YUNA 4NAWB 1KIKA 2DBKA 1ZGUB 2XK5A 1YWOA 2ED0A 2KDIA 2KRNA 4RTWA 2ZVNA 2KXDA 4BVUC 5L95C 4M8MA 2PPHA 2N1VA 1E7OA 4A63B 4W9FA 3UGBB 2JPHA 2JZZA 4PZGA 3FJ5A 3RNJA 1UFFA 2RF0A 1E8ZA 3VUXA 4NQLB 1XTEA 3ZVVA 2C0OA 4FHJA 2LJ0A 4MGZE 1KSWA 4OMOA 4MGIE 2JMCA 3DBSA 3JSVB 3SEMA 4K7WA 4K7UA 4A20A 1WYXA 2JY6A 1KLVA 1KQ6A 5AZGA 4RTXA 2AZSA 1M30A 1YWPA 5IH2A 4LCDE 3JW0X 2JRIB 5G2NA 2LVPA 3R66C 4NY0A 2LD9A 4AZ9A 4Z8AA 4TV3A 2A37A 1D3ZA 2HEQA 4KRTA 2RMOA 2M17A 3JSVA 2O31A 3PTFC 1NLPC 3P0CA 4Z88A 3QA8A 5DPWA 3EHQA 2J06A 4GLMA 3PRPB 2O2VA 1ZX6A 4R0KA 5I22A 1KOTA 1WA7A 3IQLA 3PHXB 3REBB 1VD2A 2LVQA 2RSUA 5JHBA 1PRMC 1UDLA 3EG0A 4ESRA 2DJQA 2C7MB 1WIEA 3M63B 5IA7A 4ZNXA 2QHOA 2AL6A 4DXAB 2G45B 1VA7A 4BFRA 1IO6A 4PS7A 3HPBA 4CC3A 3DVNU 3U23A 2E5KA 2KJ6A 3HPCX 2KE9A 2M4NA 2KD0A 2V1YA 4GB9A 2BYEA 1PQSA 4MSMB 4MH0E 2LWPA 3WALA 2K8BA 3NHNA 4EOYA 1X6GA 2KN5A 2J05A 1K76A 4CC7A 1WXMA 3CQTA 1PRLC 4IWQA 1WGGA 2YSQA 4ASWC 2RQWA 1I42A 4TQ1A 2EPDA 3LJ3A 1KJTA 3CSFA 3VS7A 2KEAA 3T9LA 3EHRA 2MLBA 4K7SA 4GN1A 4RTZA 2FNJB 4ZRKA 1UH6A 2SRCA 2J7QB 3VUYA 2WWZA 2RNAA 1WFYA 2K3BA 1OTRB 1G2BA 1SE9A 4WJOA 3A1QA 3VTWA 3UA7A 3R7RA 1SHFA 1YX5B 3HK0A 2V14A 1W6XA 2KO3A 2AR5A 1S1NA 1I07A 2LJ5A 3PE0A 3CSTA 1EFNA 2J0KA 2JF5A 2BGFA 1J19A 2XBBC 2SEMA 1WGHA 3SHWA 3PLVA 2DVJA 5EDSA 3OJ4B 4P7IA 4NJ6A 2DL7A 1WXBA 3NZSA 4QT7A 2CSKA 3KYCD 2G6FX 2CT4A 2JS0A 2L3PA 2OAWA 4N9F4 1OEBA 2GQIA 4DEXA 2PEAA 2V6VA 1FXTB 4F7ZA 5LXIB 2DAFA 4OVUA 2DA9A 4EEWA 4F14A 4EKUA 4DBGA 2KQSA 1T0YA 1T3LA 4HVWA 2HTHA 2I1KA 1T0JA 1H4RA 1L7YA 2KYBA 3VAWA 2NBWB 5DPRA 2K7AA 1C1YB 4EUTA 3AI5A 2QDLA 2RAKA 4EZKA 2LJ3A 5DPTA 2FEIA 2IYDB 3MHSD 2ROTA 2KZRA 4OMQA 2LCSA 2V4LA 3H7SA 2X3WD 1PHTA 4FJVB 3TL5A 1V81A 1TGZB 1A0NB 3O65B 4AOFA 2ZCCA 2IY0B 4W9HA 1I35A 2KTRB 4KSKC 3X0WA 3KUZA 2KJRA 3PLUA 1UHFA 3A4SC 3VTVA 3RUIB 2NPTB 3U30A 1RI9A 3VH3B 1YQBA 2F2VA 3ZW3A 4JJCA 2NVUI 2K2MA 2YVCA 4WWNA 2NCNA 3GZNI 4G50A 3IQ2A 1YJ1A 3VRZA 1W1FA 1OPLA 2G3QB 4W9GA 1BBZA 3L17A 4MSQB 4CC4B 4EFOA 1QCFA 4GMVA 2DZMA 4JLCA 3B08A 2KVRA 3VVWB 3QARA 4BKSD 2RQTA 2ENMA 1SSHA 3I3TB 3U7DA 4D8DA 2GBKA 2KMAA 1TBEA
chains in the Genus database with same CATH superfamily
1QKZA 2VC8A 1TS9A 2LASA 4CO7A 2FZKB 2KR3A 3WXMB 4E7IA 2IO1B 2QQRA 4M7DA 5AT1B 3N1XC 4AKVA 3E2UA 4GLSC 1YQ3B 2KROA 3CCRT 3HVZA 3PPAA 3AE5B 4A4FA 2DMOA 1HD3A 1TY0A 3BYTB 4JQWC 1I4XA 4N58A 4BDYA 2G4DB 4A3PA 3EG9B 2QILA 1KM7A 1I1JA 5J18A 2INDC 3DLLA 1BT0A 1DJ7B 1J7AA 3OG5A 4FLHA 1FNWA 4NJCA 3NY5A 1IZ6A 1JJ2S 5C2TB 4BBNC 2JWZA 4ITKA 5EE1A 5TSSA 4PJOA 1UWMA 3G7ZA 4OMFB 3T8MA 2H3JA 1W2BS 1QT9A 1T6BX 1TS3A 1KFYB 2OJ2A 2G9HD 3KYDD 4ZRJA 3CPFA 1NZ9A 1N63A 1YJ9Q 1YQ4B 4HROA 3TMPB 1MGQA 1ZSGA 1XO3A 4AFSC 4M8NA 1SE2A 4XU2A 5CHFA 4N4IA 1TY2A 2NMQA 1C4PA 2H3EB 1XD3B 4IUQA 5LJ3g 3DBLB 4ZOHC 3AEBB 1HA5A 4WWPA 1JWAD 3ETRA 4OVVA 2I2YA 3BY7A 1JEGA 4E7JA 2WQYB 2LCCA 1RAIB 4LDVA 3CMEA 1NJIU 1D3BA 4RFBA 3V8JA 4HCKA 1G8XA 2NBVB 4DHZE 5FWCA 1GCQC 2FPDA 2CR5A 2FE8A 2K9GA 1V80A 4E74A 4E2FB 3JB9I 3U52E 1FO4A 4HPMB 1K8AR 1WJ6A 5DCNA 1KLUD 2G1EA 1V29B 3CC2Q 1HTOA 3QIIA 3QZ9B 4CYEA 3G71A 3AEFB 2GQVA 4TKNA 5LJ5g 2RR9A 1QCNA 1H92A 3BK2A 2AT1B 3JB9J 3LDZE 1GL5A 4I6PA 2DTIA 2CUBA 3W9CB 1JQQA 3RKXA 5LJ3d 1KRHA 3W1SA 2MP2A 2DBYA 2PE6B 1ZE3D 3QG1A 3AT1B 4HCNB 2FRYA 3RESA 1BIBA 2KFKA 3S6WA 1H3HA 2YLMA 1YN3A 4RTTA 3FILB 4WAAA 2D2QA 3H7PB 3ASKA 4UC4A 1YITA 3MJXA 1C4AA 2YT6A 1KD1C 2LUEA 3TIXA 3PZDA 4LK0M 3UT1A 3FRNA 2XI9A 2M19A 3CBMA 1D1BA 3UDCA 4GDLB 4RM8A 1VOMA 4XE0A 2K22A 1K8RB 1WY8A 4MDWA 5D6JB 1WXVA 1TUCA 2YRCA 2DEUA 2PVGC 1RAFB 4OMLA 1Q81C 1F1BB 1LO5D 4L23A 3I55A 2RD0A 3U7ZA 5IXFA 3DBRB 4E47A 2KC2A 2C06A 5LJ5d 3DCGA 2M51A 2CP3A 3QQ8B 2KKCA 2LDMA 2YLBA 4J9HA 1KQSP 1E9MA 1IP9A 1VQLT 2KAFA 4ZN3A 1V1PA 1UGRB 4L6V5 1MFWA 4JUVA 4IC7B 4RTVA 3G4ST 3DBLI 1IGQA 5GAN7 2DK3A 2XEWA 4PS8A 1BIAA 2GGRA 4BY6C 2WXKA 1NEBA 1VDVA 3DKMA 2AIRB 2GTJA 4W9CA 4HCCA 2DFUA 4IWPA 3X26B 3TSZA 5E6JA 1VQ6T 1DOXA 2CSQA 3O13A 4HEA1 1P0RA 1Y96A 5AZHA 1YJWA 3MP8A 3BIID 3EUB2 3JYUA 4DWFA 1LFDA 2YEPB 4E71A 3HPWA 4JL9A 4M7DE 1VRAB 1QWFA 4X9DA 