2DYBA

The crystal structure of human p40(phox)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
322
structure length
297
Chain Sequence
AESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Full-length p40phox structure suggests a basis for regulation mechanism of its membrane binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Neutrophil cytosol factor 4
total genus 64
structure length 297
sequence length 322
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00564 PB1 PB1 domain
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dybA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dybA03
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2dybA01
3RYTA 3PHWB 4K1RB 1WYXA 4QT7A 1V5OA 4CC2A 3PE0A 2I1KA 2CH4W 1K4US 2ZCCA 3S2AA 1E6HA 2NPTB 1YJ1A 3ULRB 1X2QA 2BKRB 2MW5A 1ARKA 2EGCA 2D0NA 1GUAB 1SPKA 2I0NA 3M0QA 4FSSA 1UG1A 2L7RA 4AUQC 2CHXA 1GL5A 2EMSA 3TMPB 5EC7A 2FPEA 2FPDA 3QARA 2L2PA 2V14A 1OCUA 1GJZA 3REAB 1A5RA 2MLBA 2ZNVC 2J0JA 2ZVNA 3DBHI 2EW3A 4IC7B 4RM9A 3VS0A 2AL3A 4BOZB 3HM6X 4GIVA 4LN2A 1TUDA 2LRWA 2KRNA 1WF9A 2W0ZA 3N3KB 2DILA 2QHOA 2PTKA 1WFYA 4TUUA 2ZPYA 2ETTA 4RTTA 2AKKA 1G83A 1NI2A 4LCDE 4Y92A 4TQ0A 2L3ZA 2O6VD 4PYZA 2N9XA 2G4SA 2ECZA 3VTWA 2K8CA 2KHWB 1ZW7A 3NHEB 3N30A 1K9AA 1RI9A 1KMDA 2LGYA 4J9GA 3KFVA 4IWOA 2O9VA 3RULA 2RAJA 3VS2A 3R6NA 4WWPA 4K7UA 2WDTB 4K81A 4TKNA 1OCSA 5HKHA 1E8XA 3W1SC 4HCKA 2RSUA 4PS8A 3TL5A 4IIOA 1UDLA 4JJCA 2SRCA 1PKSA 2GBKA 2ASQA 3H6NA 4NPNA 2NPTA 3EHRA 3IQLA 2LVPA 1GCPA 3KW5B 2MQJA 1YQBA 4JJDA 3WANA 1QCFA 1WXUA 1AWXA 4WJQA 3RZWC 1Z9ZA 2CUDA 2ZZPB 4WCIA 2X3XD 2HSPA 4J9CA 3AULA 2J6OA 2D2QA 1X1MA 4MGIE 3FOGA 2KTFA 2LJ0A 1HD3A 1AD5A 1OEYA 3N32A 5DCNA 2GBJA 3UIOB 2DL7A 5I11A 1XT9B 3MHSD 1OPKA 2JT4A 1ZUUA 3B08A 2BYFA 2JM9A 4HXJA 1GBRA 4OMMA 4RM8A 2JY6A 4W9EA 1YX6B 2O2OA 1PNJA 4KIKA 1V81A 2AK5A 4JPBW 3QA8A 1X6BA 1WFWA 2WX1A 2WWEA 2KXCA 3M95A 4FULA 3I35A 1WXBA 4DBGA 2D10A 2IO3B 5IHKA 4W9IA 2KDEB 4IIMA 4CC4B 1AVZC 2DVJA 4E71A 2C0IA 2KO3A 2J7IA 4F14A 1HSQA 2D11A 4GN1A 1YD8U 1KFZA 1XTEA 3PT2B 2OAWA 3BINA 1OTRB 4IKBB 5GMVA 2YSQA 2DYMA 1WGGA 1ZUYA 2KFKA 3V60A 3PRMB 4FHKA 1L7YA 2K39A 1VYUA 1WJ4A 2K3BA 3LDZE 3PGEA 1V1CA 1IPGA 4GMVA 4I6PA 2KDBA 2KX0A 4ANWA 1E8YA 1QWEA 3P0CA 3REBB 1IP9A 3U7DA 2ROTA 2JRHA 4MELA 4AJWA 1WIAA 3ZTCA 4W9HA 1E8WA 4NJ7A 3WAPA 3NGPA 3GOEA 2GTJA 2SEMA 4AWJA 1P98A 2F2WA 4DWFA 4F7ZA 4HVWA 5IXBA 2KMAA 4M8MA 2EGEA 4TQ1A 2EPDA 3T8MA 4KDIC 5AZFA 1Y0MA 2LJ3A 4LUEA 4MJSB 1ZX6A 4HCNB 3TIXA 2XBBC 3GBQA 1FMKA 2FUHB 2LUEA 3VS3A 4OMOA 1M3CA 1YIWA 2W9NA 4RTUA 3R7QA 3L10B 1BK2A 2EYYA 4KZ0A 2YT6A 3QCAA 1WX8A 4AP4C 2WWZA 2AL6A 3L13A 4W9CA 4GSWA 4M4ZA 5FW9A 4ANVA 4CO7A 3IG3A 1ZLMA 2QDLA 4IUMB 4GDLB 2N9EB 1B3QA 3ZL7C 3SU8X 3TJPA 3ZVVA 2LXAA 1PKTA 3LH5A 3K9OB 2EKEC 1WGHA 5D6JB 1UELA 2BWES 2KOXA 2PPHA 4IG7B 2MBHA 4DHJD 2JZZA 3VFKA 4DDGD 4DK5A 1JXMA 3A1QB 4IM2A 1BBZA 3VRYA 4BBNC 2KEAA 2RR9A 1V49A 2VKNA 4FHJA 2J6FA 4K7SA 4W9LA 4W9DA 3Q3JA 2X3WD 4LJOB 3ZIMA 3KYDD 2JW4A 2KRSA 2N4FA 1GC6A 2CKHB 1T3SA 2NVUI 5J18A 1FYNA 1LM8B 2R2OA 3NMZC 4WQOB 4P7IA 2DZKA 2K25A 2JXBA 3HPCX 2E5KA 4EZKA 5CHFA 2KTRA 1WDXA 4JZ3A 5IHNA 2BF8B 2L76A 3AI5A 2KWVB 3PRPB 3ZNGC 3L08A 4GDKA 1QWFA 3GZNI 1AWWA 1RLPC 1SRMA 4FJYA 1C3TA 3L54A 4MH0E 4DXAB 2DL3A 1GFCA 4HPLB 3B0AA 1T0JA 3I5SA 3ALBA 4Z89A 3H7PB 4A3PA 2ZJDA 3VH4B 4HDQA 2PJHA 5CHVC 4D8KA 2VWFA 1H6HA 2YVCA 2LVQA 3V6EB 2FEIA 2KN5A 2BTTA 3A98A 3JV3A 4ZRJA 2A5UA 4W9FA 5J17A 5JHAA 1TUCA 1KQ6A 1FXTB 4HLEA 3A4RA 3TSWA 3OJ4B 4KV2A 3W1YA 2FIDA 1WIEA 5GJWB 4NQKE 3I9QA 3NHNA 3SEMA 3KUCB 1NLPC 3H0HA 1WZ0A 1R4MI 2I1JA 2BWFA 3MTNB 3AXCA 1KJWA 1SHGA 2KDIA 2KT1A 2VVKA 2FRWA 2LNHB 2IZVB 2JM8A 2MP2A 3IQ2A 2ZNVB 1UGVA 4RTWA 2XEWA 3PLUA 1WJNA 5CHWA 4MJSA 1SEMA 4B9KA 3VUXA 4PQOA 2RQRA 2HE7A 2RQTA 4GU2A 1SRLA 1X27A 3TSZA 4CYEA 2DLPA 1WXVA 3PRZA 3VXWA 3PTFC 2LWPA 1OOTA 2DZIA 2KXJA 4URKA 5BO4B 2Z0DB 2LJ5A 2IO0B 4F1SA 2K6DA 5AZHA 1E7OA 3WAOA 2DZMA 2DL4A 1TGZB 4IM0A 1CSKA 3ML9A 2GGRA 2Z59B 2KD0A 1E8ZA 4GOCA 2I4KA 1E6GA 2NBUA 4GBQA 4WJPA 4JL9A 1UJ0A 1WH3A 2M0XA 2CU1A 3VVWB 2AR5A 1M8MA 1CMXB 4J9EA 1ZGUB 2DAFA 2JMAA 2EYZA 1E90A 2ABLA 2JRIB 2JWZA 3VDZA 1P9DU 4ANUA 3QWXX 4NAWA 2IIMA 2HEQA 4LE9A 4AOFA 2D07B 1A0NB 3A9JA 4DHJB 1OEBA 2KJ6A 1J3TA 1KJTA 1VYTA 4XX5A 3C0CA 2G6FX 4K11A 2LVOA 3V61A 3R3MA 1MV0B 4J9IA 5KHQA 1ZSGA 3X23A 4HXDA 1T0HA 4KZCA 2BZYA 3EFUA 2M1MA 4HCPB 5JH5C 2CT3A 4D8DA 1YN8A 3TVTA 2REXA 1V5TA 3DVGX 4MGYE 1V86A 2KNBA 3APCA 2O31A 5TR5A 4EFOA 1WXAA 2IBIB 2L00B 4IKDA 4MSQB 2FO0A 3O5ZA 1M30A 4BKSD 2K2MA 2L73A 1NDDA 5IXFA 1JXOA 3U23A 1W1FA 4CC7A 2N1VA 3DQVA 1V2YA 3VS7A 3SHQA 4XC2A 1AEYA 1NG2A 3VS5A 4J9HA 1PRMC 3WA0A 5DPTA 1GNUA 2D3GA 4KSKC 5E6OA 1ZBJA 1JRUA 2EGAA 1NEGA 2IWLX 3QWZB 1RRBA 4P2JA 4KVGB 3JYUA 2AZSA 3EECA 2DHZA 3U30A 3UA7A 4G11A 4DHZE 4KIKB 1M3AA 1YCSB 4N9F4 2O6VA 3PVQA 4ASWC 2OI3A 4AFZC 1B07A 5IA7A 1G6JA 3L17A 1TTNA 2C0OA 4JQWC 2JPHA 5L23A 4DEYA 2MIOA 2KX3A 3L16A 2KKCA 2F2VA 2LX7A 2RF0A 1MG8A 4RTZA 3K9PB 1I07A 1PQSA 4MEMA 4RTVA 1UGMA 5JZEB 4HVUA 2LZ6A 2P4RA 5LLIA 3NZSA 2G45B 3KVFB 2LQWA 