2DYBA

The crystal structure of human p40(phox)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
322
structure length
297
Chain Sequence
AESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil cytosol factor 4
publication title Full-length p40phox structure suggests a basis for regulation mechanism of its membrane binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 64
structure length 297
sequence length 322
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00564 PB1 PB1 domain
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dybA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dybA03
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2dybA01
5HCKA 3PE0A 4HDOA 4DDID 2KOXA 2FIFA 4G50A 3X23A 1UZXB 2PTKA 3DVGX 4ZYNA 2K3BA 3IG3A 4FADA 2KXCA 4X1VA 1E8ZA 4GOCA 4Z88A 3ML9A 3CSFA 1V5OA 3QWXX 2LCSA 2D8JA 1AWWA 1WIEA 4X57B 2KTRB 1M94A 3EG2A 4W9HA 2PZ1A 2J7IA 1LM8B 5I22A 1L7YA 3HPBA 5CHVC 5IA7A 3H9DA 1GCQA 3CMMB 1VA7A 1UJ0A 4F8CB 1QLYA 4EOYA 3K9OB 4HCNB 3M62B 2K1FA 4OVVA 2M8SA 1HE8A 2BYEA 3VQIA 1UD7A 2V1YA 3VS2A 5JHAA 2DBKA 1T0HA 2MWSB 1RAXA 2AEHA 1B07A 2BZYA 1BU1A 4LDTD 1OGWA 1RLFA 4AFSC 2JS2A 2LD9A 1Y0MA 4IG7B 4AG1C 2KR3A 1YP5A 1JQQA 2K39A 2O2VB 4PZGA 1MV3A 5LXIB 3RNJA 3SHWA 2CS4A 1XTEA 2EPDA 2CUBA 2FO0A 3R6NA 3VHTC 1X69A 1VCBA 2L7RA 3W1SC 3FOGA 2JS0A 1WMHB 4GDKA 4ANXA 2HJ8A 4KV2A 3ZDMC 4J9EA 4LE9A 2LUEA 3M3JA 3DBRI 1ZKHA 2CZOA 2KFJA 1LFDA 2DYMA 1V86A 1WZ3A 2DILA 4MGYE 2DYBA 4PS3A 1WRDB 3ONSA 2DHZA 4HPMB 4NJ7A 5KHQA 1W70A 3R7RA 2GBRA 4HPLB 2J7QB 2BWFA 1AWOA 5CTRC 2NPTB 5J18A 3ZLZA 1K0SA 1ZUYA 4MJSA 3SDLC 2KT1A 2GMIC 2JT4A 2CU1A 4WWNA 2EVRA 3PVQA 3DBSA 2RN8A 4EZLA 3ML8A 1ISNA 3WAPA 2VKNA 2BWES 2IIMA 2KN5A 2V1QA 2V3SA 3TBLD 4EZKA 1FYNA 3TL5A 2A4ZA 2OAWA 4P7IA 1WXMA 2C7HA 3B1LX 2KO3A 1WE6A 2L0TA 4HXDA 4DEYA 5GMVA 2O31A 3SHQA 1M3BA 4W9KA 2YVCA 2MCNB 3WA0A 4LDTB 3W1YA 3L54A 1XTNA 1V6EA 2M0YA 1T0JA 2H8HA 4DK5A 3APCA 4RTZA 2KBTA 2J06A 1V9JA 4KIKB 2M4NA 3NGPA 1PRMC 4GU2A 5G55A 1AARA 