3CBPA 5A0DA 3S3MA 4FULA 3JCMX 3X24B 1WI7A 4IDIA 3UI3A 3V6EB 5JZEB 1QVGA 2IGHA 1U8RA 3KW5B 1WFWA 2XDDA 5GJVB 4IKDA 4PQOA 4XTZA 2ZW0A 2K3YA 3QKJA 1G3YA 1ZUKA 5GAMg 1IUEA 2DX5B 5C3JB 2CJNA 5C23A 2QQ9A 3H0HA 4FSXA 1F2RC 3OB9A 2M16A 2WWEA 1WXTA 2C60A 3MPUB 2NUTB 2LP5A 3B2GA 3RDVA 3MEWA 4YWGG 2I4KA 3CCET 3P4PB 1OPKA 3DHHC 4LLGM 4C8QE 4M7AC 2QQAA 2INNE 3JRZA 4QQ6A 2QASA 3AU4A 4M7AD 2FCNA 3QZ5B 4HDQA 4W9KA 3EGUA 4J9DA 3RNCC 1VQ9T 1MNEA 3NTIA 3QIJA 2BTEA 5FLXE 1C0MA 2DE0X 1N60A 2RA2A 1YBYA 3TU4K 3EFOB 3CMEQ 3SWNB 1T3QA 2AKKA 4GU2A 3E19A 2CH4A 1SEBD 3DBRI 1D1CA 1JWBD 5GAMd 2HKQB 2I1JA 2DXBA 3C0RB 2OJRA 1N27A 4ORZA 3NG0A 1IREB 2R2OA 1VQPT 4RMAA 1I4RA 4F8CB 4NAWA 2PJHA 1D09B 2AKLA 4BUGA 5HKHA 2ZZDA 4C0ZA 1KHCA 2DXTA 2M1MA 4AS1A 2V0GA 3T3OA 1Z9ZA 1FM0D 4D2KA 5DLQE 1JJ2P 1VJKA 3Q6BA 4FJYA 3QAQA 2EJFA 2R2QA 1UJYA 1C6VX 2K8HA 4YSYB 3V60A 4OMNA 2IPKD 1WGSA 1W2BP 4LJPB 3VUWA 1WLPB 3MTNB 1YITQ 4MZTA 4MM3B 4AUQC 3G6ET 4S0RA 3A4RA 2JT4B 4HCBA 2HKNA 2W3RA 2Y3AA 5CR2A 4EPCA 4WJQA 1IBXB 2CJOA 1A5RA 3X23A 1GCQA 4IKBB 4ZHOA 3IFWB 4DOWA 2EYXA 3CCVT 4XTYA 3FLGA 1M90U 1TBEA 1EF5A 1VLBA 4DHJB 2F5TX 1B9RA 1UNSA 1WJNA 2A08A 2DKGA 1IRXA 1QOBA 3ZNZB 1B34A 1MG8A 5KYXB 4FXCA 5IKCM 1U1TA 2KHWB 1R7SA 1D1AA 4WQOB 3WA0A 4EMKC 4XGAB 4Q2JA 1M4ZA 2VB6A 3HFOA 4E7ZA 2F2WA 4CC2A 1N8RU 2YRDA 3LX7A 1YJNA 4X57B 5GAOr 4M78C 1VQ8A 4IKBA 1BI3A 4M78D 1BI1A 4WTOB 4NL2A 3CCSQ 1E8XA 3G1JA 1YX6B 4MELA 1UE9A 4OVZA 1LXDA 3OWEB 1Y07A 4FYYB 1YJWQ 4NZLB 2UU7A 1C79A 1MMGA 4M77C 4IURA 5GJWB 4M77D 5IN1A 1WQWA 4MGKE 2HDAA 1WX8A 2MYSA 4OZBA 4P1BC 3CCMA 1J3TA 3Q69A 1VQ4T 2W82A 2FBWB 3JCMe 1WGDA 3EGXB 1V5TA 2Z8LA 3RYTA 4YTMB 2DETA 5C6SA 3OYCA 1MJDA 2HD0A 2VRRB 2JVCA 2MA9B 3HM6X 4A6QA 1M1GA 2DZJA 1I5LA 2M0AA 4O1NA 2WNMA 2K57A 2FPFA 2KQWA 2M02A 3T9NA 3CCLQ 1PDXA 5G5GA 2R5MA 1JRUA 2ZAEA 1WZOA 3L10B 1WI0A 2E4HA 1E90A 2AWTA 2LRUA 3DBHI 3MP6A 1YIJT 3EGRA 2F5KA 1LPLA 4FSSA 1KQ1A 3NS8A 1I4HA 2NTSA 4HWIB 5JHAA 4S17A 2EYYA 2PZ1A 2RJEA 3HHTB 2GFUA 2Z59B 4REZA 3ZRFA 2MBOA 1T3SA 1D5XC 1VQ7T 4DBHA 1Z9QA 1G83A 2DRKA 1JXOA 1OULA 1YN4A 4UDUC 3RMQA 1TYGB 3SR6A 4X34A 3QPHA 4PLLA 2VXEA 3C0CA 3PVLA 4B9KA 1SHGA 5AYFA 3RI7C 4V2SA 2GBJA 2KNBB 4W9LA 1WXSA 3NOBA 4E3CA 2EWNA 3HRSA 1TTNA 1WYWB 4G3XB 1SPKA 3D7SB 3FB9A 2ZNVB 3B2FA 3PREA 3CC4A 3BVGA 3M4YA 3VS3A 4USAA 1RAXA 3RT3B 4K11A 1VYVA 2D8HA 5HKCA 1G3SA 3A8MB 4F7UE 1JBMA 2OTLA 1X1MA 1K4US 3V05A 4LD6A 2DLPA 4ANJA 1WHKA 2ONQA 3BW1A 4BDZA 3V61A 3DWMA 2EQIA 3AEGB 1K1ZA 2MBEA 4RTUA 4BD3A 1ESFA 4A53A 1KQ2A 3R2TA 4ZGEB 1CQVA 2JTEA 4P16A 3O5ZA 3X25B 3CD6Q 3PO0A 1H3ZA 3SDZA 2KNBA 4GIVA 2DL5A 4M75C 1PUTA 1Y8RC 3L2UA 4WAFA 1GC7A 4M75D 5C1ZA 2ZVOA 3QK0A 3DYTA 2C9WB 2GFAA 1TKGA 1FX7A 1NYRA 1KD1U 1TSFA 2QXFA 2LNHB 5GAOq 4JWSC 4ATOA 2WGSA 3REAB 3CCJQ 5CX3A 2RAIA 2DX1A 1LJOA 1L5PA 2QYZA 3AE4B 1ZHIA 2XDBA 4TMAB 5CIUA 4EMHA 3CC7T 2YEPF 4XX5A 1B3QA 4PK1A 4J9IA 2XU8A 2UYZB 2M8SA 5KCHA 1V1OA 2RDBC 3GP7A 2ZPHB 1GD5A 4AWJA 4OVAA 1XQHA 2B86A 4RG8A 3PNWC 2RK2A 2JTMA 5FKAC 3Q8AA 4MJSB 1NM7A 1WWTA 4B6WA 2P0KA 3RFZB 4IUPA 3EG2A 4RCCA 4GLKA 4ANUA 3T3NA 2VWFA 3CCUA 4WWMA 3SDLC 3EG1A 1VUBA 3M0SA 4JJDA 5GAOn 2O4XA 1WR6E 4LDTD 4LNNA 2DRMA 3ZDMC 2X4JA 1WHLA 3VKIA 2KQ7A 1NENB 2D3AA 2QDFA 3RN9C 5FRNA 3I5RA 4XDCA 3OS5A 1SGHA 2ZGWA 2J6FA 4EIKA 1D0YA 4DXFA 3AE2B 2WACA 2FYKA 4XK8E 3OYYA 2N0SB 2AHJB 5KCOA 3CCMQ 2O6VB 2RHZA 1J0GA 3Q8CA 2QG9B 3CCRQ 1FMWA 3HFNA 2N9LA 3WAMA 3OYBA 1EU4A 3I5SA 4LUDA 1IB8A 3ALBA 2J7IA 1I8FA 2LGIA 2J6OA 2DM1A 4M7DG 2DNUA 1WGYA 3ZIMA 2QGGA 2JXBA 3HM3A 5LNK1 3APDA 1ABQA 2M0XA 5D3IB 4M78A 2BZXA 2LJ1A 1EWCA 3IVFA 2EGEA 4K81A 2MSED 3TCAA 1ACMB 4FM4B 4ZHPA 2RM4A 2MCNB 3RNBC 1M4VA 3QHTA 3TJPA 2K6DB 3VQIA 4M77A 1MV3A 5LLIA 1J7CA 1YCYA 4IOIE 4D6WA 3HKSA 1TIFA 3SHQA 4C8QG 3EGDB 3CPWA 3MJWA 3L1AA 2MW5A 3EFRA 5BYRA 1BCOA 4HLEA 1OU8A 5KHOA 2YUPA 1RUWA 3CC4Q 3AV8A 2XG8D 4LXCA 1V9JA 5BMIA 2L00B 2RDHA 2CT3A 4FIBA 1P9DU 2JUOA 3DLMA 2BYVE 3M0PA 1VQKT 2LVOA 1DOYA 1RFAA 4E7HA 3JVZX 2HJ1A 4FADA 1QZEA 1WSPA 3ZNGC 2DYBA 2MCNA 5IXBA 4AJYB 2DYIA 4KGTA 2DIGA 4XWWA 2PUKB 2RHYA 1Q7YR 