3PLVA 4Z8AA 3VS6A 3DDCB 1WMHA 1YWPA 4IKBA 2N1WA 4EZJA 2K6DB 3CMMB 1UZXB 2GMIC 1S1NA 2CSIA 2AWTA 1M3BA 2KR3A 1K8RB 2RAIA 5I22A 2FNJB 4IW0A 3QC8B 4W9JA 4B95A 4JLCA 3KUDB 2LP5A 4NQLB 5E6NA 2MA9B 2K6QA 1JU5C 4G0NB 2NCNA 4K7WA 2RPNA 3QWYA 4IM3A 2M51A 2K8HA 1OGWA 1WRDB 1UE9A 4PS3A 1V9JA 3RNJA 2LI5A 1VD2A 2DNUA 1AWOA 2R2QA 2MBEA 2L0FA 1W6XA 2KE9A 4HDOA 1QZEA 4R0KA 3EG0A 4F8CB 2OOBB 4OXWA 3H9DA 3ZDMC 2REDA 3ECIA 4AZ9A 3IHPC 2PEAA 2L3PA 2HBWA 3VTUA 2YUOA 1I35A 2C7HA 3AU4A 2JTEA 4RTXA 5HCKA 1KM7A 5E6PA 2L05A 3CF6E 4WJNA 1P3QU 2ZVOA 1IO6A 4HASA 1T3LA 1EUVB 2WX0A 3QJZA 4IWQA 2DM1A 2ZEQA 1L2NA 1PRLC 2DRKA 2LXCA 3UQBA 2KC1A 2RQVA 3I3TB 3VUYA 2OJRA 4FN2A 4II2B 2LASA 3QHTA 2G3QB 4FA6A 3APFA 2DE0X 4ZRKA 4BOSC 3EHVA 4RTYA 1LFDA 1WLPB 4MM3A 2RQWA 2KVRA 2YPSA 2ZCBA 3O65B 1NM7A 4E6RA 1Z9QA 3QQ8B 2FRYA 3QAQA 4EUTA 4ZDVA 2DBMA 5D94A 1J19A 3H1UA 1YP5A 2KFKB 3UF8A 2D8JA 3DVNU 1JQQA 4I6NB 2KK8A 4HJKA 3KH0A 1VA7A 3C0RB 3EC8A 2KC2A 2O88A 1ABQA 2G4DB 5G2NA 3I5RA 2KWCA 5EDSA 1UHCA 1WM2A 2GBQA 1U3OA 3FJ5A 1K1ZA 2BYEA 2DF6A 1OEYJ 2DENB 2KWUB 1NYFA 1JEGA 1UUEA 1KIKA 1YWOA 3ML8A 4BKGA 1Z5SB 4W9KA 4KSLC 3HIZA 4FJVB 2W10A 2KTRB 1I0CA 3JW0X 2EKHA 1AARA 1TG0A 2DRMA 1WR6E 4GGQA 1JO8A 3DBRI 4DHZB 3M0SA 1NEBA 1WZ3A 3B1LX 4HK2A 4FBJB 3A4SC 2M0YA 3PREA 1WGYA 5LXIB 1SIFA 3VS1A 2V1RA 1M94A 2CR5A 4KRTA 2JT4B 2D8HA 1WXMA 3D32A 4MGZE 1TBEA 4JIOU 2LGDA 1UH6A 2PZ1A 1AZEA 4LDTB 3LJ3A 2KNBB 2JZ3B 3EG3A 2A28A 4ZNXA 2DJQA 2O2VB 5C23A 2Z0EB 4G3XB 1H3HA 2C7MB 3IFWB 5KHOA 3U8ZA 4WWOA 2A08A 3QIJA 4EKUA 2LQNA 4I6LB 4LJPB 3M63B 1SHFA 3R66C 1WI7A 4GDKB 2EMTA 2GQIA 2BKFA 4J9DA 3DVGY 3LUIA 4ICVA 2V4LA 4BKSA 3VUWA 1KSWA 2H8HA 2L8JA 4E74A 1WI0A 2CZOA 4J9BA 2FCNA 3ZUNA 2REAA 1U06A 2CSKA 3Q3FA 3PHXB 1H4RA 3W1SA 3RD2A 2KMCA 5G55A 1OPLA 4DEXA 1EF5A 2AYOB 3AU5A 2MBQA 2L0AA 1K0SA 4HVBA 4JZ4A 1GG3A 1ABOA 3SDLC 2WYQA 2VRRB 4KDLB 3ZNZB 5L95C 2CUBA 1WX7A 1BT0A 2KRMA 1HJDA 2KLGA 2L3SA 3DBLI 4X57B 4CC3A 1E7UA 4WWNA 3M3JA 1S1QB 3KUZA 3SHWA 5CTRC 2MOXA 2LCSA 4RMAA 2KBTA 2A4ZA 3NS8A 3VAWA 2JS2A 1XOVA 3WIMA 1RFAA 1X43A 3L0WB 4PZGA 1UTIA 1UFFA 1UECA 5JHBA 1SGHA 2RMOA 2M17A 2CSQA 2K8BA 3UF4A 3TBLD 5AEKB 2NUZA 4NY0A 1RAXA 3PPAA 4MDKE 4AFUC 3JVZX 2CS4A 2KANA 4FADA 1Y8RC 3M0TA 1GCQA 4ZRIA 4AJYB 2EYXA 3UQAA 2GBRA 3IVFA 4DDID 1CKAA 4TV3A 2MBOA 3HK0A 4OMNA 2LZ6B 1X6GA 4EEWA 1X69A 1VYVA 2FCSA 1QKWA 1J0GA 4F16A 2LMJA 2XK5B 2DBKA 1E5WA 2JS0A 4PS7A 2AKLA 2LRUA 2CHWA 1UJYA 2NR2A 2EBPA 3H7SA 2JMCA 2MX2A 4MSMB 1BB9A 5IH2A 3H41A 2DYBA 3DPDA 3M0RA 3T9LA 1EO6A 1Z2MA 4LDTD 3A9KB 3RCZA 1GC7A 1MV3A 3M0PA 1HE8A 5J2RA 1WMHB 3HPBA 1YX5B 1R4NI 3PS6A 3QX1A 1VCBA 4Z88A 3VRZA 3BY4B 3RBBB 4HPMB 3ZKJC 3HHMA 1X2KA 2O6VB 1PHTA 2EYWA 2J0KA 2V3SA 5CX3A 4AG1C 3NOBA 4B6WA 2KXDA 2F2XA 4ON3A 2DL8A 1C1YB 4II3B 2RNAA 1WGRA 2ZPNA 2L3QA 1MUZA 2OJ2A 2C5LC 3ZNHB 1WM3A 1QLYA 2C60A 2D1XA 2KZRA 1S3SG 2KT8A 1W70A 1P0RA 4J9FA 1QKXA 4A20A 4OMPA 2KYBA 4ANXA 2PE9A 3OJ3A 1AWJA 2A37A 3H7PA 3APDA 2Y5BB 2UYZB 2CDTA 1ZUKA 3IBEA 1G2BA 3JSVA 2CT4A 5DPSA 2N7DA 4AKVA 2BPSA 1WXTA 1Q1OA 4ESRA 3R7RA 2DYOA 2PNIA 3A33B 4YL8A 3ZRFA 2MRPA 2GBNA 2V1YA 2YLMA 4GXBA 1KLVA 2ENMA 4BBNF 2HTHA 2NBWB 1XD3B 3A9KA 3EG1A 2IY0B 1GFDA 2GNCA 3CSFA 2HJ8A 3SD5A 2FIFA 2ED1A 2GOWA 1WYWB 4AFQC 1XQQA 5L83A 2FPFA 1GBQA 4BGJA 4IWPA 1PWTA 2K1FA 3NPFA 1N5ZA 4BFRA 5GJVB 2GBMA 3VQIA 4XZ4A 2DMOA 1T0YA 2BZXA 1UD7A 3DBSA 3VH3B 2RGFA 1WXSA 1EF1A 2K9GA 4M8NA 2V6VA 2C7NB 2RD0A 4ZYNA 3EHQA 2MWSB 2M4NA 1NLOC 2BYVE 1K0XA 3A1QA 4LNPA 1WR1A 4WAAA 3WALA 4BVUC 2C0TA 4NNJB 1Y57A 2KFJA 2JVCA 1Q5WB 1H8CA 1AOJA 2IY1B 3TCAA 2MSED 2LD9A 2IO1B 3DCGA 2EQIA 2RN8A 1D3ZA 2DX1A 3KYCD 4J6IA 4W9GA 4FJZA 4OVUA 1H8KA 1OV3A 2AZVA 5ECAA 2KJHB 2MCNA 2A36A 2AEHA 3OAWA 1WA7A 2DAJA 1WX9A 2M8SA 3ONSA 1WY8A 1U4AA 3NZUA 3V6CB 3P2BA 4GB9A 1H92A 2NS5A 2FAZA 2PE6B 2CREA 3VHTC 4NJ6A 3H0FA 4HWIB 2YDLA 1WJUA 2MCNB 2L0TA 1NBFC 1V80A 1WE7A 5LXHA 2ED0A 1UBIA 2MP2B 5IAAC 1GD5A 2KROA 1WX6A 5FWCA 3DYTA 4BKTA 2XK5A 1RLFA 4M0WB 4CHKA 5D7GA 3ZNID 2KDFB 2ESWA 4HVVA 2FG0A 2KYMA 2O9SA 2J6KA 3UINB 4G50A 3PZDA 3UGBB 1GRIA 2KQ7A 2KQSA 2IYDB 4AFSC 1K76A 1KOTA 2YUNA 1ISNA 3ENEA 1IYFA 3DOWA 2JF5A 2MBBB 2DX5B 4A3OA 1V6EA 2KJRA 4WJOA 4OMQA 2HCKA 2UWQA 4JGHB 1YNZA 2KGTA 3WAMA 3OLMD 3QK0A 3ZW3A 2RAKA 2YUPA 2LGXA 2J0MA 4F17A 3UATA 3X0WA 1M27C 4GLMA 3CQTA 4AG2C 2J06A 1SSHA 2YUQA 3UA6A 1RLQC 2RPQA 1J8CA 2BGFA 3ZDTA 1UHFA 4GDLA 3RUIB 1NYGA 2B86A 2JUOA 3M62B 2DA9A 1SE9A 2DL5A 3THKA 3H0IA 4ORZA 3MJWA 1E7VA 4EZLA 3ZO5B 4EOYA 3PVLA 1I1JA 2EVRA 1TZ1A 2K79A 2DZJA 2CH4A 3EG2A 4OMLA 4X1VA 4PQPA 1OQYA 2XMFA 1XTNA 3RZFA 2ROLA 1I42A 3NY5A 3V62A 2J7QB 1Q0WB 2B3AA 1EFNA 3PV1A 1WE6A 1RUWA 2N9PC 1UBQA 2O2VA 3A9JB 4RUGA 2J05A 2CHZA 4P2IA 2BZ8A 3ZLZA 1CKBA 3EGUA 2GTOA 4NAWB 1AZGB 4FLHA 4LUDA 3ZRCA 3DVNV 5C1ZA 5IHIA 1O7KA 1GCQC 4JJBA 1LCKA 2FCQA 4MGKE 2V1QA 1WJ6A 2LJ1A 2JXXA 2N7EA 1ZKHA 4ICUA 4PYUA 5FR6A 5AZGA 2RQUA 2K7AA 4OVVA 3UIPB 3PSEB 1LQBA 3ZTDA 2HD5B 2HDAA 2C9WB 2IO2B 1U5SA 3VS4A 3VTVA 2KLCA 1BU1A 2NWMA 5DPRA 5FWBA 4E3CA 1LXDA 2NBVB 3JSVB 4A63B 1F9JA 3RT3B 5DPWA 1WGDA 2FCMA 4EIKA 3CSTA 3HM3A 1P1AA 5D2MB 3M0UA