3L08A 4DXAB 5D7GA 1V5TA 4MDKE 2AK5A 1WXBA 2ETTA 1ZLMA 4MGIE 3PLUA 2O6VD 4D8KA 1NYFA 1WR1A 2KRNA 3JSVA 2DL7A 2D3GA 3DYTA 2MBHA 2V4LA 1X6GA 3KVFB 3U7DA 2N9XA 2LJ1A 3ZUNA 3I35A 2EBPA 3ZW3A 3I9QA 3EGUA 2DRKA 3A98A 1WJ4A 3H0HA 2YLMA 1B3QA 2G4SA 2KQ7A 3VUWA 4EEWA 1AZEA 2ZEQA 1E7VA 5I11A 4RTWA 1P98A 2AYOB 4RM9A 2HCKA 3ZTCA 3OLMD 3WAMA 3N30A 4IUMB 4MH0E 3DVGY 4HASA 2PNIA 5DPTA 5LLIA 2KYBA 2LJ5A 2KVRA 1YD8U 1NYGA 3VFKA 1HD3A 1GCQC 2MP2B 1JXMA 2BKFA 3CQTA 4HCPB 1K9AA 2IY0B 1ZUUA 3OJ3A 1KIKA 5JH5C 3HPCX 4TKNA 3CSTA 2KGTA 3DDCB 2YUOA 2JXXA 3DOWA 2FG0A 3NPFA 3DBHI 4NJ6A 2AWTA 4DHZE 2ECZA 4JLCA 3VS6A 4DHZB 4LJPB 2FCNA 3QC8B 3I3TB 3PRMB 2WX0A 2MBQA 1H92A 1C3TA 4GDLB 1OTRB 1WDXA 4JJCA 4MSMB 2DMOA 4AJWA 4LUDA 2RQUA 2ZPYA 2HSPA 4FJVB 4K1RB 2EYXA 5E6NA 2I0NA 3R3MA 2O6VB 2W0ZA 2ZNVC 4GN1A 4AKVA 1ZGUB 2N9PC 1KLVA 4URKA 3VH4B 2OJ2A 1P0RA 1GBRA 2V6VA 2ASQA 4J9GA 4FN2A 1WIAA 2MRPA 1WA7A 1Z9ZA 4KDIC 2KDBA 4ANUA 1Z2MA 1J8CA 2SRCA 2DAFA 3QX1A 3WIMA 2ED0A 3TIXA 2KXDA 3RT3B 2FPFA 1GRIA 1AZGB 2ZVNA 4EKUA 2RQTA 4LCDE 3K9PB 1HJDA 2L0AA 2L76A 2REDA 3TMPB 4AP4C 3H0FA 1YIWA 1WH3A 2PPHA 2IO0B 2IZVB 4DEXA 2BPSA 3A4RA 3HK0A 3V61A 4G3XB 2DZJA 4II2B 3R7QA 2KK8A 5L23A 1K8RB 1VYUA 1AOJA 2JRHA 3UA6A 1UFFA 2F2WA 4FBJB 1WJUA 2ZZPB 5JHBA 2REXA 1TBEA 3KUZA 2C0OA 1WYXA 2LWPA 5KHOA 3L17A 1K76A 3JV3A 1X6BA 1H6HA 4A3OA 4IM3A 2L73A 4RTYA 3TJPA 2YSQA 2MOXA 2LQNA 4FA6A 4OMQA 4J9BA 2JXBA 2F2XA 2XMFA 3VUXA 1GCPA 3UA7A 1WXAA 2DRMA 2DL3A 2D2QA 2ZNVB 4FULA 1SE9A 2EMSA 4J9CA 3VUYA 4A3PA 1E7OA 1U4AA 3THKA 4W9DA 1WGRA 4RTTA 2LQWA 4IKDA 3AU4A 2JMAA 2L3ZA 3B0AA 2CT3A 1U5SA 1VYVA 2AZSA 3A9KA 4HDQA 4ICUA 4IM0A 2RR9A 4ORZA 2MX2A 1Z9QA 2GBNA 1QCFA 4MJSB 3ZNGC 1U06A 3RZWC 5CHWA 4KVGB 3PGEA 1LCKA 4HXJA 4NQKE 3DQVA 2KT8A 4ANVA 1G6JA 1GL5A 4JQWC 2JW4A 1HSQA 1WX6A 1O7KA 1TG0A 4BKSA 3KUDB 2Z0DB 4NAWA 2MQJA 1RRBA 3JW0X 1S1NA 3DPDA 4GB9A 1GFCA 4E6RA 4IWQA 2Z0EB 1UBQA 1OQYA 3A9JA 4ZRKA 4J6IA 2MW5A 4MSQB 3PVLA 1H3HA 1E8XA 2HBWA 2RAJA 4OMMA 1OCUA 2HD5B 1GC6A 3UF8A 4ESRA 