4DBFA 2GNCA 2BB5A 4XAXB 4FHKA 3I35A 1PGXA 2D11A 3EGDA 1E7VA 3JB9D 2RGFA 1R4MB 2KX0A 4HT8A 4AP4C 1RRBA 4M7AE 1NI3A 2BYTA 2D3GA 4PJOC 3MHXA 4DQ2A 3VDZA 4PJOD 3HRTA 4C92C 4DQOC 3A8LB 1GFDA 3LUIA 2JZ2A 3RBBB 3ABVB 2NWMA 4C92D 2EKEC 5LL6S 1MVKA 2CZ0B 1QOFA 2KVQG 5JH5C 3AH7A 1WGKA 1ENFA 4KX6B 2D8JA 2ACZB 4PLIA 5EE3A 4XTVA 3ML8A 3ZKJC 4KKIA 4PJLA 5CKHA 1BCMA 2MBBB 2DL4A 3O8VA 1YHQT 2I0NA 4LTUA 1TKEA 2W54A 2FZCB 5CVIA 3S3OA 1AWDA 1D6EC 4YTNB 1KQSA 4WJNA 4CHKA 2DO3A 4XWTA 3MHZA 2QEXA 2QSDA 3AE3B 4IKFA 1WMHB 1OV3A 1VIFA 1N9SA 1P7FA 2H88B 2CZ6B 3VS1A 1QCOA 2WS3B 2BF8B 2LI5A 5IAYA 1B1ZA 1H8KA 4BOSC 3SB2A 2L73A 1SRLA 3L2ZA 2K79A 4LDUA 3UA6A 3J7AF 4P6VF 2L89A 4RUGA 3C94A 1PFDA 3G4SQ 1I4K1 3THKA 2FIDA 3DVGX 3AB5A 2EGAA 4JPSA 1W4SA 2HDEA 4JDSA 1Y56A 1WJ4A 4GDKB 1I0CA 1KTKA 4HKZE 1VQ6Q 4TSSA 2D9TA 1TZOA 1AZEA 3AE1B 3VXWA 2Y4YA 1L0XB 3VS5A 1QILA 1LOJA 2OX7A 1S3SG 5M9OA 1ZQ1A 2M56B 3R7QA 3RKYA 3W1SC 1RL2A 2C5LC 1M3CA 1JWSD 4TVRA 2IPOB 4HVUA 2D6FA 2PMVA 1L4ZB 4RMOA 2BQQA 1GFCA 4IM2A 1GC6A 4YXDB 2YUOA 5IAAC 1C76A 1OQQA 2JZPA 1BYMA 3GNFB 2HE7A 2X9HA 2G3RA 1F1HA 1QVPA 2NUPB 1CJEA 1R4MI 5GAN6 2LZ6B 2BTTA 4HASA 2CKHB 3V6CB 2LGXA 2FG0A 1A70A 2LQNA 9ATCB 2V26A 5FK9C 3DWGC 1TTHB 4M78E 1YIJA 4HK2A 4YSXB 4ZDVA 4C00A 1UGMA 2VZKD 4HCPB 4RF0A 2R58A 1M8MA 4E7LA 2LTOA 2RHXA 2J53A 3PT2B 3GF5A 2L32A 1NYGA 3I56T 3MEAA 3KXTA 2O88A 1YMHE 4M77E 3UF4A 1TOVA 1M3AA 1PCXA 4C4VA 2PVOB 2R61A 2QQSA 1MNDA 5A0GA 2KDBA 4RM9A 3A9KB 4FYVB 1PM3A 2WDRB 2KTRA 4HT9A 2K4YA 1N5ZA 1WF9A 1NBFC 1JJ2A 3A98A 2KLCA 2E6NA 4LNOA 1V86A 3ONSA 1VQPQ 2KT8A 3JCMP 5E6OA 4FA6A 4F7UG 2KBTA 2JOYA 1YI2A 2N7JA 3P63A 3P2BA 2DENB 1XQQA 1W2BA 2SEBD 2NPTA 1VQ5A 1PKSA 2ZPEB 1JWMD 4FU6A 1R4NB 3KFVA 3GPLA 3UQBA 4OGEA 4ICUA 4BE1A 2V3NA 5FU7B 3VV0A 4RGNA 2GBQA 5H8YE 3URYA 3ZL7C 1K9MR 3PRZA 3LGFA 3DVGY 3ULRB 1VZ6A 3QX1A 1F0ZA 4OF1A 1Q82C 1L2NA 4WWOA 2X8XX 3KVFB 4AJWA 2C7NB 2PLPA 2V9HA 1MUZA 3G6EQ 2KOXA 3N3KB 3OYFA 3R2IA 5HK0A 4QVDA 1FFVA 5KYYA 5KYNA 3QWXX 2X4YA 2QEXQ 5I4DA 2EQUA 4RGOS 3CCVQ 2OOBB 2KDEB 1OZ3A 3BYYB 1WX9A 4DEYA 4KDLB 3L4PA 5KYWB 1D5ZC 2V8IA 1OGWA 2GBNA 3M0UA 1OFFA 2LQWA 1WM2A 3H0FA 4W9JA 1MV0B 5D94A 5FWBA 4B9XA 1FIQA 3GE8C 5KH6A 3JCMg 3CMAA 1Y7XA 3NZUA 3MEVA 3SD5A 3BVMA 1XLNA 3QJYA 4C8QB 4C92A 1GB4A 4ELZC 4WH4A 1V76A 4TUUA 2D1XA 3MC0B 2D0NA 4A4HA 2WX0A 4M75E 2LT1A 2LVMA 1XT9B 2EKHA 2LXCA 2ZCFB 1SB3C 4P2IA 3PTAA 1FCCC 3HHMA 3M62B 3EG9A 3SWNC 2A3LA 1I4GA 1UZXB 3E9GA 1SIFA 1M94A 3J81E 3RD2A 4XQ3A 1TUDA 3PV1A 1VQ4Q 3IAM1 2EGCA 4HJKA 1DOIA 4KIKB 2WDTB 2LQKA 3RR6A 1SF0A 1OQKA 2N9PC 3AXCA 4KVGB 3JCMd 2YRVA 1SSNA 2XN9C 3JCMc 3B1LX 4J9EA 1LQBA 2RPNA 4II3B 3KH0A 4NJ7A 1ZBJA 1R4NI 1IPGA 1LM8B 2LGDA 2MJDA 3W2DA 4P2JA 5EG2A 2KYMA 2QIEB 5AUIA 3OS1A 3M3JA 4NAMA 4IUMB 5KYUB 3OYMA 1YIJQ 2RK1A 2NR2A 2W9NA 2L2PA 3L54A 3E56A 2FCQA 5GXGB 8AT1B 3R6NA 2EYZA 1KF6B 1NDDA 3OSVA 2JNGA 1D0XA 2L3RA 3ZJTA 2NLUA 4QKUA 5IHIA 1VQ7Q 4YTPB 3QBYA 5BYSA 3PS6A 1UGVA 1JROA 3ZYYX 3OYKA 1WNLA 2E70A 3D32A 2VKNA 3QCAA 3KQ4A 2HTME 4J83A 2NYSA 2GTOA 1S72T 2DL8A 1IHWA 1YJJA 3GB1A 4KGRA 4DHJD 5GMKl 4ACFA 2MJEA 1AWXA 1SEMA 3B9JA 1OEYJ 2J52A 3APCA 3CBOA 3NTHA 2VGMA 1PSFA 4F17A 4AFQC 5I2MA 4R55A 3OLMD 2BZYA 5JXVA 1YI2Q 3ZNID 4KUIA 1M1KR 1GCPA 3RNGC 2K5FA 1E8WA 1U1SA 1VQ5Q 2K1FA 3DB3A 2ZJDA 4CQNA 3OMGA 3OJ3A 4RCBA 1GB1A 4JZ3A 1SIJA 2AYOB 1P1AA 4BAXA 4US8A 4ME7A 2EMTA 1YN8A 2L83A 4KULA 4PJJA 1YIWA 3ZEHA 3FILA 2GBMA 2MEKA 1KJWA 3H7PA 4NOYA 3RZFA 3FEOA 3NRZA 2JXXA 3NVVA 2W3SA 2HQXA 3L2WA 2AX5A 1ET6A 4M7AG 1SRMA 2HMAA 1WRDB 2KXJA 1WR1A 4GDLA 2MWPA 4LNIA 2HNIA 4DXGA 1ABOA 3VRYA 4CI0C 3CCSA 2D3BA 2XNAC 3H6ZA 1V1CA 2DEQA 3SU8X 3Q14C 2HJ8A 4M0WB 1NVID 2KY9A 3ZFJA 3H6NA 5GAN4 3EH1A 1RLQC 3CC7Q 1FFUA 3TEXA 2JQRB 3WANA 1IYFA 4LNKA 4US9A 3CCQT 3CMAQ 1MHXA 5GAOl 1RAAB 3V7CA 3OAWA 2QJLA 4YL8A 4VUBA 1RAGB 4LDXA 1T0QC 2EIFA 2QTXA 2K25A 2FPEA 1ZSZB 3HL8A 2OTJT 3ECIA 3ZJUA 1YP5A 1AWJA 1VQNA 2M0OA 5CQYA 3VS4A 3IG3A 5ECAA 3H9DA 3IBEA 2ASQA 1AD5A 4JPBW 1ZXHA 4KH1B 1TT5B 3CCLA 3MC8A 4LDYA 4PJMA 1GUAB 1WXAA 2N9EB 4GXBA 1Z2MA 4PJOE 2BB6A 2B76B 2ATCB 