chains in the Genus database with same CATH superfamily
1D1CA 2RDHA 3RYTA 2EAYA 4QQ6A 3LYYA 1X75C 4BE2A 1OYXA 2CZ0B 3PHWB 4K1RB 2F5TX 3RERA 1WYXA 4QT7A 1MGQA 2P0QA 4ANJA 1V5OA 2MJEA 1YJ9T 1TWBA 2CGHA 3OYBA 3NVZA 4CC2A 3PE0A 4B9XA 1M9SA 2E70A 3H8ZA 2K0PA 3EH2A 3E2UA 3KUFA 2I1KA 2CH4W 1K4US 2ZCCA 3S2AA 1E6HA 2NPTB 1YJ1A 3ULRB 1FFUA 3RI7C 3CBOA 5CR2A 3N20C 2INPE 1VQLA 1X2QA 3VUBA 4HCBA 3HP9A 2BKRB 2KMTA 1ZSZC 2MW5A 1QOGA 1EIFA 3G6ET 1ARKA 2EGCA 4N4GA 2D0NA 5CQXA 1GUAB 2Y5CA 4A8XC 1SPKA 2VXEA 5J26A 1RM6C 2I0NA 3ZXRA 4J83A 1TKGA 1W2BP 3M0QA 4FSSA 1O9SA 1UG1A 2L7RA 3CC4A 3RNAC 2GCXA 4AUQC 2CHXA 2CP3A 3V8JA 1YHQA 1GL5A 3NG0A 1K73U 1F2RC 2EMSA 3TMPB 5EC7A 2FPEA 2FPDA 3QARA 1Q95G 2L2PA 4C56C 5FR3A 2V14A 1ZHIA 3JB9F 5GAN4 2V3PA 1OCUA 3QKJA 4YXDB 1GJZA 1VDVA 3REAB 4EMHA 1KQ1A 4M7DC 1A5RA 2MLBA 2ZNVC 2J0JA 2ZVNA 1HK9A 3DBHI 4PLLA 2QDFA 1V29B 2EW3A 2QC8A 2E4HA 4RNAA 4IC7B 4Q2JA 4RM9A 5KYNA 3VS0A 1JWSD 2AL3A 5GXGB 1EM7A 3HM6X 4GIVA 4BOZB 2RO0A 1A70A 2LQKA 4LN2A 1BMLC 3V3XA 3I56Q 1ACCA 1TUDA 1T6BX 2IPOB 3CC2A 2LRWA 3OBWA 2JZ2A 2LMCA 2KRNA 4PJOD 1WF9A 1SB3C 2W0ZA 5C0MA 1ROEA 3RMSA 1K73C 1XLOA 3N3KB 4HCZA 4GY5A 2X4XA 4E2FB 2DO3A 2DILA 2LT1A 2QHOA 2PTKA 1WFYA 4TUUA 2ZPYA 2ETTA 4RTTA 2IGHA 2AKKA 1WGKA 1ZA1B 2M56B 2J52A 2E64A 4DA4A 3QSUA 1G83A 4L5GA 3SWNB 1OQRA 4C4VA 2WSFE 2SAKA 1FM0D 1JROA 5CIUA 5GAOm 3L2QA 1NI2A 3EA6A 1I5OB 3KWLA 1N8RU 1Y7XA 1VIEA 4LCDE 4Y92A 1E6EB 4YTMB 1F77A 2D3AA 2OHFA 3N9YC 4PFPA 1M1KR 1ACMB 3KXTA 1HZ6A 2Y5PA 3OYLA 1Q82R 2L3ZA 1B7TA 3EFRA 2N9XA 2O6VD 2G4SA 3AE5B 4PYZA 4C5GA 2ECZA 3VTWA 1TH7A 2K8CA 4BAXA 4DBFA 3EG9B 2KHWB 3JCMP 1ZW7A 2DTIA 3NHEB 4KULA 1QLBB 2DZCA 2HD0A 3N30A 1K9AA 3FB9A 3HRUA 1RI9A 3OMGA 1KMDA 1ZA2B 2LGYA 4O1NA 4J9GA 2Z8LA 3VYHB 3X26B 4C5HA 5GAOp 3KFVA 4P1CC 5AUKA 1VQ7T 4IWOA 1LPLA 1XNIA 2O9VA 3I63C 1TS9A 3RULA 1KHIA 2RAJA 3VS2A 1RAEB 4BKGA 3AT1B 3R6NA 4WWPA 4K7UA 4LDYA 2MPXC 3G7ZA 5DM7R 4XU3A 1OX8A 2OTLQ 2WDTB 4K81A 4LK0M 1KQ2A 1NJIC 4TKNA 2K2VA 4HT9A 1OCSA 2WHIA 2JN0A 5HKHA 3MKDA 3ZYYX 1E8XA 3W1SC 4HCKA 4L6V5 1VQNA 2RSUA 4PS8A 3TL5A 1FXXA 3CCRT 2XICA 5D6YA 4IIOA 1VQNT 1OQKA 1UDLA 4JJCA 2SRCA 1PKSA 2GBKA 3AH7A 4JWSC 1D1AA 2ASQA 3H6NA 4MMLA 4NPNA 2HNIA 1YNTE 1HZ5A 2NPTA 3EHRA 4D6WA 3CMET 1J7AA 4XAXB 3IQLA 2LVPA 1GCPA 1Q86R 3G1JA 3KW5B 2MQJA 2ZPHB 3C8YA 1YQBA 1OI1A 4YTNB 2LVMA 2X35A 5CAIA 4JJDA 3WANA 4NL3A 3OY9A 4HKQA 1QCFA 3KBGA 1WXUA 1AWXA 1QP3A 2QYZA 3VJPA 4WJQA 1QOBA 3M56A 2EJ9A 3RZWC 1Z9ZA 4DQOC 2CUDA 4M7AF 2ZZPB 4WCIA 1BI0A 2X3XD 4M7DA 2HSPA 4J9CA 3OMCA 4BE1A 2J6OA 1TXQA 3AULA 1QW1A 3CC2T 2D2QA 3AEEB 1X1MA 4LNIA 3I55Q 4MGIE 1VQOQ 2KTFA 1O75A 3FOGA 2LJ0A 1HD3A 3CC7T 1AD5A 1OEYA 3N32A 5DCNA 3DB4A 2GBJA 2KQ4X 3UIOB 2DL7A 3GP7A 2M9UA 4C5EA 3GS2A 4KGTA 1I5LA 2QA4T 1SE3A 4F7UG 3Q6BA 2MH7A 5I11A 1XT9B 3MHSD 1OPKA 2JT4A 4XTUA 1ZUUA 3B08A 2PIAA 3A5ZB 4FXCA 1VR9A 2BYFA 4C80A 2PTLA 2JM9A 4RCCA 4XTWA 4HXJA 2QK0A 3C4SA 5CQYA 1GBRA 3BFMA 4OMMA 3KQ4A 1UGJA 3PMIA 4TMAB 5BMGA 1RL2A 5GAN3 2EKIA 2DTOA 4RM8A 2CP6A 2JY6A 1YX6B 2O2OA 2WDVB 1PNJA 4KIKA 4W9EA 1V81A 2AK5A 1C6VX 4JPBW 3QA8A 3EG9A 1ZOYB 8AT1B 1X6BA 1WFWA 4QKUA 1PUTA 2WX1A 1YIJA 3CIRB 2WWEA 1H641 3JCMW 4PJLA 2KXCA 3JB9J 1R7SA 3M95A 1NYRA 4FULA 1KHCA 3I35A 2GFAA 3TSSA 1EU4A 1WXBA 3W9CB 4DBGA 2D10A 2IO3B 2E41A 5IHKA 1QVGS 2G1EA 4W9IA 1PGAA 1VQ6A 2QG9B 2KDEB 1MMGA 4IIMA 4H2AA 4CC4B 4M75F 1AVZC 5AYFA 8ATCB 4XDCA 1OX9A 2ZPEB 3P8HA 3CMAA 1V8CA 1M8VA 2DVJA 1T3QA 3DKMA 4NZLB 4E71A 2C0IA 4ARIA 2KO3A 2J7IA 4F14A 2NTTA 3CCQA 4R3DA 2DLBA 1GXIE 1L4DB 2BB5A 1HSQA 5LJ5e 4R55A 2D11A 4FM4B 4GN1A 1YD8U 1G3YA 3CCQT 5KYXA 3EH1A 1KFZA 1PSFA 1V1PB 2QEJC 4USAA 4J5YA 3SFDB 4M75G 3SR6A 2DXTA 2MEKA 4ZGEB 1XTEA 2WXNA 3PT2B 2OAWA 4MDXA 3CMEQ 4FW1A 1BI3A 3CC2Q 3BINA 1OTRB 4IKBB 2WLBA 5GMVA 3CCSA 2YSQA 2P0KA 2PQWA 2DYMA 1WGGA 4A9AA 1ZUYA 3GZNB 3N1YC 2KFKA 3V60A 5KYYA 3RKYA 1PGXA 3OYJA 3L2VA 3PRMB 4FHKA 1L7YA 1MJDA 2K39A 1VYUA 1WJ4A 4OMFB 2K3BA 1EU3A 2JX5A 3LDZE 3PGEA 1V1CA 4JRKA 1IPGA 4GMVA 5GAN6 2W55A 4I6PA 2KDBA 2KX0A 4AT1B 4ANWA 1E8YA 1QWEA 2MF2A 3U7ZA 3P0CA 3REBB 4BB7A 2M1HA 2EJGA 1IP9A 3U7DA 5IT9E 2ROTA 3CMAQ 2JRHA 3Q8FA 1N60A 3S3NA 2VV5A 4MELA 5GAMj 4LNKA 4AJWA 4FYYB 1WIAA 3RPFC 3ZTCA 4W9HA 3L42A 3E9SA 4HPPA 1E8WA 4NJ7A 3WAPA 3NGPA 3GOEA 2GTJA 5GAN7 1FD6A 1K53A 3L2ZA 1QOFA 1TS4A 2SEMA 1XLPA 4AWJA 3ME9A 5A0GA 1P98A 2F2WA 4DWFA 4F7ZA 4HVWA 3JSCA 5IXBA 1KF6B 2KMAA 2EGEA 4M8MA 4TQ1A 2EPDA 5IP4D 4BY6C 2Z0WA 4C92G 1YJWT 4C5IA 3IT6B 4RCOA 3T8MA 1ZXIA 3P4SB 3IAS1 3LX7A 1Y0MA 4KDIC 5AZFA 3MHZA 1N6ZA 2LJ3A 3F70A 4P5NA 1Y96A 5BMHA 5FU7B 4LUEA 2RPVA 1W4SA 4K3CA 4MJSB 1ZX6A 4HCNB 3VYGA 5FU6B 2M0OA 3GLXA 1L5PA 3TIXA 2XBBC 2CP2A 3QUIA 3U4EG 3GBQA 1KD1R 3GNGA 1JRIA 3HPWA 1FMKA 2FUHB 2IDYA 1N8RC 3L2UA 2LUEA 3URYA 3VS3A 4RGTA 4B6MA 3AEGB 3P8BB 4OMOA 1HXYD 2HKQB 1GOZA 1M3CA 1WJRA 1YIWA 3TEXA 2W9NA 4RTUA 3AM9A 3R7QA 3L10B 2ZPGB 1YN5A 3CCVT 2SEBD 1BK2A 3R8BA 1WPYA 3A8GB 1SJHD 2OTJT 2JSVX 3DLLA 2QQSA 2EYYA 3AE6B 4KZ0A 3ETRA 2YT6A 1RWSA 3QCAA 1WX8A 2R61A 4AP4C 2WWZA 3VRAB 2PU9B 2AL6A 3L13A 4EMGA 4W9CA 2PMVA 