2LX7A 4KSKC 3V62A 2EGCA 4J9FA 2BZ8A 2L3QA 1EF1A 4KSLC 4CC4B 2YUPA 3IBEA 1J0GA 1P1AA 4E71A 2KX0A 2K8BA 2LJ3A 4F16A 3JSVB 5D94A 2BKRB 2JRIB 3ULRB 1M27C 3PHWB 2O88A 1WX7A 4CO7A 4PYZA 1PRLC 4AJYB 2LGYA 1E7UA 3GBQA 4ON3A 4WAAA 1AWXA 1ZSGA 1Z5SB 2YDLA 4W9IA 4J9IA 4M4ZA 2O2OA 3NHNA 4MGKE 2RAKA 1OPLA 2AZVA 2MIOA 1WGHA 4TV3A 5GJWB 2KC2A 5E6PA 3UGBB 4B95A 4OVUA 4J9HA 2ZJDA 1WXVA 2KRSA 3EG1A 4BFRA 1WR6E 1IYFA 2LZ6B 3H7SA 1KJWA 4F1SA 3TVTA 4XC2A 3OJ4B 2RGFA 4FSSA 1T3LA 2XBBC 3P0CA 3CF6E 2UYZB 1BB9A 2RF0A 4WJOA 3V6EB 2FCQA 3NZUA 3RZFA 5D6JB 4M8NA 4FHJA 1J3TA 3UIPB 2EQIA 3A1QB 2KX3A 4B6WA 2FRWA 2BYFA 3MHSD 1RUWA 2KD0A 1I35A 3TSZA 1RI9A 2BF8B 2EGEA 2BGFA 2G6FX 3NOBA 2NBWB 4IKBB 3PREA 1OOTA 3VTVA 1OEBA 5D2MB 3EHRA 2X3WD 4MELA 4HLEA 2K2MA 2A37A 2DF6A 2J0MA 1WFWA 2KNBA 2JTEA 2F2VA 3NMZC 2K6DA 5IH2A 2ROTA 4HCKA 2JM8A 1QWFA 4JZ4A 2VRRB 4J9DA 1WXTA 3VTWA 2KJHB 3X0WA 4JIOU 4BKTA 3JVZX 1VD2A 1U3OA 1GC7A 4W9LA 5GJVB 2CDTA 1V2YA 1JO8A 5C23A 3VS7A 3UIOB 2GGRA 1T3SA 2A5UA 4ZNXA 1X1MA 3A4SC 3KH0A 4BBNC 4N9F4 4EIKA 1ZUKA 2EKEC 2KWVB 2MBEA 2C9WB 3O65B 2MA9B 2N7DA 2KDIA 2LGXA 3QAQA 2L00B 2RMOA 1A5RA 2FIDA 4NQLB 4CYEA 2YT6A 3Q3FA 2GBKA 5FR6A 5E6OA 2NWMA 1YX6B 3PTFC 4BOSC 3VRYA 1CKBA 3NZSA 2OJRA 2GQIA 2KTRA 1SHGA 2FCMA 2KFKB 1SHFA 1UHCA 1KJTA 3RYTA 1WY8A 4LJOB 4ZRIA 4WCIA 2KANA 2RPNA 1X27A 3RULA 1E5WA 5G2NA 1OEYA 2IY1B 1WI0A 4F14A 2LMJA 2HDAA 2PE6B 3IVFA 2CT4A 4W9CA 3L0WB 2D10A 4MEMA 1WGYA 2D0NA 2EMTA 3ZDTA 3VVWB 4QT7A 5L83A 4W9GA 3H7PB 3HHMA 4GGQA 2O2VA 2L3SA 2PE9A 2K7AA 2DLPA 2MLBA 4BKGA 1UJYA 5DCNA 4HVUA 4I6LB 1PKSA 4IM2A 1TZ1A 2SEMA 1V80A 4AUQC 2KLCA 2A08A 1MV0B 4M8MA 3SU8X 4JJBA 1WMHA 2JY6A 1XOVA 3UINB 4IW0A 1X2KA 2KEAA 2DX5B 2N1VA 2M1MA 3RUIB 2Y5BB 1UH6A 3REAB 1RLPC 2DZKA 4WQOB 1UDLA 1UTIA 2BTTA 2C7MB 1VYTA 3REBB 1CKAA 1QKXA 4LUEA 1EFNA 2NR2A 1SPKA 2DE0X 1UUEA 2CH4W 2AKLA 5BO4B 3N3KB 1M8MA 2KYMA 1ARKA 2NPTA 3PRPB 2ZCCA 4ANWA 2N9EB 5JZEB 2J6OA 1YWOA 3EFUA 4BBNF 2ZCBA 1WJNA 5IHKA 2EW3A 2GTOA 4LN2A 1PHTA 2ZVOA 2YUNA 