1OCUA 4C92E 1UUPA 1QKWA 2CP5A 4X9CA 4DDID 2FAZA 2VVKA 3UIOB 1WX7A 3N30A 2JM8A 4E6RA 2CUDA 2XK5B 2CSIA 2P4RA 4PFZA 4HJGE 2KRSA 2W55A 4MMLA 1HJDA 2ZNVC 3AEEB 2K2VA 2IIMA 5L23A 2V3PA 4X1VA 1C1AA 2BKDN 2LQ8A 3BFMA 1TH7A 2K8CA 4Y92A 1FD6A 1PC0A 1WHMA 4F7UB 1ZLMA 4J9GA 4I6LB 2RN8A 2CU1A 2LHDA 4N4HA 2JYEA 1XTNA 1UWXA 1B07A 3NGPA 2DZKA 2NBUA 3I9V1 4KV2A 2DAJA 2V3SA 3FAHA 4BZAA 1O7KA 3M95A 3JSCA 1M2VB 2KWUB 2NUTA 3SEBA 3MEUA 4AG1C 1VCBA 4D8KA 2PW9A 1WPYA 4ZN1A 3WVDB 2PTLA 2D3CA 2E6ZA 4PFPA 2LXAA 3JCMW 1K73R 1K51A 5CK9A 1PKTA 4L5GA 3AU5A 2L7RA 3EFOA 4M78G 2L8JA 3DBHB 1WM3A 3SWNA 2RI2A 4JJBA 4HRSA 3PHWB 3DHGC 1ZUYA 2FB7A 3CD6A 4XDDA 2COYA 1G3WA 2AZVA 3RUXA 2L52A 3UIPB 4QVCA 2X3XD 2WX1A 4M77G 2YHTA 1L0YB 1VR9A 3AE8B 2A36A 3I5JC 3LW5E 4W9IA 4M7DF 2MRPA 4C56C 4W9DA 2BYFA 2KDSA 1UHCA 1VQKQ 1N61A 3QWYA 2MK5A 2A4ZA 3AM9A 2H89B 2KGTA 1AVZC 4B9WA 2XICA 2NTTA 2IO3B 1V49A 3KUCB 3CCJA 1WDXA 2MWSB 4HXDA 5D3DA 1NPPA 3OSSC 4AFUC 3M57A 3BWUD 4F04B 2GLSA 2AL3A 2KDFB 4IIMA 3RPFC 3NMZC 2ZCBA 3SFMA 4BACA 2KWVB 2BKRB 3ML9A 4JS4A 1EIFA 2L05A 2BWES 2E1HA 5I2SA 1RLPC 4MM3A 3AULA 3TCJA 4LD9K 2BS4B 2JT4A 3PMIA 4C8QF 3PIOA 5D6WA 2BW2A 2PIAA 3P4QB 2QC8A 2QCZA 2G4SA 3DDCB 1IBXA 1Q82U 2DBMA 1E8YA 4IW0A 4A3OA 2INPE 4PS3A 2DPPB 1RM6C 4K1RB 4LDWA 3Q8FA 5D7GA 2AQ1B 5EC7A 2O6VD 1MHNA 1OX9A 3NZ3A 1XXGA 1I4QA 2PTKA 1ZKHA 1VQOA 3L2VA 1UEBA 1FMAD 4PKCC 3GOXA 1SE4A 2EQMA 1EM7A 2GRIA 5KYXA 4ZYNA 5D2MB 5CKBA 1K9MC 3AECB 2A28A 2RD1A 2KTFA 2DF6A 5IT9E 2KANA 2EKIA 3LH5A 1K0SA 2O2VB 1WYGA 2LHEA 1IGUA 2LC4A 1N6ZA 3HUIA 1VQMT 3CCRA 1UF0A 3PSEB 4RG2A 2RPQA 2VH1A 2B3AA 3EECA 1VQNQ 4WQMA 1FCLA 2CKKA 1GAQB 5D7UA 2O9SA 1RFKA 2ROLA 1YJ9T 2N9XA 2M9UA 2ZPBB 2WXPA 3W1YA 4MMKA 1TUGB 3EC8A 4FT2A 2E3IA 1HSQA 5CAIA 2UWQA 3UWNA 4KDIC 3VUZA 2KYWA 4G0NB 3N32A 3C19A 4NPNA 2XMFA 1JXMA 3A33B 1YNTE 2JYTA 3PGEA 4IUVA 1JO8A 2CZOA 1KC8R 4M75G 2IY1B 1JRPA 3EGXA 3ME9A 3QC8B 2EQKA 2HCKA 2QK0A 4IIOA 3BINA 4JWUC 3QDFA 2V1QA 1ARKA 2K39A 3M55A 3OYEA 1MHHE 2WXNA 4C7ZA 4BKGA 4JRQA 4ON3A 3QYHB 2ETTA 1QW1A 2OAUA 1ZDXA 2AQ2B 2WXOA 4IWOA 1L6UA 4GBQA 3KWLA 3BY4B 2MWOA 4ARCA 2PVDB 2KK8A 2CS4A 4RF1A 3U4EG 3CC2T 3FC4A 5MPOA 4CRIA 1KK7A 1QWEA 2K5IA 2FZGB 2KJHB 3P4RB 5L83A 4DDGD 1QKXA 4FBJB 4BI3A 5A2QE 2IBIB 2W10A 5FU6B 1RAEB 5TR5A 4WCIA 1N5WA 3K9OB 2COZA 2CDTA 4XTWA 3OYHA 1E6HA 5IHNA 1QQJA 3QYGB 3P4SB 3CXCA 3P1MA 1M90R 2WSCE 2ZPFB 2E64A 2MIOA 4A4KA 2REAA 2BE7D 2BPSA 2CS7A 2RI3A 5IHKA 1K8AC 2DYMA 2KX3A 3UF8A 3I56Q 2J0JA 4XC2A 2COWA 2L3QA 1RLFA 2D07B 1PGAA 4J6IA 1SSFA 1AEYA 2HL5C 2MQJA 2VH2A 3WCQA 2R5AA 2EKOA 2LT4A 2YXYA 1F77A 3AEAB 4G11A 1XJWB 5HY6A 3LXFA 2KDMA 2A7YA 3CMMB 1C78A 1PD0A 3L42A 4J6WA 1WH3A 2V1RA 2N7DA 2WXJA 3HVDA 3NJTA 4C0DC 1B7TA 5GMKh 1JQ4A 3TQ7P 3ZDTA 1I7HA 2HBWA 4XU3A 2QI2A 5CHWA 1EWYC 1GNUA 2YWWA 4GOCA 1Q95G 4DA4A 1M1KC 2MH7A 5HCKA 5HK3A 1RABB 1O9SA 4KSLC 2KRMA 2K9XA 1VIEA 2MOXA 3PIPA 3L13A 5GANe 5A0LA 1WE7A 1ZBXA 3VRBB 4NL3A 1VQLA 3N20C 4C0GA 1ZW7A 1VQOQ 5GANf 1NPRA 1T0RC 4FYXB 1XF5L 5J17A 3L16A 2KMCA 3G4SA 3LB8C 3VHTC 2E41A 4ANXA 4EZLA 2L3ZA 1W70A 1XTDA 3DPDA 3VRAB 3H41A 1R0BG 2FRWA 2RHUA 1DYQA 2CHZA 3TBLD 3VS2A 1OI1A 1U4AA 1P7EA 3Q3OC 4ZRPA 2RQVA 4FN2A 5GMKm 1EZZB 1VQ6A 1IXDA 3FOGA 2K5LA 4AFZC 2K0PA 3FKYA 4FCYA 3H8ZA 4MJSA 3MFGA 1BI0A 4F7UF 5FW9A 2EJ9A 3A1QB 4BBNF 1OOTA 1JMLA 2JZ3B 3V62A 4EMKB 4BGJA 4F1SA 1X27A 3HSBA 5D6YA 5AEKB 2RQRA 5C0MA 3JCMJ 4MGYE 1VZ8A 3ZO5B 2XIDA 3JB9G 1U3OA 2F2XA 1R77A 3GNGA 3A8GB 3PT9A 1LNXA 1E6EB 1YCSB 3EG3A 3M54A 3QXEB 4Z89A 2O6VA 5GMVA 2A5UA 1C3TA 4XZ4A 1MMNA 4BE2A 2OI3A 2L3SA 4MACA 3UATA 3CMET 4PJOG 1UUEA 1MG4A 3H1UA 2DD4A 4RTYA 4LE9A 4KGXB 4QQGA 4C92G 1AARA 3DVNV 2RMMA 3CCEA 4C5GA 2IGGA 3I9QA 2QDYB 4J6XA 1TS5A 3K9PB 1C4CA 2PVOD 1YNZA 4JS5A 4JX1C 3RMKC 1WXUA 5GAMf 2RQUA 1VQ9A 2EVRA 1XLPA 2BWFA 1D0ZA 3G71T 1UGJA 3V3XA 2JN0A 2ABLA 1UBIA 1EF1A 2XHCA 3I63C 3M56A 4XTUA 5GAOm 2N1WA 5LXHA 2LMJA 1IGCA 3LH0A 2Z0DB 4RCOA 1WX6A 3M53A 2L1AA 1M1FA 2K6DA 1VZ7A 2IZVB 2BKFA 1EUVB 2WXRA 2BS2B 1NYFA 4NS5A 4NQKE 1VQPA 4OMPA 4F16A 1K9AA 5FU7C 1YITT 2O2OA 1S1QB 2FCSA 2LNVA 