3JCMh 2FE8A 3FILA 3HKSA 4GSWA 4L1BA 4M4ZA 5FW9A 1XO3A 1KC8U 4ANVA 1FPYA 3IG3A 4CO7A 1ZLMA 2M02A 2QDLA 2PUKB 2P84A 4IUMB 4GDLB 2N9EB 3CCQQ 3BZDB 1TKEA 1B3QA 2FBWB 3ZL7C 4NL2A 2B76B 3SU8X 3TJPA 3ZVVA 2JTMA 2V8JA 2LXAA 1PKTA 3LH5A 4ZYSA 2DIQA 4ZTJA 4CQNA 3K9OB 1SJED 1WGHA 2EKEC 2J4XA 5D6JB 1UELA 1Q81R 5GAN5 2BWES 2KOXA 2PPHA 5KYXB 1V1PA 2MBHA 3EGXB 4IG7B 4DHJD 2JZZA 3VFKA 1N9RA 2JTFA 1G3TA 4DDGD 1YJJA 1ESFA 1DJ7B 1JXMA 1YQ4B 4DK5A 2KY9A 3A1QB 2KDMA 1BBZA 4IM2A 3TUOA 3MEAA 1CJEA 1TS2A 3VRYA 2C06A 4BBNC 3VUZA 2KEAA 4O5VA 3G71Q 3SB2A 3RKWA 2LCLA 2RHZA 2RR9A 1JMLA 1V49A 2VKNA 4TQ0A 5EE1A 1KQ6A 3NZ3A 4FHJA 1ZDVA 3V8LA 2J6FA 2AQ2B 2BE9B 4K7SA 4W9LA 1M5Q1 1YMHE 4W9DA 3Q3JA 3M4YA 3EGXA 2X3WD 4LJOB 3ZIMA 3KYDD 2LRQA 3UWNA 2BVCA 4JDSA 4C92D 2JW4A 2NMQA 2KRSA 3EFSA 3HFNA 1GC6A 2N4FA 2CKHB 3WXMB 2WU2B 2H3JA 4M78A 1AHJB 1T3SA 4OB2B 2NVUI 1OULA 4WQMA 1PDXA 2HQXA 3INZA 4F7UB 1Q86C 5J18A 1FYNA 2HBPA 5LJ3g 1LM8B 3JCMe 2R2OA 1VZ7A 4OVZA 3I56T 3NMZC 3FC3A 5AUIA 4WQOB 3MP8A 1VUBA 2DZKA 1UGQB 2ZAEA 4OGEA 2GB1A 4P7IA 2K25A 1NPPA 1RAGB 2JXBA 5IO9A 1BCOA 3HPCX 2RHXA 1LGRA 2E5KA 5FROA 4EZKA 2WXKA 1FXAA 2DXCA 5CHFA 3JCMX 3J7AF 4M7AE 4J3OD 2KTRA 4JRPA 1WDXA 4JZ3A 3CCJT 2KDSA 5GAN2 4M78E 4LNOA 5IHNA 2BF8B 2L76A 3AI5A 4XK8E 3CCJA 1QCNA 1WQ7A 4BI8B 2KWVB 5D3IB 3PRPB 2JU6X 3ZNGC 3FKYA 4IUVA 1QOAA 3L08A 4PJNA 4GDKA 1QWFA 1MMAA 3G71A 4KT0E 1Q7YR 2RM4A 4DBRA 1YJNQ 1K52A 3GZNI 4IKFA 1AWWA 1VQKQ 1RLPC 4XE0A 4PL6A 1SRMA 4FJYA 1C3TA 3L54A 2AT1B 3V8KA 4MH0E 4DXAB 5I21A 4S17A 2DL3A 3AE1B 1GFCA 2V8KA 2H89B 4C8QD 1MFWA 5FLXE 4HPLB 5IOIA 2DTHA 3SDZA 3B0AA 1T0JA 3I5SA 2W3RA 3ALBA 3CCUA 4Z89A 4LD9K 3H7PB 2QEXT 2V9HA 4A3PA 3JCMd 2ZJDA 3L2RA 2D3BA 3BK1A 4HDQA 3VH4B 3C94A 4KGZB 3CCUT 2PJHA 5CHVC 1NEKB 3GE8C 4D8KA 2VWFA 3X28B 3GB1A 1QMCA 1H6HA 3CPWP 2YVCA 2LVQA 4TSSA 1UGRB 4KH0B 3V6EB 2FEIA 2KN5A 2BTTA 4BZAA 3A98A 1KH0A 3JV3A 2X51A 3FEOA 3M9QA 4ZRJA 2A5UA 2Y4XA 1WNLA 4LNNA 4W9FA 5J17A 5JHAA 1TUCA 3A8LB 1FXTB 4HLEA 3A4RA 3BWUD 2RJEA 1Q82C 2NUTB 2I2YA 3MP6A 4FCYA 1B9RA 3TSWA 2HQEA 3OJ4B 1VJKA 4M7DF 4KV2A 3W1YA 2FIDA 2BS3B 3CWIA 5AT1B 1WIEA 3SFMA 5GJWB 4NQKE 2V26A 4WWMA 3I9QA 2WXQA 3NHNA 3SEMA 3KUCB 1NLPC 1I4K1 3H0HA 1YJWA 4ACFA 3J81E 1WZ0A 3DBRB 1MVKA 2K9XA 1R4MI 2I1JA 3OYAA 2BWFA 4OP0A 2QAZA 2WXHA 3MTNB 3AXCA 1HEZE 1KJWA 2XDDA 2Y90A 1SHGA 2KDIA 2KT1A 2VVKA 2FRWA 2LNHB 2IZVB 4J8OA 2R58A 4LDXA 3RFZB 1SF9A 3H9NA 1KLGD 1FX7A 2JM8A 2XIDA 1FNVA 2MP2A 2X4WA 3KWVA 3IQ2A 2ZNVB 1N63A 1UGVA 4RTWA 1IGCA 2XEWA 1WHGA 3PLUA 2LHDA 3TEWA 2COYA 1WJNA 5CHWA 5DPTA 4MJSA 1BIBA 1WRIA 1SEMA 3M57A 3MEWA 1K8AU 2YLBA 3UDCA 4B9KA 4DBQA 3VUXA 4PQOA 1D09B 2RQRA 2HE7A 4AS1A 2RQTA 4GU2A 1SRLA 1BYMA 4MMKA 2ZZDA 1M4VA 1X27A 3TSZA 1LNXA 4CYEA 2V8IA 2DLPA 4VUBA 4IDIA 1WXVA 3LH0A 3LW5E 3PRZA 1RAAB 3VXWA 1MNDA 3QPHA 3PTFC 3CCEQ 2LWPA 1OOTA 2QASA 3X25B 2DXUA 2DZIA 1D6EC 2KXJA 4URKA 5CVIA 2VUBA 3UT1A 1N27A 3JCMQ 2LJ5A 2Z0DB 5BO4B 2IO0B 4F1SA 2K6DA 4XU2A 5AZHA 1E7OA 4MZTA 5FRMA 2YEPF 3CPWS 4M78D 3WAOA 2DZMA 2DL4A 3E9GA 3PZ8A 3TQ7P 1I4QA 3RMKC 2VH2A 5CKFA 1YI2T 1S72T 5FU7C 1BUIC 1FWZA 1TGZB 2WXPA 4IM0A 1YI2A 1CSKA 2JUFA 1TZOA 3ML9A 4IUUA 1Y71A 3I5JC 2GGRA 4QVDA 1KRHA 2Z59B 3RN9C 2RK1A 3VR8B 2KD0A 1E8ZA 1WXQA 4FT2A 4GOCA 1FRRA 2I4KA 1E6GA 1QVFP 2NBUA 4GBQA 4WJPA 4N4IA 3VR9B 2HKNA 4JL9A 1UJ0A 1WH3A 3FILB 4BUGA 2YRVA 1OZ2A 3B2FA 2M0XA 2CU1A 2CZ6B 5GAN8 3VVWB 5JXVA 4QVCA 2AR5A 3V7CA 1M8MA 1CMXB 4X9CA 1C0MA 4OZAA 4J9EA 3EGRA 2N9LA 3BDUA 4OVAA 1XLNA 1MHHE 1NI3A 1ZGUB 2DAFA 2M0AA 2JMAA 4DBHA 4J7FA 1IBXB 2EYZA 1E90A 1PSEA 2ABLA 2YRDA 3L2WA 3DBLB 2JRIB 1QVGA 2JWZA 1P9DU 3AECB 3VDZA 4ANUA 3QWXX 3X20B 4NAWA 3L1AA 1ZXHA 3SWNC 2IIMA 1R77A 4JRQA 3AE7B 2DYIA 4JLGA 5KCOA 2HL5C 2HEQA 1ZE3D 2VZKD 2RI2A 2ZPBB 1YITQ 4LE9A 2D07B 3A9JA 1A0NB 4AOFA 4DHJB 1OEBA 4O6JA 1J3TA 2KJ6A 1KJTA 4M77B 1MPEA 1QP2A 1VYTA 1FNUA 3FC4A 4XX5A 1VQ7A 3C0CA 3HTRA 2G6FX 2WDQB 5DY9A 1KLUD 2Y4YA 4K11A 1XF5L 4ZHPA 1RYJA 2LVOA 1NJIR 4LLGM 3V61A 3H6ZA 3R3MA 1STEA 1MV0B 3J80E 2VGNA 1M90C 4J9IA 1MG4A 5HI1A 5KYUA 4J7IA 1X01A 2AHJB 2RJFA 3BK2A 4C8QG 1ZSGA 4C7YA 2HAXA 3PFSA 3X23A 4HXDA 1T0HA 2D3CA 1HXDA 4KZCA 2BZYA 2KI7A 4ME7A 3EFUA 2M1MA 4HCPB 2QILA 5JH5C 2DK3A 2CT3A 3HRSA 4D8DA 1YN8A 3CCMT 3TVTA 2LGSA 2REXA 3Q3MC 1V5TA 2EKOA 4C92E 3DVGX 3DB3A 4MGYE 1V86A 3CCMA 2KNBA 2WXMA 3APCA 3G4SA 5GANd 4GLKA 2NTSA 1DOXA 2O31A 5TR5A 3OS0A 1CK1A 4EFOA 1WXAA 2IBIB 2L00B 4IKDA 4MSQB 2FO0A 3VV0A 5LJ5h 4HJGE 3O5ZA 1M30A 5LJ5d 4BKSD 2K2MA 2L73A 1NDDA 4D2KA 3OSVA 1I4XA 2HL3A 2JWUA 1VZ8A 5IXFA 2WXRA 3CXCP 1JXOA 3U23A 3P4PB 1W1FA 4X34A 1BI1A 4CC7A 5C6SA 1OU8A 2JYEA 3CCMQ 4C0FA 1QVFS 2N1VA 3A1PA 3DQVA 1E0ZA 4F7UE 1V2YA 3VS7A 3SHQA 1B34B 3NTKA 4WF2A 4RGOS 1EZZB 4XC2A 4J6WA 1AEYA 3PIPA 2MJDA 2X8XX 1NG2A 3VS5A 3GOXA 4J9HA 1PCXA 4B0EA 1PRMC 3WA0A 2JZPA 1I4GA 3A8OB 1KD1U 2YRCA 1GNUA 4P16A 3OYDA 2EWNA 3E1SA 4M7AB 2D3GA 4KSKC 5E6OA 4XTVA 4M78B 1VQMT 3BYTB 2EQKA 2RK2A 1ZBJA 3BW1A 4C8QA 1YITA 2EGAA 1M2VB 1NEGA 2L8DA 2RHUA 3OYIA 1JRUA 2IWLX 3OYMA 1WHMA 3QWZB 1VQMA 1KFYB 1RRBA 4P2JA 4KVGB 1NBEB 4LDUA 3JYUA 1NVID 1JALA 