1K1ZA 3UATA 2GTJA 2KDEB 3ZVVA 2D11A 4IIOA 2EKHA 2MSED 1A0NB 5FWCA 3M0UA 4W9EA 2IWLX 2AKKA 3I5SA 2J6FA 3PSEB 2MCNA 3LDZE 5CX3A 2CSQA 1GJZA 4NPNA 1GBQA 2K9GA 2J0JA 4AG2C 2DZMA 2IO1B 2NS5A 2RQRA 4IIMA 3IQ2A 4KIKA 3M0QA 2RSUA 1I07A 3W1SA 1RLQC 3RD2A 5TR5A 1UG1A 3M0RA 2RAIA 3A33B 3QJZA 1FMKA 2KXJA 2EYYA 1WXSA 3IHPC 3T8MA 4KZ0A 2A36A 4CC3A 2Z59B 4DHJD 1UECA 1WGDA 2WWZA 2L8JA 4LNPA 1C1YB 3FJ5A 1N5ZA 4GDKB 1G83A 2DL8A 2C7NB 4AOFA 2DBMA 1E8WA 1YNZA 2FUHB 3C0CA 1FXTB 4ZRJA 4PQOA 1V1CA 4FLHA 4OMLA 1UGVA 4TQ1A 2KJ6A 2WYQA 4G0NB 2VVKA 2L2PA 3U30A 2LXAA 1MUZA 5DPSA 1V49A 4W9FA 2JT4B 4HJKA 2I1JA 4ICVA 4DDGD 1GUAB 1X2QA 2MP2A 4G11A 2M0XA 1V81A 3LJ3A 2KNBB 3MTNB 1LQBA 2REAA 2WX1A 2K6DB 3M0SA 3ZO5B 3LH5A 3PRZA 1GG3A 5AZHA 1ZW7A 5FW9A 2OI3A 2CH4A 1I1JA 1RFAA 2LRUA 2E5KA 2PJHA 3AULA 4WJNA 1OEYJ 3V6CB 3U8ZA 3H0IA 4ASWC 5IXFA 4JJDA 4HK2A 1Y57A 2VWFA 4FJYA 1SEMA 1YJ1A 2RD0A 4GDLA 2LASA 5HKHA 2LGDA 2DX1A 2K25A 1NM7A 4HVWA 2O6VA 4RM8A 4DHJB 1EO6A 2V1RA 2L05A 4B9KA 1L2NA 3AI5A 4CC7A 4WWOA 3MJWA 5J2RA 1KM7A 2KLGA 4PS7A 1PQSA 3R66C 3T9LA 1WYWB 5DPWA 2P4RA 2MBBB 1H4RA 4BVUC 1Q0WB 2CHWA 1NDDA 2ABLA 3IQLA 3ZIMA 3L10B 2N4FA 4W9JA 1UHFA 3QHTA 2KZRA 3EC8A 3PV1A 4E74A 1ZX6A 2B3AA 1X43A 3EG3A 2CUDA 4RTXA 2V14A 2W9NA 2ZPNA 5LXHA 1AD5A 3C0RB 1BBZA 2FRYA 3TSWA 1K0XA 3V60A 2DA9A 2RQWA 4NNJB 1PKTA 1S1QB 4MGZE 4K7UA 5L95C 4DBGA 2LI5A 5CHFA 1E6GA 3HM3A 2KTFA 2YUQA 4KDLB 2JPHA 4HWIB 1NG2A 3L13A 1EUVB 2J6KA 1D3ZA 3ZTDA 4A20A 4K7WA 5AEKB 2IO3B 2DVJA 3I5RA 1M3AA 2LRWA 3VS0A 1MG8A 3ZKJC 1I42A 3M0TA 1OCSA 4FJZA 4KZCA 3N32A 1GFDA 1P3QU 2I1KA 5FWBA 1J19A 4OXWA 4F17A 2DZIA 3AXCA 3RBBB 4WJQA 4M0WB 4GSWA 1XQQA 4WJPA 2JZZA 4IWOA 2JM9A 2WDTB 4A63B 5C1ZA 1UELA 2M51A 4GLMA 1QZEA 1KSWA 2NCNA 3H6NA 2DL4A 3DCGA 2AL3A 1OV3A 2RQVA 1W1FA 3BINA 2G45B 2FPEA 4KRTA 3QA8A 3APDA 2G3QB 4AFUC 2JVCA 2K6QA 2N7EA 2J0KA 3ZNZB 4JGHB 3ECIA 3M95A 1UGMA 2FPDA 2WWEA 1SGHA 2RNAA 3OAWA 4BGJA 2K8HA 3RCZA 2HEQA 1YWPA 2MBOA 2KROA 3KYDD 2JZ3B 3DBLI 3H1UA 3AU5A 2O9SA 2XK5A 3SEMA 