2ZW1A 1QLYA 3ZUNA 1Q81R 3GIBA 1T5XD 4M01A 2ZPGB 3NUHB 2DZIA 3BDUA 1G6JA 3JCMQ 2RH2A 4A4GA 1U5SA 2CP7A 3META 4LUEA 1S72Q 3PZ8A 1K73C 1Q86R 3I55T 2VYTA 2WYQA 1X43A 1V5OA 1QVFS 3L2RA 2N4FA 3NPFA 5IOIA 3FDRA 1Q0WB 2Y4XA 1Q5WB 2RHIA 2RPVA 3G6EA 3P8DA 1V97A 1X6BA 1ISNA 4IUTA 3OYNA 2JU6X 1KMDA 1Z5SB 5CO7A 5KHQA 1FXAA 2IO0B 1M9SA 2BT6A 3CCVA 2K6QA 2EAYA 2OHFA 3Q8BA 3ZLZA 4HCZA 3U8ZA 2VGNA 3RCZA 1XLOA 4C8QC 2BIVA 4N0AC 2EBPA 2GBRA 1KQ6A 2CREA 2JWUA 2LRWA 3AE7B 3PRMB 2MAMA 3R3MA 5D6XA 2I2LA 1GOZA 1YJWT 2DZCA 1VQLQ 3CPWS 2F1LA 3NVYA 1NG2A 4O5VA 1K50A 1ZXIA 3A9JB 1SXTA 2EMSA 3HIZA 2J6KA 1L0VB 3OQ5A 3V8LA 2MX2A 5E6PA 3RKWA 2RO0A 1D5MC 3KUFA 1UTIA 1K9MU 2RJCA 2FO0A 1WMHA 4II2B 2GMIC 3LYIA 3RIRA 4AG2C 3ZNHB 3JCMV 4DHZB 3CCQQ 2YPSA 1SKUB 2M0YA 1Y0MA 1EX4A 1WXQA 1M3BA 1VQ4A 1YJIA 1UELA 4JGHB 3ZRCA 1I81A 3TVTA 2BS3B 2Y5BB 3AEDB 4WIPA 2JX5A 1K0XA 3N1YC 4C0FA 4LDTB 3A9JA 5GANj 1AYFA 3QWZB 4ZRQA 4GDKA 3OBWA 1VYTA 2B8AA 1OU9A 2RJFA 2YDLA 4XYCA 2CYZB 3OS0A 3JV3A 4M7AF 3ZXRA 3KBGA 2RAJA 1N5XA 5BMHA 3M9QA 3OMCA 2HD5B 2WXMA 2EYWA 4BKTA 3GBQA 3CCEQ 1F52A 2MBHA 2DVEA 1P98A 1WRIA 2ZPNA 2ZZPB 3H0IA 1V2YA 2L0TA 2HBPA 1X2QA 1NEKB 2IWLX 2D0QB 1VQ9Q 1VQ7A 2BVCA 3UINB 4URKA 5CHVC 2GOWA 1WJQA 2GCXA 5CKDA 1YFNA 2ESWA 2QA4T 3EFUA 3MO8A 1GBRA 1N6AA 1UECA 1KC8C 1E10A 1KHIA 1M2OA 2NUPA 4ANWA 2LZ6A 1AWWA 2KXCA 5EE9A 4LN2A 1KG1A 4KGSA 3VH4B 3ZGZA 2E6XA 3KUDB 2HSEB 1L4DB 2N7EA 3BZDB 4A9AA 1JRIA 2P0PA 1E7UA 2HSPA 2K5PA 1WZ3A 1UB4A 1BK2A 2CP2A 2JW4A 1JW9D 2QGFB 4OMMA 4J5YA 2W0ZA 3NS1A 2REXA 3TREA 1NLOC 4LJOB 4DK5A 5CQXA 2V4IB 1QP2A 1K8AU 2MI6A 3Q3NC 1E5WA 2DYOA 5DPSA 3VTUA 2Y5CA 3A9KA 5BMGA 4OXWA 2K3XA 2VXFA 1X01A 3EFCA 1BU1A 5GAN2 1EO6A 1QP3A 3Q3JA 4XU0A 2KC1A 2BZ8A 4MT5A 4KZCA 1CMXB 5I11A 2RDGA 4M7DB 1BB9A 1WE6A 2CHWA 4GY5A 4L2YA 3E9SA 1YJNT 1LCKA 2GF7A 4YT0B 3M0RA 3SFEB 2AQ3B 1GRIA 1OX8A 1VQ8T 2LMCA 1GBQA 1ZSZC 4B6MA 1F9JA 3CC7A 2DAQA 2JMAA 1JWUD 1TG0A 2Z0EB 4PYZA 3URGA 3VS0A 2X4XA 3WAPA 2KFJA 3OW2S 3APFA 1T0HA 2ED1A 4FW1A 4JRKA 1M1KU 1UD7A 2WXQA 4ICVA 4PJOB 3NTKA 2E12A 4M78F 3F70A 4RH6A 2FVUA 1TXQA 3RZWC 1H8CA 2Z0WA 1BKBA 1LVKA 3MCAB 3CCMT 3QJZA 1CSKA 3TSWA 4WJPA 1HE8A 1J8CA 3ZJVA 1HYOA 2NS5A 2PNIA 3M4GA 1UBQA 3Q3FA 1Y57A 1OEYA 1NI2A 3EA6A 4M77F 2LUMA 1EU3A 5AZFA 2LGYA 3GOEA 1GPXA 1CKAA 4XTXA 2WXFA 5CTRC 4EDUA 3VJPA 1AWOA 1E6GA 5KYWA 1KFZA 2FCMA 3EHVA 1TKYA 3VUBA 2JRHA 3I57A 2O9VA 1FYNA 2E3TA 2WU5B 5G5HA 3WAOA 2X38A 3V8KA 3VS6A 1PWTA 1AZGB 2DHZA 1FMKA 1WJSA 4MZMA 4QW2A 5J2RA 4R56A 1VQMQ 2DD5A 2ICIA 5GANh 1WGRA 1AOJA 1D3BB 4C8QA 4N0AA 1QVFP 4OZAA 4ZTJA 4ANVA 3CIRB 3NHEB 4OHJA 4HPPA 2REDA 2QQBA 3L08A 3ZTDA 3JAME 4J7IA 3VU3C 2KWDA 2CH4W 3X20B 1RYJA 1V6EA 5J39A 4MDKE 2HQEA 2KN4A 3WIMA 1QMCA 2KT1A 4TQ0A 4HVVA 3CC4T 1XOVA 3M0TA 1FNVA 1U06A 3QJ6A 4HPLB 3RULA 1UJ0A 1X2KA 1ZA2B 2C0TA 4KIKA 2MP2B 3OYJA 2FUG1 5FRMA 1T0SC 5GMKe 2OTLT 2WXLA 3PMTA 3CPWP 2DILA 3P42A 2KFKB 2AK5A 4JRPA 4PYUA 1C9FA 3Q3MC 3B0AA 2QEJC 1NEGA 4A55A 3J80E 4EZJA 3M59A 3QO3A 5J3BA 2DL3A 1XNIA 2EW3A 5KYUA 1VYUA 4RGMA 3C8YA 3FIFA 1VQKA 3QHSA 1STEA 3IT4B 1ZUUA 4GGQA 1HEZE 2J0MA 1UG1A 5E6NA 5GAMh 5FR6A 5HHDG 3PFSA 1IHVA 1P3QU 1WIAA 8ATCB 2KLGA 2VZKB 1WZ0A 2ZPYA 1WHGA 2JTFA 4OB1B 5FR3A 4O6JA 1R0CB 4MEMA 1KH0A 3IT6B 4IG7B 2MBQA 2NUZA 4B95A 4HVBA 2CP0A 4M75F 2C0IA 1Q7YC 1HZ6A 1V1PB 2LJIA 3HRUA 1SJHD 5T8IA 2L0AA 2LX7A 1Q1OA 1SG5A 1YD8U 5BO4B 3PZ7A 1K73U 3AE6B 3TEEA 3VFKA 2ZEQA 4C7YA 2V8JA 2FUHB 4LNPA 5GANg 1KLGD 2K3UA 3X28B 4BOZB 5DLOA 4IKGA 1CKBA 1Y96B 5H92C 1L6VA 2AEHA 3DB4A 2FIFA 3C12A 4KGZB 2BE9B 3IHPC 4FJZA 1JCKB 4I6NB 3CCUT 1HZ5A 3M58A 4KZ0A 1Q86C 4OB2B 2H8HA 2PE9A 1YHQA 2CHXA 4AT1B 5CCAA 2PUOB 4J9CA 3OYDA 1WJUA 4IM3A 3OYIA 4HXJA 5G55A 3W5VB 3C4SA 2IO2B 3EAEA 1UGSB 2DXCA 3Q1JA 2L0FA 3OY9A 4W9EA 3DOWA 4NNJB 3M0QA 4PT5A 1PNJA 2JS2A 2KWCA 2A0FB 2D10A 1X75C 4M0WA 1CK1A 4PQPA 2WXGA 3A5ZB 3CF6E 1NJIR 2PU9B 5GANd 4J9BA 3BVZA 3J9CA 2C7HA 1H6HA 3DHIC 1GJZA 5DM7R 4A4EA 3PVQA 3A8HB 2SAKA 4J9FA 1NYQA 2ECZA 4BKSA 1ZSZA 3ZTCA 2CU3A 2V8KA 1C77A 5KE2A 4ZRIA 1GG3A 1M27C 3UQAA 1OQYA 4M4ZA 5IP4D 5J26A 