1SIJA 1SSFA 2AZSA 2WP9B 3NRZA 3EECA 2DHZA 3NVYA 3U30A 2DIGA 3UA7A 3CCLA 3MJ5A 1V76A 4G11A 2AQ1B 4DHZE 4KIKB 1VQ6Q 1M3AA 1JWMD 1YCSB 4N9F4 1YCYA 2O6VA 1ET9A 5LJ3f 3BY7A 1PYWD 3PVQA 4ASWC 1Q7YU 5BYSA 2OI3A 4AFZC 1I8FA 1B07A 1RAIB 1VQMQ 2WS3B 3L17A 5IA7A 1G6JA 1IBXA 4KUIA 5FK9C 1TTNA 2C0OA 4JQWC 3JB9D 3S6WA 2JPHA 5L23A 2F69A 1YIJT 4DEYA 2MIOA 5GAMe 2KX3A 1WHHA 1VQ4A 3GE3C 5IAYA 3L16A 4C92F 2Q5WD 2KKCA 4A6QA 1N9SA 2WNMA 3MP9A 2F2VA 1OFFA 2LX7A 4M75E 2F5KA 1VQ4T 2QQAA 4RG8A 5G5GA 2QTVA 2RF0A 1MG8A 4RTZA 1VQOA 4KKJA 3K9PB 2NLUA 2LNVA 2JJ9A 1RAFB 1I07A 2RD1A 1PQSA 4EPCA 2WU5B 4MEMA 2QQRA 4RTVA 1UGMA 3AB5A 4BE0A 4XDDA 4HVUA 5JZEB 3R6OA 2LZ6A 5BMIA 4NS5A 5KYUB 5KYWA 1TS5A 1YN4A 2P4RA 3Q14C 3NZSA 5LLIA 2G45B 3KVFB 3G4SQ 2LQWA 1QQJA 3EFCA 4Z8AA 5KE3A 3VS6A 2LUMA 3PLVA 3DDCB 1WMHA 1YWPA 3G71T 2BS2B 1GB4A 5A0DA 4IKBA 1XQHA 1MNEA 3D7SB 3OW2P 2K6DB 2N1WA 4US9A 4EZJA 4ZHOA 3FDRA 1SF0A 5L8RE 2X9HA 3CMMB 1W2BS 4C0GA 3Q8BA 1UZXB 3AHUA 2GMIC 1S1NA 2F1LA 2CSIA 3URGA 4EMKC 2LFIA 1N62A 2AWTA 1W2BA 2YHTA 4WAFA 4QW2A 1L0VB 2CP5A 1M3BA 2KR3A 1VQLQ 1K8RB 2RAIA 4BACA 4M78G 5I22A 5J39A 2FNJB 4IW0A 1UUPA 3QC8B 4W9JA 2DXBA 4B95A 4JLCA 3CCLQ 3KUDB 2LP5A 3X24B 4CI0C 2VXFA 4NQLB 1ENFA 5E6NA 4US8A 2KK4A 4A4EA 2E65A 2QCZA 4UC4A 2K6QA 2MA9B 2J53A 1JU5C 3PO0A 1SE2A 3R2IA 4G0NB 5HKCA 2NCNA 4K7WA 4NAMA 3PT9A 2RPNA 3RR6A 3QWYA 4IM3A 1ZQ1A 1IB8A 1NZ9A 4Z02A 4C8QB 1I81A 2M51A 1P7FA 2DBYA 1OGWA 1WRDB 2MI6A 1UE9A 2K8HA 4PS3A 4PJOA 1JW9D 1V9JA 4XWTA 3RNJA 1R0BG 1FCLA 3KLSX 1D4BA 2LI5A 1VD2A 2RJDA 2DNUA 1AWOA 1VQ8Q 2R2QA 1AN8A 2AX5A 2MBEA 2L0FA 2XK0A 1W6XA 4FU6A 3PZ7A 3LYIA 1N8RR 4S0RA 2KE9A 3T9NA 4HDOA 3ASKA 1QZEA 4R0KA 4C92A 4JPSA 3EG0A 2JVVA 4F8CB 2OOBB 4OXWA 2ATCB 3H9DA 2DERA 4M01A 1K51A 2G3RA 3B2GA 1ZP0B 4PK4A 3ZFJA 2REDA 3ECIA 3OB9A 1GPXA 4AZ9A 5D6WA 2DAQA 2OAUA 3EGDB 3ZEHA 2D5GA 1C77A 3IHPC 1B34A 2I2LA 5CO7A 2PEAA 4YTLA 3HRTA 2L3PA 1KG1A 4PLIA 1D5ZC 2HBWA 3VTUA 2YUOA 1XCTL 1I35A 1M4ZA 2WGSA 3MEUA 2QQ9A 2C7HA 5GAOq 3AU4A 3W2DA 1ZUD2 2JTEA 4MDWA 4RTXA 2W3SA 5HCKA 1KM7A 4C4VB 5FU6C 2L05A 5E6PA 3CF6E 4WJNA 4ZTFA 3P42A 1P3QU 2EQJA 2ZVOA 1V1OA 3LWHA 4OHJA 1IO6A 1QILA 4HASA 1JWBD 1T3LA 1VQOT 1EUVB 3MEVA 2DEUA 2IGDA 2WX0A 3I55T 1UNSA 1VLBA 3QJZA 3DWGC 4IWQA 2DM1A 4BI4A 2IPKD 1X6OA 2O4XA 5EE3A 4IUTA 4PJOE 2ZEQA 1L2NA 1PRLC 1MI0A 2DRKA 2LXCA 1VIFA 3UQBA 1VZ6A 2KC1A 3OW2A 1WHKA 3EFOB 2RQVA 2X38A 4OB3B 5EE9A 3I3TB 3VUYA 2GQVA 1K9MU 5TSSA 2OJRA 1RI0A 1TU0B 4M7AA 3FAHA 4FN2A 2KACA 2YWWA 4FW2A 4II2B 3CCST 3A8HB 1TS3A 2LASA 3QXEB 1D0YA 2BBCA 4Y91A 1C4CA 3OWEB 4JX1C 3QHTA 1M1KC 2G3QB 4FA6A 5GANh 2R5AA 4PKCC 3APFA 4HKEA 4M77E 1S72A 2DE0X 4ZRKA 4BOSC 3QYGB 3EHVA 4RTYA 5HY6A 1LFDA 3QJ6A 1WLPB 4PJOG 1XXGA 4MM3A 2RQWA 2KVRA 2YPSA 2WXFA 2ZCBA 3CCRQ 1VQNQ 2QI2A 1PC0A 1NM7A 2BB6A 3BYYB 3O65B 4XWWA 3WVDB 4E6RA 1Z9QA 2FL7A 3QQ8B 2FRYA 1MHXA 3QAQA 4HEA1 2QEXA 4EUTA 4ZDVA 4BI3A 2OTLA 2HJ1A 2DBMA 5D94A 2UU7A 2BE7D 3OBYA 1K9MC 1J19A 3NUHB 3NVWA 2OTLT 4C92B 5LJ3j 3H1UA 2FHDA 3P4RB 5H8YE 1YP5A 2VC8A 3CPWA 4XQ3A 2IVWA 1HYOA 2ZPIB 2KFKB 2LGIA 3IXSA 3UF8A 3Q1JA 3JCMJ 2D8JA 2DKGA 3QO3A 1WHJA 1C78A 3DVNU 1JQQA 2W54A 5C3JB 1FMWA 5I2MA 4I6NB 2KK8A 4HJKA 3FLGA 2XD0A 4A55A 4M75A 1YHQQ 3KH0A 2RHIA 2INCC 2EQUA 1RACB 4M7AG 1VA7A 1KC8R 3EUB2 3C0RB 3EC8A 2KC2A 2O88A 4AMCA 1ABQA 2G4DB 4OB0B 3TU4K 5G2NA 3I5RA 5HK3A 2COWA 2KWCA 5EDSA 1UHCA 1WM2A 2GBQA 1U3OA 3FJ5A 3HL8A 4N6EB 2PVOB 1K1ZA 1I4RA 2BYEA 2DF6A 1OEYJ 2DENB 2KWUB 2V3NA 3OYYA 3ZXVA 4RMOA 2KWDA 1NYFA 1WGSA 1JEGA 3Q3NC 1UUEA 1KIKA 2OTJQ 2JNGA 1JB0E 3OS2A 1R8OB 3AEDB 1YWOA 1QVPA 3TEEA 2E3IA 1Q81U 1IGQA 3ML8A 1Z5SB 2BS4B 4L2YA 4UDUC 4W9KA 4KSLC 4E47A 3HIZA 4FJVB 2W10A 1WHLA 1Y96B 3O13A 3P4QB 1L0XB 1IHVA 2KTRB 3B9JA 3L4PA 1I0CA 1UEBA 4JRIA 4A4KA 1PG5B 3JW0X 1ZSZB 2EKHA 2DPPB 1AARA 3E9FA 2L32A 1TG0A 2DRMA 1WR6E 4NJCA 4GGQA 1D5MC 2DD4A 1JO8A 2RDGA 3DBRI 3CEYA 2QGGA 3CMAT 2DFUA 4DHZB 3M0SA 1NEBA 1WZ3A 5GAOn 3B1LX 4HK2A 4FBJB 4N58A 5G5HA 3AEBB 4PT5A 2L3RA 3A4SC 2XHCA 1SKUB 2M0YA 3PREA 3VKIA 2YXYA 1WGYA 1LVKA 5LXIB 1SIFA 3J9CA 3VS1A 4ZN3A 4E7HA 1JJ2P 2V1RA 1M94A 3QIIA 4J6YA 1YJWQ 4KRTA 3CC7Q 2CJNA 2CR5A 2D8HA 2JT4B 1OU9A 4ZOHC 1WXMA 1KK7A 1GAQB 2PVGC 4GLSC 9ATCB 3D32A 2K3YA 4M75B 1N5WA 4MGZE 2NUTA 1TBEA 4JIOU 2LGDA 1T5XD 1UH6A 2PZ1A 4L23A 4RFBA 1AZEA 5HHDG 4IUQA 1J7CA 3EAEA 2BQQA 4LDTB 3LJ3A 2BTEA 7AT1B 1CZPA 2KNBB 4MZMA 4DXFA 4C92C 2JZ3B 1WQWA 2DZ9A 3EG3A 3W5VB 4F04B 2A28A 4ZNXA 2DJQA 3T3OA 2O2VB 5C23A 2DWQA 3U2SC 5HFYA 2Z0EB 1RFKA 4G3XB 2BT6A 2K57A 1H3HA 2C7MB 3ZDMC 3IFWB 5KHOA 3DHIC 2G9HD 1L6VA 3CCLT 1R0CB 3U8ZA 4WWOA 2AQ3B 3M54A 3RUXA 2ON8A 1WJQA 2NYSA 2A08A 4DOWA 4E7JA 3QIJA 4EKUA 2LQNA 1AYFA 5EE0A 1JJ2A 2AIRB 4OZCA 4I6LB 4LJPB 4M77A 2KQWA 2YLCA 1TYGB 3M63B 1SHFA 3S3OA 3R66C 1WI7A 2LHEA 4IKGA 4KH1B 1QVGP 3MP1A 1UWMA 4GDKB 2EMTA 2GQIA 2BKFA 4J9DA 3DVGY 4XTYA 2N9KA 2VGMA 4OF1A 1D1BA 4PFZA 3WVEB 2RI5A 2ZPFB 3I56A 3C12A 3LUIA 4RGNA 4ICVA 2MWOA 2V4LA 4BKSA 3LXFA 3VUWA 2HZYA 3NFCA 1KSWA 2H8HA 3OA6A 1Q7YC 1DYQA 2INDC 4C8QE 2L8JA 3O8VA 4E74A 1YJNT 2KN4A 4X9DA 4OB1B 1WI0A 2CZOA 4FYXB 4J9BA 2ZGWA 2FCNA 3ZUNA 1T0QC 3P63A 4DXGA 1U06A 2REAA 2CSKA 2CP0A 3Q3FA 2VYTA 1F1BB 3PHXB 2GI9A 2K3XA 1RABB 3GPLA 2JXTA 2ICIA 1H4RA 3W1SA 3RD2A 2INNE 1LOJA 2L52A 2KMCA 5KCHA 1DGJA 5G55A 3M5AA 1VQ9A 1XCQL 4QQDA 1OPLA 4DEXA 1EF5A 2AYOB 4DOVA 2K3UA 2MWPA 3CMEA 3AU5A 2E5QA 1QKZA 4K3BA 2MBQA 4KKIA 3QJYA 2L0AA 3OS1A 1K0SA 2E6XA 4HVBA 3CCSQ 4JZ4A 6AT1B 3N1ZC 1GG3A 1ABOA 1XJWB 3SDLC 2LDMA 3QDRB 2VRRB 2WYQA 4KDLB 1EWCA 3ZNZB 5L95C 3MC0B 2CUBA 3AV8A 4JUVA 1WX7A 3U52E 2LEKA 1BT0A 1PD0A 2KRMA 1HJDA 4KGSA 2KLGA 2E1HA 2L3SA 3QBYA 1F0ZA 1L4ZB 3DBLI 3RIRA 3ZBDA 1TY2A 2A7YA 2QA4Q 1YJIA 1QT9A 4X57B 4CC3A 3DLMA 1SSNA 2OEDA 1E7UA 3E19A 1JRPA 3Q69A 4WWNA 3JCMc 3M3JA 1S1QB 1VQKA 2A0FB 2IGGA 3KUZA 5HG2A 2MHJA 2ZW0A 3OYFA 3SHWA 5CTRC 2MOXA 1K73R 5GMKi 1BIAA 4LNFA 3CCEA 2LCSA 3EFOA 3MO8A 4WURA 2ONQA 2KAJA 4M78C 4MZPA 3MFGA 4RMAA 1VOMA 2KBTA 4PJOB 2A4ZA 3NS8A 1N61A 3VAWA 3OS5A 2JQRB 1M1FA 2JS2A 4M77F 1XOVA 3JB9H 3WIMA 4M7DD 1RFAA 1AW7A 2KT7A 1X43A 2VASA 3L0WB 4PZGA 1UTIA 1UFFA 1UECA 5JHBA 1SGHA 2RMOA 3ZJVA 2M17A 2CSQA 1TIFA 2RDBC 3CC4Q 4N59A 5GAMd 2K8BA 1M90U 4C8QF 1Q81C 5MPOA 1HTQA 3GNFB 4B0MA 3CPFA 3UF4A 3TBLD 4KGVB 4JLIA 5AEKB 2LC4A 2NUZA 3NTIA 2LT4A 4NY0A 2R5MA 3CCJQ 2N7JA 3OG5A 3FJPA 1RAXA 3PPAA 4MDKE 1YFNA 1M90R 2XN9C 4AFUC 3JVZX 2PW9A 2CS4A 2KANA 2MK5A 1Y8RC 3HHTB 3M0TA 4FADA 1GCQA 4ZRIA 4HKZE 4AJYB 1YJ9A 2ZW1A 3JB9G 2L5QA 3CXCS 2EYXA 5CK9A 3JCMb 3RNBC 3UQAA 2GBRA 3IVFA 1WZOA 4DDID 2HDEA 1NYQA 1CKAA 1IHWA 1EX4A 4TV3A 2EFIA 3V05A 4PK1A 2OX7A 2MBOA 3HK0A 4OMNA 3C95A 1SBBB 1RADB 2LZ6B 1JBMA 3N5BB 1X6GA 4EEWA 2B8AA 1X69A 1VYVA 4M77G 3G6EQ 3LGFA 2FCSA 2PVDB 1QKWA 5GMKj 1J0GA 5CKEA 4F16A 1RAHB 4ELYC 4N0AA 2LMJA 2XK5B 1ZPSA 2VB6A 4HROA 2DBKA 1E5WA 2JS0A 4PS7A 2AKLA 3DHGC 2LRUA 2R57A 1VQ7Q 1VQPT 2GFUA 1M2OA 3CC4T 3TEYA 3MHXA 5LJ3h 5CKHA 1VQPA 5LJ3d 1M1GA 3TCJA 2CHWA 3LLRA 1UJYA 3SWNA 2NR2A 2EBPA 3HFOA 5IKCM 2JYTA 1UGPB 1FCCC 2JMCA 1VQ5T 1PGBA 2MX2A 3H7SA 4MSMB 5T8IA 1BB9A 1G8XA 4LTUA 5IH2A 3H41A 2E6ZA 2DYBA 1TSFA 3DPDA 3M0RA 3RDVA 1IGDA 3OYEA 4XTXA 3T9LA 1EO6A 1Z2MA 4LDTD 4LDWA 3A9KB 3RCZA 1M1KU 4E7LA 1GC7A 1QF6A 5GANg 1J7BA 1MV3A 2IG0A 1SE4A 3M0PA 1BXTA 1HE8A 1QQRA 5KHQA 1PM3A 3RESA 1C4PA 1VQKT 1Q10A 3NVVA 1TOVA 4PNOA 5J2RA 1WMHB 3HPBA 1YX5B 2LQ8A 4RCBA 1R4NI 3PS6A 2WQYB 3QX1A 1VCBA 2WDRB 4Z88A 5D6XA 3VRZA 3OYNA 1VQ5Q 2BW2A 2EIFA 3BY4B 2E6NA 3RBBB 4HPMB 3CXCA 4M7AC 1HQRD 3HHMA 3ZKJC 1X2KA 2O6VB 3MCAB 5FRNA 1PHTA 2EYWA 2J0KA 2V3SA 4LD6A 5KYYB 1K8AC 5CX3A 2E12A 4AG1C 3Q8CA 5GAMg 3NOBA 2P4TA 4AQ7A 3CBMA 3OSSC 4B6WA 2XKOC 5LJ5f 5GMKl 1HA5A 2KXDA 4QVZA 5DLQE 3BDLA 3P1MA 1WSPA 2F2XA 1M2VA 3M53A 4C0DC 3CD6Q 3SFEB 4ON3A 3QDFA 2DL8A 1C1YB 4II3B 5E6JA 2RNAA 1UF0A 4EE2A 2WXIA 1WGRA 2ZPNA 4M7AD 2L3QA 1XEEA 1MUZA 2OJ2A 4C8QC 2C5LC 3ZNHB 1WM3A 1QLYA 2C60A 1VQPQ 3TEZA 4A4HA 5GAMf 2D1XA 2KZRA 4RGMA 1S3SG 2KT8A 1W70A 4BD3A 4L59A 3BVGA 1P92A 3JCMg 1P0RA 4J9FA 3RNFC 1QKXA 4HT8A 4M7DG 5D7UA 5CKDA 4ZRQA 1TTHB 4E7ZA 4A20A 4A90A 4IURA 2VH1A 5KH6A 4OMPA 2KYBA 4ANXA 5C2TB 1EWYC 2RJCA 4A4GA 3LB8C 1C4AA 1LJOA 3CCVA 3T3NA 2V0GA 2NUPB 4EMKB 2PE9A 1G5VA 3OJ3A 2CYZB 4M00A 1R4MB 1C9FA 3E56A 1AWJA 2A37A 3H7PA 2PVOD 1IXDA 4XGAB 5FKAC 3C19A 2ZCFB 1JJ2S 2KMMA 3APDA 3GP8A 2JOYA 2Y5BB 2UYZB 2CDTA 5GAMh 3S3MA 1IRXA 1ZUKA 2H3EB 1FFVA 4P6VF 3IBEA 1G2BA 2BUDA 2CT4A 3JSVA 5DPSA 2N7DA 4AKVA 4BY6B 3W5UB 3Q8EA 2FYKA 2BPSA 4M7DE 1WXTA 1VQ8A 1F1HA 1Q1OA 1LO5D 4ESRA 3R7RA 2DYOA 2PNIA 3A33B 2HQHA 2XG8D 4YL8A 3ZRFA 4OZBA 2WSEE 1G3WA 2PLPA 1KQSP 2MRPA 4FT4A 3OYGA 1QCOA 1DOIA 2GBNA 2V1YA 4MM3B 2YLMA 3DHHC 4P1BC 1D5XC 2BIVA 4GXBA 1KLVA 2MAMA 2CU3A 3CCUQ 4YSXB 2ENMA 4BBNF 2HTHA 2NBWB 3R2TA 4CRIA 1XD3B 3EG1A 2IY0B 1BKBA 3A9KA 2WXLA 3OW2S 1GFDA 4YSZB 2PKOA 1D0XA 2GNCA 3CD6T 3CSFA 4F7UF 2HJ8A 2FZKB 3SD5A 1FXIA 2FIFA 2ED1A 3CC7A 2GOWA 2XDBA 1WYWB 4AFQC 1FMVA 3CCVQ 1XQQA 5L83A 2FPFA 1GBQA 2DVEA 2KVQG 2V4IB 4BGJA 5GANe 4IWPA 1PWTA 4OGCA 3HVZA 2RHYA 1D0ZA 2K1FA 3NPFA 1N5ZA 3ZJTA 4M77D 5GJVB 4DQ2A 4BFRA 2O4XB 2GBMA 1SEBD 3VQIA 4XZ4A 4LDVA 2NUPA 4EMKA 2DMOA 4ZGDB 3M59A 1T0YA 2BZXA 2VZKB 3OYCA 4FIBA 1FEHA 1N5XA 1PD1A 1Q86U 1KTKA 2P0PA 2IJ0A 2K5PA 3NJTA 1UD7A 3DBSA 5GMKe 3VH3B 4PJOF 2RGFA 3JB9I 4C7ZA 1U1SA 2TSSA 1WXSA 1EF1A 2K9GA 4M8NA 2V6VA 1SXTA 1TKYA 2C7NB 3RNGC 1WJSA 2DETA 2RD0A 4ZYNA 1YJNA 2WXJA 3EHQA 2DD5A 2MWSB 3QHSA 3Q8AA 4ZGJB 3V7RA 2M4NA 3SEBA 1NLOC 2X4JA 3JRZA 1BI2A 4A54A 2QJLA 4ZRPA 2BYVE 1K0XA 3A1QA 3I55A 2CP7A 1UB4A 4LNPA 4ATOA 1D3BB 2MJ3A 1L6UA 4XU0A 4C0ZA 1WR1A 2H88B 2QSDA 4QAYA 4WAAA 4FYWB 3WALA 2O01E 4BVUC 2M19A 4FYVB 2C0TA 4NNJB 1Y57A 1C1AA 2KFJA 4JS5A 1VQLT 2JVCA 2XI9A 1Q5WB 3UI3A 1H8CA 5A0LA 1AOJA 3CCRA 2IY1B 3TCAA 2MSED 5KYWB 2LD9A 5LJ3e 3MPUB 1I4HA 2IO1B 3DCGA 1K8AR 4YWGG 2EQIA 1R4NB 2RN8A 2QIEB 2YEPB 3FRNA 1D3ZA 1CQVA 1YOVB 1JWUD 2DX1A 3KYCD 3ZQ4A 3ZJUA 2L1AA 1KD1C 1YHQT 4J6IA 3RMQA 4W9GA 1PFDA 4ITKA 3QZ5B 4JE3B 4FJZA 4OVUA 4Y28E 1H8KA 1OV3A 3QZ9B 3VRBB 2AZVA 4NOYA 5ECAA 2KJHB 1ZSZA 2GRIA 1VQ8T 4LXCA 1NE8A 2A36A 2MCNA 2AEHA 3OAWA 1WA7A 3V7SA 1XTDA 2DAJA 4M78F 1KC8C 1WX9A 2M8SA 3ONSA 1WY8A 1IGUA 1C76A 3PIOA 1UGSB 