4JZ4A 2WHIA 4BB7A 4Y28E 4HDOA 4GSWA 4JJNK 2J4XA 2YUQA 5FU6C 3DQVA 3ENEA 4IM0A 4JIOU 3S2AA 5KE3A 3QDRB 2P4TA 2VUBA 2JM9A 7AT1B 1OCSA 1X69A 4B0EA 1JU5C 2L76A 1TZ1A 3L0WB 2YUNA 4NAWB 1KIKA 3N1ZC 3LGLA 3P8HA 2DBKA 2O01E 1ZGUB 2XK5A 1YWOA 1MMDA 4N59A 1ROEA 2FHDA 2DWQA 3OW2P 2ED0A 2KDIA 2KRNA 4M02A 1R8OB 4RTWA 2DTHA 4A54A 5GMKi 2IDYA 1E7PB 3HRDD 4F7UA 1WQ7A 4DBRA 4RGTA 2P84A 2GI9A 4AMCA 4BI4A 2IG0A 1NE8A 1MPEA 3KWVA 3C95A 1FEHA 2ZVNA 1KC8U 2KXDA 3I56A 3AMZA 4BVUC 1M2VA 5L95C 4M8MA 2PPHA 3G71Q 4EE2A 1XCQL 4WURA 1QVGS 2QA4A 3UPUA 2E10A 2N1VA 1E7OA 1OQRA 4A63B 4PJNA 4W9FA 1AW7A 1ZDVA 2JPHA 3UGBB 4JLIA 1ZP0B 2JZZA 4J6YA 3FJ5A 4PZGA 3JB9F 3RNJA 1UFFA 1B34B 2RF0A 2CP6A 1SBBB 3RNAC 3OYLA 2WXHA 3HTRA 1E8ZA 3VUXA 4ELYC 4NQLB 2CZ1B 4PJOF 1XTEA 3ZVVA 2C0OA 1UGQB 2F69A 2LCLA 4C92F 1FMVA 2RJDA 5GMKj 2DXUA 4FHJA 2JXTA 2LJ0A 4KT0E 4MGZE 2QEXT 2R57A 1KSWA 4OMOA 4MGIE 1YN5A 2JMCA 3DBSA 5IN7A 4KGVB 3I55Q 3JSVB 3SEMA 1SF9A 4RKUE 4K7WA 1BMLC 3IAS1 4B0MA 2DIQA 2LGSA 2WSFE 3Q2AC 4K7UA 1LGRA 4P1CC 4C5EA 1YHQQ 1WYXA 4A20A 2PVGB 4HA8A 2JY6A 3LWIA 1KLVA 2WSEE 1Q10A 3A1PA 4RTXA 2AZSA 2LRQA 1M30A 5AZGA 1YWPA 5IH2A 4JLGA 3QSUA 4LCDE 2E5QA 4IUUA 3JW0X 2JRIB 5G2NA 2LVPA 3R66C 4A90A 3OA6A 4NY0A 2LD9A 4AZ9A 1O75A 2L8DA 3BDLA 4Z8AA 4TV3A 2A37A 4DBQA 1D3ZA 2HEQA 4KRTA 3CEYA 4PK4A 2RMOA 1K53A 2M17A 3JSVA 4Q5WA 2O31A 3PTFC 1NLPC 4BY6B 2WDQB 3P0CA 4Z88A 1NBEB 5CKEA 1G5VA 3QA8A 3SD4A 5DPWA 3EHQA 2J06A 4GLMA 1OYXA 4OB0B 3PRPB 2X51A 2X4WA 4BE0A 2JVVA 2VV5A 4Y91A 1ZX6A 2O2VA 3VYGA 4R0KA 5I22A 1HXYD 3MC9A 3JCMf 3TUOA 1ZA1B 1KOTA 1WA7A 1X6OA 3IQLA 2KMTA 3PHXB 3MKDA 3REBB 4E7KA 1VD2A 2LVQA 2ZPIB 2RSUA 5JHBA 2CZ7B 4C5IA 1PRMC 1UDLA 3OYAA 3EG0A 3A8OB 2DJQA 4JRIA 4ESRA 2C7MB 1HXDA 1WIEA 4EMGA 3M63B 1TS4A 5IA7A 4ZNXA 4MH8A 4RNAA 2QHOA 5LJ3e 1UGPB 2AL6A 2IVWA 4DXAB 2G45B 1VA7A 1ACCA 1RI0A 3W5UB 2WU2B 5LJ3f 1PGBA 1FXXA 4M7AB 4BFRA 1IO6A 3ZBDA 2RI5A 4PS7A 2PKOA 2DJZA 5GAOp 4YTLA 3HPBA 3R6OA 3VR8B 4C80A 4JE3B 2HQHA 4CC3A 1N62A 3DVNU 4FT4A 3U23A 2MJ3A 2E65A 2EQJA 2QA4Q 4PNOA 1YI2T 1TS2A 5CKFA 4ZGJB 3WVEB 1VQ5T 5LJ5e 2XDPA 3JCMb 2E5KA 1PSEA 1S72A 1N8RR 2EFIA 2Q5WD 1RACB 2KJ6A 1RADB 4QVZA 4DOVA 5LJ5f 1Q82R 4M7AA 3ZQ4A 1QF6A 2HL3A 3AN1A 3HPCX 4C5HA 2KE9A 2EELA 3FJPA 5DY9A 1M8VA 2LEKA 2M4NA 3E1SA 2QAZA 2QTVA 1TWBA 3AHUA 5HI1A 3VYHB 5HFYA 2KD0A 2V1YA 4GB9A 4OW0A 2LFIA 1Q7YU 2BYEA 1AT1B 1PQSA 1FWZA 4MSMB 4MH0E 1ZPSA 2LWPA 3WALA 3GS2A 2K8BA 4FYWB 2O4XB 3ZXVA 3NHNA 3MJ5A 4L1BA 1SE3A 3MP9A 4OZCA 4EOYA 1X6GA 1ET9A 2KN5A 1Q81U 2J05A 1K76A 4CC7A 3CWIA 2IJ0A 3CMAT 1WXMA 3CQTA 1GXIE 1PRLC 4IWQA 1WGGA 3IXSA 2BUDA 2YSQA 1AN8A 4WF2A 1PG5B 2OEDA 4ASWC 2RQWA 3LWHA 4ZYSA 2P0QA 1I42A 4TQ1A 2DLBA 2EPDA 1Q86U 1F2RI 3LJ3A 2KAJA 2EJGA 4OB3B 1YJNQ 1KJTA 2M1HA 3L2QA 1VQ8Q 3CSFA 3VS7A 2KEAA 3T9LA 3EHRA 4KBMB 5L8RE 2MLBA 4K7SA 4GN1A 4RTZA 1V8CA 3HP9A 1QVGP 3CCQA 3CXCS 2FNJB 4ZRKA 1RWSA 3NFCA 4KUDK 1UH6A 2SRCA 2J7QB 4FW2A 1ZUD2 2KI7A 4M78B 3MP1A 2OTJA 3VUYA 1QLBB 2WWZA 4AQ7A 1J7BA 2WP9B 3H8HA 1AHJB 2RNAA 2QMTA 1Y71A 2Y5PA 3EH2A 1PD1A 4FL6A 2K3BA 1WFYA 2ON8A 3QUIA 4M77B 1MI0A 1OTRB 1G2BA 4M00A 1SE9A 5GAMe 1QVFA 4WJOA 1MMAA 3A1QA 4N6EB 1TU0B 3UA7A 3R7RA 3VTWA 1SHFA 3N9YC 3JB9H 4EMKA 1I5OB 1NJIC 4QAYA 1YX5B 4J8OA 4LNFA 2KK4A 2JJ9A 5BYQA 3RERA 3HK0A 2DNFA 2V14A 1W6XA 3BK1A 3FC3A 2MF2A 4HKQA 1PYWD 3PGGA 4PFOA 2KO3A 2AR5A 1S1NA 1K52A 1I07A 4P5NA 1KD1R 2LJ5A 3GE3C 3N5BB 3PE0A 1M5Q1 3CSTA 2HZYA 1SJED 3NVZA 1EFNA 4MZPA 2J0KA 2JF5A 2E3HA 2BGFA 2MHJA 3SFDB 4A8XC 1HQRD 2D5GA 2MMPA 4XU1A 1J19A 1H641 2XBBC 2OTLQ 1WJRA 4N4GA 2SEMA 1WGHA 2WXIA 3P8BB 3SHWA 4BI8B 4M7DC 3PLVA 2DVJA 4M7DD 5EDSA 2KSSA 3NVWA 1P92A 2OJWA 3OJ4B 4P7IA 2DL7A 4NJ6A 2WDVB 4K3CA 5LJ3j 1WXBA 1YOVB 3OS2A 3LYYA 3NZSA 5FROA 4QT7A 2LX9A 3GP8A 2CSKA 3KYCD 4HKEA 2G6FX 2CT4A 1WHJA 2JS0A 2L3PA 4OGCA 2JSVX 2OAWA 1QOGA 3U2SC 4N9F4 3RMSA 1E0ZA 3Q8EA 3CCST 3OYGA 1OEBA 2GQIA 4DEXA 2PEAA 4J3OD 1QOAA 2V6VA 4C8QD 4M75B 2X35A 1FXTB 1FXIA 4F7ZA 2FL7A 5LXIB 1XEEA 2DAFA 1FRRA 1ZOYB 5IO9A 4YSZB 5LJ5j 4OVUA 2DA9A 4KH0B 5AUKA 4EEWA 4F14A 4EKUA 3KLSX 4DBGA 2N9KA 2KQSA 1HK9A 1T0YA 1T3LA 4HVWA 1VQNT 2HTHA 5GAN8 3GZNB 1RAHB 2RB6A 4C0DB 1T0JA 2I1KA 1H4RA 1I4PA 1L7YA 3CCLT 1D4BA 2KYBA 6AT1B 2XKOC 3CCUQ 2DTOA 1DGJA 3VAWA 3RNEC 1FNUA 4M75A 3AE9B 2NBWB 5DPRA 2K7AA 1C1YB 1TJEA 4EUTA 3AI5A 5GAN3 4H2AA 2QDLA 1VQMA 2I38A 2RAKA 2KQ4X 5GAN5 2OTJQ 2BBCA 4EZKA 4QQDA 2KT7A 2DZ9A 2LJ3A 5EE0A 1N9RA 1YJ9A 5DPTA 2FEIA 3BE3A 2IYDB 3MHSD 4II1A 1FPYA 2ROTA 2KZRA 4OMQA 4PL6A 4L59A 2LCSA 4E7SA 2V4LA 3H7SA 2XD0A 1G3TA 2X3WD 1PHTA 3GLXA 3TEZA 2J42A 4FJVB 3TL5A 2DERA 1V81A 3OBYA 1TGZB 3E9FA 4C4VB 1A0NB 1KQSS 4MDXA 3O65B 4AOFA 2ZCCA 4ZGDB 2IY0B 2KVZA 4W9HA 1FRDA 1I35A 2KTRB 3V7SA 3R8BA 2HAXA 4KSKC 2KMMA 4ARIA 3X0WA 3KUZA 3EFSA 3OW2A 3JCMh 2KJRA 3CC2A 3PLUA 4KKJA 1BI2A 1UHFA 3CD6T 3H9NA 1HTQA 3A4SC 3VTVA 1BXTA 4OP0A 2KACA 3RUIB 2NPTB 2VASA 5I21A 2TSSA 1JALA 4J7FA 3U30A 1RI9A 2IGDA 3VH3B 1YQBA 2F2VA 3ZW3A 3CXCP 2EYQA 5GAMj 1CZPA 4JJCA 2NVUI 2K2MA 2YVCA 4WWNA 2NCNA 5HG2A 3LLRA 3CCJT 3GZNI 2L5QA 4G50A 3RNFC 2CGHA 3IQ2A 1BUIC 1JB0E 3TEYA 1YJ1A 5LJ3h 3VRZA 3S3NA 1W1FA 1OPLA 4Z02A 2G3QB 4W9GA 2Y90A 1M90C 4K3BA 1BBZA 2YLCA 5KYYB 3L17A 2PQWA 4MSQB 4CC4B 4R3DA 3INZA 2INCC 1IGDA 4EFOA 2MPXC 1QCFA 3TEWA 1XCTL 2WLBA 1QQRA 4GMVA 2DZMA 2JUFA 4JLCA 3B08A 2KVRA 3V7RA 4ZTFA 3VVWB 3VR9B 2GB1A 1WHHA 3QARA 4BKSD 2RQTA 3ER0A 3M5AA 1N8RC 2ENMA 1SSHA 3I3TB 1OZ2A 4D8DA 1VQOT 2GBKA 2KMAA 2XK0A 3TSSA 3U7DA 5LJ5h 1XLQA 4C92B
chains in the Genus database with same CATH topology
2LASA 4CO7A 2KR3A 2IO1B 4AKVA 2KROA 3PPAA 2DMOA 1HD3A 4JQWC 2G4DB 4A3PA 1KM7A 1I1JA 5J18A 1BT0A 4FLHA 3NY5A 4BBNC 2JWZA 3T8MA 4ZRJA 2OJ2A 3KYDD 3TMPB 1ZSGA 4AFSC 4M8NA 5CHFA 1XD3B 4WWPA 4OVVA 1JEGA 4HCKA 2NBVB 4DHZE 5FWCA 1GCQC 2FPDA 2CR5A 2K9GA 1V80A 4E74A 4HPMB 1WJ6A 5DCNA 4CYEA 4TKNA 2RR9A 1H92A 3LDZE 1GL5A 4I6PA 2CUBA 1JQQA 3W1SA 2MP2A 2PE6B 4HCNB 2FRYA 2KFKA 2YLMA 1H3HA 4RTTA 4WAAA 2D2QA 3H7PB 2LUEA 3TIXA 2YT6A 3PZDA 4RM8A 4GDLB 1K8RB 1WY8A 5D6JB 1WXVA 1TUCA 4OMLA 2RD0A 5IXFA 2KC2A 3DCGA 2M51A 3QQ8B 2KKCA 4J9HA 1IP9A 4RTVA 3DBLI 4PS8A 2XEWA 2GGRA 1NEBA 2GTJA 4W9CA 4IWPA 3TSZA 2CSQA 1P0RA 5AZHA 4DWFA 3JYUA 1LFDA 4E71A 4JL9A 1QWFA 4FULA 1WI7A 5JZEB 3V6EB 3KW5B 1WFWA 5GJVB 4IKDA 4PQOA 1ZUKA 2DX5B 5C23A 3H0HA 2WWEA 1WXTA 2C60A 2LP5A 2I4KA 1OPKA 3AU4A 2FCNA 4HDQA 4W9KA 3EGUA 4J9DA 3QIJA 2DE0X 2AKKA 4GU2A 2CH4A 3DBRI 3C0RB 2I1JA 2OJRA 4ORZA 2R2OA 4RMAA 4F8CB 4NAWA 2PJHA 2AKLA 5HKHA 2M1MA 1Z9ZA 4FJYA 3QAQA 2R2QA 1UJYA 2K8HA 3V60A 4OMNA 4LJPB 3VUWA 1WLPB 3MTNB 4AUQC 3A4RA 2JT4B 4WJQA 1A5RA 3X23A 1GCQA 4IKBB 3IFWB 4DHJB 2EYXA 1EF5A 1WJNA 2A08A 3ZNZB 1MG8A 2KHWB 4WQOB 3WA0A 2F2WA 4CC2A 4X57B 4IKBA 1E8XA 1YX6B 4MELA 1UE9A 1LXDA 5GJWB 4MGKE 2HDAA 1WX8A 1J3TA 3RYTA 1WGDA 1V5TA 2VRRB 2JVCA 2MA9B 3HM6X 2DZJA 2FPFA 1JRUA 3L10B 1WI0A 1E90A 2AWTA 2LRUA 3DBHI 4FSSA 3NS8A 4HWIB 5JHAA 2EYYA 2PZ1A 2Z59B 3ZRFA 2MBOA 1T3SA 1Z9QA 1G83A 2DRKA 1JXOA 3C0CA 3PVLA 4B9KA 1SHGA 2GBJA 2KNBB 4W9LA 1WXSA 3NOBA 4E3CA 1WYWB 1TTNA 4G3XB 1SPKA 2ZNVB 3PREA 3VS3A 1RAXA 3RT3B 4K11A 1VYVA 2D8HA 1X1MA 1K4US 2DLPA 3V61A 2EQIA 1K1ZA 2MBEA 4RTUA 2JTEA 3O5ZA 2KNBA 4GIVA 2DL5A 1Y8RC 1GC7A 5C1ZA 2ZVOA 3QK0A 3DYTA 2C9WB 2LNHB 3REAB 5CX3A 2RAIA 2DX1A 4XX5A 1B3QA 4J9IA 2UYZB 2M8SA 1GD5A 4AWJA 2B86A 4MJSB 1NM7A 4B6WA 3EG2A 4ANUA 2VWFA 3SDLC 3EG1A 3M0SA 4JJDA 1WR6E 4LDTD 2DRMA 3ZDMC 2KQ7A 3I5RA 1SGHA 4EIKA 2J6FA 2O6VB 1J0GA 3WAMA 3I5SA 4LUDA 3ALBA 2J7IA 2J6OA 2DM1A 2DNUA 1WGYA 3ZIMA 2JXBA 3HM3A 3APDA 1ABQA 2M0XA 2BZXA 2LJ1A 3IVFA 2EGEA 4K81A 2MSED 3TCAA 2MCNB 3QHTA 3TJPA 2K6DB 3VQIA 1MV3A 5LLIA 3SHQA 3MJWA 2MW5A 4HLEA 5KHOA 2YUPA 1RUWA 1V9JA 2L00B 2CT3A 1P9DU 2JUOA 2BYVE 3M0PA 2LVOA 1RFAA 3JVZX 4FADA 1QZEA 3ZNGC 2DYBA 2MCNA 5IXBA 4AJYB 2GNCA 4FHKA 3I35A 2D11A 1E7VA 2RGFA 2KX0A 4AP4C 1RRBA 2D3GA 3VDZA 1GFDA 3LUIA 3RBBB 2NWMA 2EKEC 5JH5C 2D8JA 3ML8A 3ZKJC 2MBBB 2DL4A 2I0NA 4CHKA 4WJNA 1WMHB 1OV3A 3VS1A 2BF8B 2LI5A 2L73A 1H8KA 4BOSC 1SRLA 3UA6A 2K79A 4RUGA 3THKA 2FIDA 3DVGX 2EGAA 1WJ4A 4GDKB 1I0CA 3VXWA 1AZEA 3VS5A 1S3SG 3R7QA 3W1SC 2C5LC 1M3CA 4HASA 4HVUA 4IM2A 1GFCA 1GC6A 2YUOA 5IAAC 2HE7A 1R4MI 