3PGGA 1U4AA 3MC9A 4KBMB 4RG2A 3NZUA 3V6CB 1E10A 3P2BA 3FIFA 5BYRA 3PMTA 4GB9A 2K5LA 1H92A 2NS5A 2FAZA 2PE6B 2CREA 5LJ5j 3VHTC 3TREA 4NJ6A 1YITT 3OYKA 2CJOA 3RNEC 3BIID 3H0FA 5BYQA 4Q5WA 3LGLA 4HWIB 2YDLA 3JCMf 1MHNA 1MMDA 5M9OA 5DLOA 1WJUA 4YT0B 4ELZC 2MCNB 5GANj 3CD6A 4QQGA 2L0TA 1FMAD 1FRDA 2MYSA 1NBFC 1V80A 1WE7A 5IN1A 5LXHA 2CZ1B 1FIQA 2ED0A 4YSYB 3SD4A 1UBIA 2MP2B 5IAAC 1GD5A 2KROA 4RKUE 1WX6A 5FWCA 1YN3A 3DYTA 4BKTA 2XK5A 1RLFA 2EQMA 3META 4M0WB 4CHKA 5D7GA 3ZNID 2FZGB 3M58A 1JWAD 2I38A 2KDFB 2QDYB 2ESWA 4YTPB 4HVVA 4B9WA 3AE8B 1I7HA 2EYQA 1YIJQ 2RMMA 4RF0A 4C00A 2FG0A 1XLQA 1U8RA 2KYMA 4REZA 2O9SA 2J6KA 3UINB 4M75C 1K9MR 4G50A 5GAOr 3PZDA 3UGBB 1GRIA 1VQ9Q 2KQ7A 2FVUA 1TT5B 2KQSA 2W82A 1JCKB 4IUPA 4AFSC 4PFOA 2IYDB 1VQ6T 1K76A 4N4HA 2YUNA 1ISNA 1KOTA 3ENEA 1Y56A 1IYFA 2K5FA 1OQQA 3DOWA 4II1A 2JF5A 2MBBB 2DX5B 2D6FA 2ACZB 4HA8A 4A3OA 2LTOA 3BVZA 1Y07A 2BKDN 3GIBA 1SG5A 1V6EA 3NS1A 2KJRA 4M02A 4WJOA 1F2RI 1WYGA 4OMQA 2HCKA 2UWQA 4JGHB 1YNZA 3NTHA 2KGTA 2KSSA 1YI2Q 2RA2A 3WAMA 1T0SC 3OLMD 4PJMA 1S72Q 3UPUA 1UWXA 4KX6B 3H8HA 2E3TA 1IZ6A 2K22A 3QK0A 4F7UA 5GAOl 3ZW3A 2RAKA 1VQ9T 2YUPA 2LGXA 2J0MA 3HSBA 4F17A 1B1ZA 4MACA 3UATA 3X0WA 1M27C 3HVDA 2DJZA 4GLMA 3CQTA 2QXFA 4AG2C 4E7SA 2J06A 1SSHA 2YUQA 3IAM1 3UA6A 1RLQC 3GF5A 2RPQA 5H92C 1J8CA 2BGFA 4HRSA 4C0DB 1QVFA 3ZDTA 4HCCA 1UHFA 1P7EA 4GDLA 2Y3AA 3N1XC 1JQ4A 1IUEA 2CKKA 3RUIB 1NYGA 4FSXA 2B86A 2RH2A 2JUOA 2DA9A 3M62B 2K4YA 5LL6S 1MMNA 4XU1A 4E7IA 2LX9A 1SE9A 1H3ZA 2DL5A 3THKA 3H0IA 3DBHB 4JWUC 5GMKh 4ORZA 2PVGB 3MJWA 3RKXA 2PUOB 1E7VA 2KAFA 4EZLA 3AE9B 2MMPA 3ZO5B 4EOYA 3PVLA 1C79A 2KVZA 1I1JA 1FNWA 2EVRA 5HK0A 1TZ1A 2QMTA 5A2QE 2KYWA 1TUGB 5KE2A 4IOIE 1DOYA 2K79A 2DZJA 2CH4A 3EG2A 4OMLA 3RNCC 4X1VA 1I4PA 3ER0A 4PQPA 1VQ4Q 1OQYA 2QEXQ 4M75D 1G3SA 1IREB 1L0YB 3I57A 2M16A 3CBPA 4PJJA 4BDYA 4M0WA 2QQBA 4OW0A 2COZA 4M7DB 2DNFA 1VRAB 2WSCE 2XMFA 1XTNA 3BVMA 1E7PB 3RZFA 4V2SA 1AT1B 2ROLA 2L89A 1I42A 3WCQA 5IN7A 3NY5A 3AEFB 3V62A 2J7QB 3P8DA 4A53A 2D9TA 1Q0WB 2B3AA 2LJIA 1EFNA 3MJXA 3VU3C 2HMAA 3PV1A 1WE6A 5I4DA 4XYCA 1RUWA 3I9V1 1D3BA 2EELA 2OJWA 1WWTA 1AWDA 4RF1A 2QGFB 1ZDXA 5LJ5g 5CCAA 4JJNK 4ZN1A 3AEAB 2N9PC 1UBQA 3PNWC 2O2VA 3A9JB 4RUGA 1NENB 2FUG1 2J05A 2CHZA 4P2IA 2BZ8A 3OQ5A 3ZLZA 1CKBA 3ZGZA 3EGUA 2N0SB 3M4GA 3OYHA 1NPRA 3ABVB 2XU8A 2GTOA 3QYHB 3G6EA 1V97A 4MT5A 1N6AA 4NAWB 1AZGB 5EG2A 1YQ3B 5J3BA 2A3LA 4FLHA 4LUDA 1Q82U 4E7KA 3DVNV 3ZRCA 5C1ZA 4TVRA 5IHIA 1O7KA 1KQSS 1GCQC 4JJBA 3G4ST 3IT4B 1LCKA 2E3HA 2FCQA 4ARCA 2GLSA 2OTJA 2V1QA 4MGKE 1WJ6A 2X4YA 3JAME 2LJ1A 1K50A 2JXXA 2QTXA 4XTZA 2N7EA 2WACA 1ZKHA 4A4FA 4ICUA 4PYUA 5FR6A 3Q3OC 3QG1A 4KGXB 1HTOA 5AZGA 5GANf 2RQUA 2K7AA 1ET6A 2E10A 5LNK1 4FL6A 2FZCB 2LCCA 1BCMA 2CZ7B 4OVVA 2J42A 4N0AC 4EDUA 4R56A 1TJEA 3BE3A 3DWMA 5D3DA 1VQ5A 4KGRA 3UIPB 3PSEB 4WTOB 1E9MA 2BYTA 2K5IA 2L83A 1LQBA 2WXGA 4WIPA 2RI3A 1KQSA 4KUDK 1T0RC 3M55A 3ZTDA 1FO4A 4BDZA 2HD5B 2HDAA 3HUIA 2C9WB 3CCET 3AE2B 5GMKm 2DEQA 2IO2B 4M77C 4MH8A 2D0QB 3AMZA 1U5SA 1F52A 3JCMV 3VS4A 2FB7A 2XDPA 2XNAC 4RH6A 4JS4A 2HTME 3MC8A 3VTVA 5CKBA 2GF7A 2KLCA 2HSEB 1BU1A 1OZ3A 3PTAA 1YJ9Q 2NWMA 1ZBXA 5FWBA 5DPRA 2WXOA 3EGDA 1LXDA 2NBVB 4E3CA 1TY0A 3JSVB 4J6XA 4A63B 1F9JA 3AE4B 5I2SA 2CS7A 3A8MB 1NJIU 1YBYA 1GB1A 3RT3B 3AE3B 3HRDD 3AN1A 2QA4A 4WH4A 5DPWA 4PJOC 1U1TA 1WGDA 3LWIA 2RB6A 2FCMA 4EIKA 3CSTA 2EJFA 3HM3A 1P1AA 5D2MB 3M0UA 3Q2AC
chains in the Genus database with same CATH topology
3RYTA 3PHWB 4K1RB 1WYXA 4QT7A 1V5OA 4CC2A 3PE0A 2I1KA 2CH4W 1K4US 2ZCCA 3S2AA 1E6HA 2NPTB 1YJ1A 3ULRB 1X2QA 2BKRB 2MW5A 1ARKA 2EGCA 2D0NA 1GUAB 1SPKA 2I0NA 3M0QA 4FSSA 1UG1A 2L7RA 4AUQC 2CHXA 1GL5A 2EMSA 3TMPB 5EC7A 2FPEA 2FPDA 3QARA 2L2PA 2V14A 1OCUA 1GJZA 3REAB 1A5RA 2MLBA 2ZNVC 2J0JA 2ZVNA 3DBHI 2EW3A 4IC7B 4RM9A 3VS0A 2AL3A 4BOZB 3HM6X 4GIVA 4LN2A 1TUDA 2LRWA 2KRNA 1WF9A 2W0ZA 3N3KB 2DILA 2QHOA 2PTKA 1WFYA 4TUUA 2ZPYA 2ETTA 4RTTA 2AKKA 1G83A 1NI2A 4LCDE 4Y92A 4TQ0A 2L3ZA 2O6VD 4PYZA 2N9XA 2G4SA 2ECZA 3VTWA 2K8CA 2KHWB 1ZW7A 3NHEB 3N30A 1K9AA 1RI9A 1KMDA 2LGYA 4J9GA 3KFVA 4IWOA 2O9VA 3RULA 2RAJA 3VS2A 3R6NA 4WWPA 4K7UA 2WDTB 4K81A 4TKNA 1OCSA 5HKHA 1E8XA 3W1SC 4HCKA 2RSUA 4PS8A 3TL5A 4IIOA 1UDLA 4JJCA 2SRCA 1PKSA 2GBKA 2ASQA 3H6NA 4NPNA 2NPTA 3EHRA 3IQLA 2LVPA 1GCPA 3KW5B 2MQJA 1YQBA 4JJDA 3WANA 1QCFA 1WXUA 1AWXA 4WJQA 3RZWC 1Z9ZA 2CUDA 2ZZPB 4WCIA 2X3XD 2HSPA 4J9CA 3AULA 2J6OA 2D2QA 1X1MA 4MGIE 3FOGA 2KTFA 2LJ0A 1HD3A 1AD5A 1OEYA 3N32A 5DCNA 2GBJA 3UIOB 2DL7A 5I11A 1XT9B 3MHSD 1OPKA 2JT4A 1ZUUA 3B08A 2BYFA 2JM9A 4HXJA 1GBRA 4OMMA 4RM8A 2JY6A 4W9EA 1YX6B 2O2OA 1PNJA 4KIKA 1V81A 2AK5A 4JPBW 3QA8A 1X6BA 1WFWA 2WX1A 2WWEA 2KXCA 3M95A 4FULA 3I35A 1WXBA 4DBGA 2D10A 2IO3B 5IHKA 4W9IA 2KDEB 4IIMA 4CC4B 1AVZC 2DVJA 4E71A 2C0IA 2KO3A 2J7IA 4F14A 1HSQA 2D11A 4GN1A 1YD8U 1KFZA 1XTEA 3PT2B 2OAWA 3BINA 1OTRB 4IKBB 5GMVA 2YSQA 2DYMA 1WGGA 1ZUYA 2KFKA 3V60A 3PRMB 4FHKA 1L7YA 2K39A 1VYUA 1WJ4A 2K3BA 3LDZE 3PGEA 1V1CA 1IPGA 4GMVA 4I6PA 2KDBA 2KX0A 4ANWA 1E8YA 1QWEA 3P0CA 3REBB 1IP9A 3U7DA 2ROTA 2JRHA 4MELA 4AJWA 1WIAA 