2LZ6B 2BTTA 2CKHB 3V6CB 2LGXA 2FG0A 2LQNA 4ZDVA 4HK2A 1UGMA 4HCPB 1M8MA 3PT2B 1NYGA 2O88A 3UF4A 1M3AA 2KDBA 4RM9A 3A9KB 2KTRA 1N5ZA 1WF9A 1NBFC 3A98A 2KLCA 1V86A 3ONSA 2KT8A 5E6OA 4FA6A 2KBTA 3P2BA 2DENB 1XQQA 2NPTA 1PKSA 3KFVA 3UQBA 4ICUA 2GBQA 3ZL7C 3PRZA 3DVGY 3ULRB 3QX1A 1L2NA 4WWOA 3KVFB 4AJWA 2C7NB 1MUZA 2KOXA 3N3KB 3QWXX 2OOBB 2KDEB 1WX9A 4DEYA 4KDLB 1OGWA 2GBNA 3M0UA 2LQWA 1WM2A 3H0FA 4W9JA 1MV0B 5D94A 5FWBA 3NZUA 3SD5A 4TUUA 2D1XA 2D0NA 2WX0A 1XT9B 2EKHA 2LXCA 4P2IA 3HHMA 3M62B 1UZXB 1SIFA 1M94A 3RD2A 1TUDA 3PV1A 2EGCA 4HJKA 4KIKB 2WDTB 2N9PC 3AXCA 4KVGB 3B1LX 4J9EA 1LQBA 2RPNA 4II3B 3KH0A 4NJ7A 1ZBJA 1R4NI 1IPGA 1LM8B 2LGDA 4P2JA 2KYMA 3M3JA 4IUMB 2W9NA 2NR2A 2L2PA 3L54A 2FCQA 3R6NA 2EYZA 1NDDA 5IHIA 3PS6A 1UGVA 3D32A 2VKNA 3QCAA 2GTOA 2DL8A 4DHJD 1AWXA 1SEMA 1OEYJ 3APCA 3OLMD 4F17A 4AFQC 2BZYA 3ZNID 1GCPA 1E8WA 2K1FA 2ZJDA 3OJ3A 4JZ3A 2AYOB 1P1AA 2EMTA 1YN8A 1YIWA 2GBMA 1KJWA 3H7PA 3RZFA 2JXXA 1SRMA 1WRDB 2KXJA 1WR1A 4GDLA 1ABOA 3VRYA 3SU8X 1V1CA 2HJ8A 4M0WB 3H6NA 1RLQC 1IYFA 3WANA 3OAWA 4YL8A 2K25A 2FPEA 3ECIA 1YP5A 1AWJA 3VS4A 3IG3A 5ECAA 3H9DA 3IBEA 2ASQA 1AD5A 4JPBW 1GUAB 1WXAA 2N9EB 4GXBA 1Z2MA 1OCUA 1QKWA 4DDID 2FAZA 2VVKA 3UIOB 1WX7A 3N30A 2JM8A 4E6RA 2CUDA 2XK5B 2CSIA 2P4RA 2KRSA 1HJDA 2ZNVC 2IIMA 5L23A 4X1VA 2K8CA 4Y92A 4I6LB 1ZLMA 4J9GA 2RN8A 2CU1A 1XTNA 2DZKA 1B07A 3NGPA 2NBUA 4KV2A 2DAJA 2V3SA 1O7KA 3M95A 2KWUB 4AG1C 1VCBA 4D8KA 2LXAA 1PKTA 3AU5A 2L7RA 2L8JA 1WM3A 4JJBA 3PHWB 1ZUYA 2AZVA 3UIPB 2X3XD 2WX1A 2A36A 4W9IA 2MRPA 4W9DA 2BYFA 1UHCA 3QWYA 2A4ZA 2KGTA 1AVZC 2IO3B 1V49A 3KUCB 1WDXA 2MWSB 4HXDA 4AFUC 2AL3A 2KDFB 4IIMA 3NMZC 2ZCBA 2KWVB 2BKRB 3ML9A 2L05A 2BWES 1RLPC 4MM3A 3AULA 2JT4A 2G4SA 3DDCB 2DBMA 1E8YA 4IW0A 4A3OA 4PS3A 4K1RB 5D7GA 5EC7A 2O6VD 2PTKA 1ZKHA 4ZYNA 5D2MB 2A28A 2KTFA 2DF6A 2KANA 3LH5A 1K0SA 2O2VB 3PSEB 2RPQA 3EECA 2B3AA 2O9SA 2ROLA 2N9XA 3W1YA 3EC8A 1HSQA 2UWQA 4KDIC 4G0NB 3N32A 4NPNA 2XMFA 1JXMA 3A33B 3PGEA 1JO8A 2CZOA 2IY1B 3QC8B 2HCKA 3BINA 4IIOA 2V1QA 1ARKA 2K39A 4BKGA 4ON3A 2ETTA 4IWOA 4GBQA 3BY4B 2KK8A 2CS4A 1QWEA 2KJHB 5L83A 4DDGD 1QKXA 4FBJB 2IBIB 2W10A 5TR5A 4WCIA 3K9OB 2CDTA 1E6HA 5IHNA 2REAA 2MIOA 2BPSA 5IHKA 2DYMA 2KX3A 3UF8A 2J0JA 4XC2A 2L3QA 1RLFA 2D07B 4J6IA 1AEYA 2MQJA 4G11A 3CMMB 1WH3A 2V1RA 2N7DA 3ZDTA 2HBWA 5CHWA 1GNUA 4GOCA 5HCKA 4KSLC 2KRMA 2MOXA 3L13A 1WE7A 1ZW7A 5J17A 3L16A 2KMCA 3VHTC 4ANXA 4EZLA 2L3ZA 1W70A 3DPDA 3H41A 2CHZA 2FRWA 3TBLD 3VS2A 1U4AA 2RQVA 4FN2A 3FOGA 4AFZC 4MJSA 5FW9A 3A1QB 4BBNF 1OOTA 2JZ3B 3V62A 4BGJA 4F1SA 1X27A 5AEKB 2RQRA 4MGYE 3ZO5B 1U3OA 2F2XA 1YCSB 3EG3A 4Z89A 2O6VA 5GMVA 2A5UA 1C3TA 4XZ4A 2OI3A 2L3SA 3UATA 1UUEA 3H1UA 4RTYA 4LE9A 1AARA 3DVNV 3I9QA 3K9PB 1YNZA 1WXUA 2RQUA 2EVRA 2BWFA 2ABLA 1UBIA 1EF1A 2N1WA 5LXHA 2LMJA 2Z0DB 1WX6A 2K6DA 2IZVB 2BKFA 1EUVB 1NYFA 4NQKE 4OMPA 4F16A 1K9AA 2FCSA 1S1QB 2O2OA 1QLYA 3ZUNA 2DZIA 1G6JA 1U5SA 4LUEA 2WYQA 1X43A 1V5OA 2N4FA 3NPFA 1Q0WB 1Q5WB 1X6BA 1ISNA 1KMDA 1Z5SB 5KHQA 2IO0B 2K6QA 3ZLZA 3U8ZA 3RCZA 2GBRA 2EBPA 2CREA 2LRWA 3PRMB 3R3MA 1NG2A 3A9JB 2EMSA 3HIZA 2J6KA 5E6PA 2MX2A 1UTIA 2FO0A 1WMHA 4II2B 2GMIC 4AG2C 3ZNHB 4DHZB 2YPSA 2M0YA 1Y0MA 1M3BA 4JGHB 1UELA 3ZRCA 3TVTA 2Y5BB 1K0XA 4LDTB 3A9JA 3QWZB 4GDKA 1VYTA 2YDLA 3JV3A 2RAJA 2HD5B 4BKTA 2EYWA 3GBQA 2ZPNA 2MBHA 2ZZPB 4IC7B 1P98A 3H0IA 1V2YA 2L0TA 1X2QA 2IWLX 3UINB 4URKA 5CHVC 2GOWA 2ESWA 3EFUA 1GBRA 1UECA 4ANWA 2LZ6A 1AWWA 2KXCA 4LN2A 3VH4B 3KUDB 2N7EA 1E7UA 2HSPA 1WZ3A 1BK2A 2JW4A 4OMMA 2W0ZA 2REXA 1NLOC 4LJOB 4DK5A 1E5WA 2DYOA 5DPSA 3VTUA 3A9KA 4OXWA 1BU1A 1EO6A 3Q3JA 2KC1A 2BZ8A 4KZCA 1CMXB 5I11A 1BB9A 1WE6A 2CHWA 1LCKA 3M0RA 1GRIA 1GBQA 1F9JA 2JMAA 2Z0EB 1TG0A 4PYZA 3VS0A 3WAPA 2KFJA 3APFA 1T0HA 2ED1A 1UD7A 4ICVA 3RZWC 1H8CA 3QJZA 1CSKA 3TSWA 4WJPA 1HE8A 1J8CA 2NS5A 2PNIA 1UBQA 3Q3FA 1Y57A 1OEYA 1NI2A 5AZFA 2LGYA 3GOEA 1CKAA 5CTRC 1AWOA 1E6GA 1KFZA 2FCMA 3EHVA 2JRHA 2O9VA 1FYNA 3WAOA 2DHZA 3VS6A 1PWTA 1AZGB 1FMKA 5J2RA 1WGRA 1AOJA 4ANVA 3NHEB 2REDA 3L08A 3ZTDA 2CH4W 1V6EA 4MDKE 3WIMA 2KT1A 4TQ0A 4HVVA 1XOVA 3M0TA 1U06A