3ZTCA 4W9HA 1E8WA 4NJ7A 3WAPA 3NGPA 3GOEA 2GTJA 2SEMA 4AWJA 1P98A 2F2WA 4DWFA 4F7ZA 4HVWA 5IXBA 2KMAA 4M8MA 2EGEA 4TQ1A 2EPDA 3T8MA 4KDIC 5AZFA 1Y0MA 2LJ3A 4LUEA 4MJSB 1ZX6A 4HCNB 3TIXA 2XBBC 3GBQA 1FMKA 2FUHB 2LUEA 3VS3A 4OMOA 1M3CA 1YIWA 2W9NA 4RTUA 3R7QA 3L10B 1BK2A 2EYYA 4KZ0A 2YT6A 3QCAA 1WX8A 4AP4C 2WWZA 2AL6A 3L13A 4W9CA 4GSWA 4M4ZA 5FW9A 4ANVA 4CO7A 3IG3A 1ZLMA 2QDLA 4IUMB 4GDLB 2N9EB 1B3QA 3ZL7C 3SU8X 3TJPA 3ZVVA 2LXAA 1PKTA 3LH5A 3K9OB 2EKEC 1WGHA 5D6JB 1UELA 2BWES 2KOXA 2PPHA 4IG7B 2MBHA 4DHJD 2JZZA 3VFKA 4DDGD 4DK5A 1JXMA 3A1QB 4IM2A 1BBZA 3VRYA 4BBNC 2KEAA 2RR9A 1V49A 2VKNA 4FHJA 2J6FA 4K7SA 4W9LA 4W9DA 3Q3JA 2X3WD 4LJOB 3ZIMA 3KYDD 2JW4A 2KRSA 2N4FA 1GC6A 2CKHB 1T3SA 2NVUI 5J18A 1FYNA 1LM8B 2R2OA 3NMZC 4WQOB 4P7IA 2DZKA 2K25A 2JXBA 3HPCX 2E5KA 4EZKA 5CHFA 2KTRA 1WDXA 4JZ3A 5IHNA 2BF8B 2L76A 3AI5A 2KWVB 3PRPB 3ZNGC 3L08A 4GDKA 1QWFA 3GZNI 1AWWA 1RLPC 1SRMA 4FJYA 1C3TA 3L54A 4MH0E 4DXAB 2DL3A 1GFCA 4HPLB 3B0AA 1T0JA 3I5SA 3ALBA 4Z89A 3H7PB 4A3PA 2ZJDA 3VH4B 4HDQA 2PJHA 5CHVC 4D8KA 2VWFA 1H6HA 2YVCA 2LVQA 3V6EB 2FEIA 2KN5A 2BTTA 3A98A 3JV3A 4ZRJA 2A5UA 4W9FA 5J17A 5JHAA 1TUCA 1KQ6A 1FXTB 4HLEA 3A4RA 3TSWA 3OJ4B 4KV2A 3W1YA 2FIDA 1WIEA 5GJWB 4NQKE 3I9QA 3NHNA 3SEMA 3KUCB 1NLPC 3H0HA 1WZ0A 1R4MI 2I1JA 2BWFA 3MTNB 3AXCA 1KJWA 1SHGA 2KDIA 2KT1A 2VVKA 2FRWA 2LNHB 2IZVB 2JM8A 2MP2A 3IQ2A 2ZNVB 1UGVA 4RTWA 2XEWA 3PLUA 1WJNA 5CHWA 4MJSA 1SEMA 4B9KA 3VUXA 4PQOA 2RQRA 2HE7A 2RQTA 4GU2A 1SRLA 1X27A 3TSZA 4CYEA 2DLPA 1WXVA 3PRZA 3VXWA 3PTFC 2LWPA 1OOTA 2DZIA 2KXJA 4URKA 5BO4B 2Z0DB 2LJ5A 2IO0B 4F1SA 2K6DA 5AZHA 1E7OA 3WAOA 2DZMA 2DL4A 1TGZB 4IM0A 1CSKA 3ML9A 2GGRA 2Z59B 2KD0A 1E8ZA 4GOCA 2I4KA 1E6GA 2NBUA 4GBQA 4WJPA 4JL9A 1UJ0A 1WH3A 2M0XA 2CU1A 3VVWB 2AR5A 1M8MA 1CMXB 4J9EA 1ZGUB 2DAFA 2JMAA 2EYZA 1E90A 2ABLA 2JRIB 2JWZA 3VDZA 1P9DU 4ANUA 3QWXX 4NAWA 2IIMA 2HEQA 4LE9A 4AOFA 2D07B 1A0NB 3A9JA 4DHJB 1OEBA 2KJ6A 1J3TA 1KJTA 1VYTA 4XX5A 3C0CA 2G6FX 4K11A 2LVOA 3V61A 3R3MA 1MV0B 4J9IA 5KHQA 1ZSGA 3X23A 4HXDA 1T0HA 4KZCA 2BZYA 3EFUA 2M1MA 4HCPB 5JH5C 2CT3A 4D8DA 1YN8A 3TVTA 2REXA 1V5TA 3DVGX 4MGYE 1V86A 2KNBA 3APCA 2O31A 5TR5A 4EFOA 1WXAA 2IBIB 2L00B 4IKDA 4MSQB 2FO0A 3O5ZA 1M30A 4BKSD 2K2MA 2L73A 1NDDA 5IXFA 1JXOA 3U23A 1W1FA 4CC7A 2N1VA 3DQVA 1V2YA 3VS7A 3SHQA 4XC2A 1AEYA 1NG2A 3VS5A 4J9HA 1PRMC 3WA0A 5DPTA 1GNUA 2D3GA 4KSKC 5E6OA 1ZBJA 1JRUA 2EGAA 1NEGA 2IWLX 3QWZB 1RRBA 4P2JA 4KVGB 3JYUA 2AZSA 3EECA 2DHZA 3U30A 3UA7A 4G11A 4DHZE 4KIKB 1M3AA 1YCSB 4N9F4 2O6VA 3PVQA 4ASWC 2OI3A 4AFZC 1B07A 5IA7A 1G6JA 3L17A 1TTNA 2C0OA 4JQWC 2JPHA 5L23A 4DEYA 2MIOA 2KX3A 3L16A 2KKCA 2F2VA 2LX7A 2RF0A 1MG8A 4RTZA 3K9PB 1I07A 1PQSA 4MEMA 4RTVA 1UGMA 5JZEB 4HVUA 2LZ6A 2P4RA 5LLIA 3NZSA 2G45B 3KVFB 2LQWA 3PLVA 4Z8AA 3VS6A 3DDCB 1WMHA 1YWPA 4IKBA 2N1WA 4EZJA 2K6DB 3CMMB 1UZXB 2GMIC 1S1NA 2CSIA 2AWTA 1M3BA 2KR3A 1K8RB 2RAIA 5I22A 2FNJB 4IW0A 3QC8B 4W9JA 4B95A 4JLCA 3KUDB 2LP5A 4NQLB 5E6NA 2MA9B 2K6QA 1JU5C 4G0NB 2NCNA 4K7WA 2RPNA 3QWYA 4IM3A 2M51A 2K8HA 1OGWA 1WRDB 1UE9A 4PS3A 1V9JA 3RNJA 2LI5A 1VD2A 2DNUA 1AWOA 2R2QA 2MBEA 2L0FA 1W6XA 2KE9A 4HDOA 1QZEA 4R0KA 3EG0A 4F8CB 2OOBB 4OXWA 3H9DA 3ZDMC 2REDA 3ECIA 4AZ9A 3IHPC 2PEAA 2L3PA 2HBWA 3VTUA 2YUOA 1I35A 2C7HA 3AU4A 2JTEA 4RTXA 5HCKA 1KM7A 5E6PA 2L05A 3CF6E 4WJNA 1P3QU 2ZVOA 1IO6A 4HASA 1T3LA 1EUVB 2WX0A 3QJZA 4IWQA 2DM1A 2ZEQA 1L2NA 1PRLC 2DRKA 2LXCA 3UQBA 2KC1A 2RQVA 3I3TB 3VUYA 2OJRA 4FN2A 4II2B 2LASA 3QHTA 2G3QB 4FA6A 3APFA 2DE0X 4ZRKA 4BOSC 3EHVA 4RTYA 1LFDA 1WLPB 4MM3A 2RQWA 2KVRA 2YPSA 2ZCBA 3O65B 1NM7A 4E6RA 1Z9QA 3QQ8B 2FRYA 3QAQA 4EUTA 4ZDVA 2DBMA 5D94A 1J19A 3H1UA 1YP5A 2KFKB 3UF8A 2D8JA 3DVNU 1JQQA 4I6NB 2KK8A 4HJKA 3KH0A 1VA7A 3C0RB 3EC8A 2KC2A 2O88A 1ABQA 2G4DB 5G2NA 3I5RA 2KWCA 5EDSA 1UHCA 1WM2A 2GBQA 1U3OA 3FJ5A 1K1ZA 2BYEA 2DF6A 1OEYJ 2DENB 2KWUB 1NYFA 1JEGA 1UUEA 1KIKA 1YWOA 3ML8A 4BKGA 1Z5SB 4W9KA 4KSLC 3HIZA 4FJVB 2W10A 2KTRB 1I0CA 3JW0X 2EKHA 1AARA 1TG0A 2DRMA 1WR6E 4GGQA 1JO8A 3DBRI 4DHZB 3M0SA 1NEBA 1WZ3A 3B1LX 4HK2A 4FBJB 3A4SC 2M0YA 3PREA 1WGYA 5LXIB 1SIFA 3VS1A 2V1RA 1M94A 2CR5A 4KRTA 2JT4B 2D8HA 1WXMA 3D32A 4MGZE 1TBEA 4JIOU 2LGDA 1UH6A 2PZ1A 1AZEA 4LDTB 3LJ3A 2KNBB 2JZ3B 3EG3A 2A28A 4ZNXA 2DJQA 2O2VB 5C23A 2Z0EB 4G3XB 1H3HA 2C7MB 3IFWB 5KHOA 3U8ZA 4WWOA 2A08A 3QIJA 4EKUA 2LQNA 4I6LB 4LJPB 3M63B 1SHFA 3R66C 1WI7A 4GDKB 2EMTA 2GQIA 2BKFA 4J9DA 3DVGY 3LUIA 4ICVA 2V4LA 4BKSA 3VUWA 1KSWA 2H8HA 2L8JA 4E74A 1WI0A 2CZOA 4J9BA 2FCNA 3ZUNA 2REAA 1U06A 2CSKA 3Q3FA 3PHXB 1H4RA 3W1SA 3RD2A 2KMCA 5G55A 1OPLA 4DEXA 1EF5A 2AYOB 3AU5A 2MBQA 2L0AA 1K0SA 4HVBA 4JZ4A 1GG3A 1ABOA 3SDLC 2WYQA 2VRRB 4KDLB 3ZNZB 5L95C 2CUBA 1WX7A 1BT0A 2KRMA 1HJDA 2KLGA 2L3SA 3DBLI 4X57B 4CC3A 1E7UA 4WWNA 3M3JA 1S1QB 3KUZA 3SHWA 5CTRC 2MOXA 2LCSA 4RMAA 2KBTA 2A4ZA 3NS8A 3VAWA 2JS2A 1XOVA 3WIMA 1RFAA 1X43A 3L0WB 4PZGA 1UTIA 1UFFA 1UECA 5JHBA 1SGHA 2RMOA 2M17A 2CSQA 2K8BA 3UF4A 3TBLD 5AEKB 2NUZA 4NY0A 1RAXA 3PPAA 4MDKE 4AFUC 3JVZX 2CS4A 2KANA 4FADA 1Y8RC 3M0TA 1GCQA 4ZRIA 4AJYB 2EYXA 3UQAA 2GBRA 3IVFA 4DDID 1CKAA 4TV3A 2MBOA 3HK0A 4OMNA