1ABQA 1OPKA 1WJ6A 3PS6A 3UQBA 4CHKA 3QK0A 3PLVA 2K8CA 4ZDVA 1JXOA 2KJRA 3IFWB 4BKSD 2M17A 3UF4A 4K7SA 2RPQA 3JYUA 2QHOA 2IBIB 2I4KA 1M3CA 1WLPB 1R4MI 2C0TA 3PHXB 1NEGA 3VAWA 2KKCA 4TUUA 3BY4B 3KFVA 3ZL7C 4YL8A 2LJ0A 2FEIA 1F9JA 2LVOA 1GNUA 2A28A 2ROLA 3QARA 3VS3A 5IHNA 1KQ6A 4PQPA 4EUTA 4AZ9A 2CKHB 2LP5A 3ALBA 1WZ0A 3DVNV 2D07B 4GBQA 4JL9A 3M0PA 3APFA 2GOWA 1AVZC 3PT2B 4I6NB 1CSKA 2GNCA 1WGGA 3DVNU 1WI7A 2UWQA 1WE7A 4P2IA 2DNUA 1NEBA 4Z89A 2KE9A 3NS8A 2CSIA 4AFQC 1PWTA 1YCSB 3VRZA 2GBMA 5IAAC 3B08A 2PEAA 1NLPC 2IO2B 3H41A 3A9KB 5EDSA 1R4NI 3LUIA 4EFOA 3D32A 2LZ6A 4I6PA 3VS5A 1AEYA 1YX5B 4AWJA 4K11A 1KMDA 4NY0A 3ENEA 4F7ZA 2CHZA 2EYZA 2IYDB 4II3B 3KW5B 1XD3B 2CHXA 4PS8A 2K79A 5DPRA 1Q1OA 3VS4A 2ENMA 3KYCD 1E90A 1WF9A 4OMPA 1G2BA 3UQAA 2ESWA 5IXBA 4NAWB 2W10A 3ZRCA 2LXCA 3VXWA 2DENB 3EHVA 2LVPA 1GD5A 4RUGA 3A9JB 2DAJA 3A1QA 1M30A 3PPAA 3SD5A 1ZBJA 1Y8RC 2N1WA 1UE9A 4R0KA 4Y92A 3QWYA 2YPSA 1PNJA 4XZ4A 2FCSA 1EF5A 4P2JA 1NLOC 1WFYA 1JU5C 1E8YA 2DJQA 3WAOA 4IKBA 2DM1A 4RMAA 4K81A 1Q5WB 1SIFA 3QQ8B 3HM6X 3VDZA 1AWJA 1I0CA 2DYOA 1WX8A 2KHWB 3ZNHB 1IPGA 1TUDA 3ZNID 2JF5A 1NI2A 5J17A 3VS1A 4TQ0A 4FHKA 2KWCA 4RTVA 2JWZA 1TGZB 4GMVA 2D1XA 5AZFA 2QDLA 2CSKA 2DL5A 4E3CA 2L0FA 2X3XD 3L16A 1SRMA 4OMNA 2KQSA 1TTNA 2R2OA 4JPBW 2CR5A 2NUZA 5EC7A 1YN8A 3WALA 1H8KA 3HIZA 1W6XA 3M63B 3QWZB 2C0IA 2C5LC 1QWEA 2JUOA 3EG0A 2O9VA 3ZRFA 2ED1A 4EZJA 1XT9B 1BT0A 3U23A 4CC2A 3O5ZA 1P9DU 1TUCA 1CMXB 1IO6A 1JEGA 1SRLA 3TCAA 3QCAA 2KDFB 2R2QA 2B86A 4HVBA 3QIJA 5ECAA 4RTUA 2NVUI 2CREA 4PYUA 2KFKA 3Q3JA 5AZGA 4GIVA 3WANA 2KMCA 2OOBB 1H8CA 1WM3A 2HTHA 3GOEA 1K4US 3P2BA 4D8DA 3NY5A 4XX5A 1WX9A 2LNHB 5IHIA 3KUCB 2KRMA 2JMCA 1YQBA 4IWPA 3EECA 1KFZA 2J05A 1QKWA 4GXBA 1ABOA 1BK2A 2FNJB 2HE7A 3VTUA 2EYWA 1JRUA 1KOTA 1IP9A 2XEWA 2AL6A 3NHEB 4OMOA 3S2AA 2BZXA 2GBQA 4JZ3A 1WXUA 4AFZC 2AR5A 3PZDA 2D8HA 3GZNI 4DWFA 2KC1A 1WM2A 2NBVB 3H7PA 3EHQA 4Z8AA 2NBUA 4MM3A 4WWPA 2GBJA 4IC7B 1LXDA 1NBFC 2G4DB 2FAZA 2L3PA 1E6HA 1T0YA 2KWUB 2C60A 1SSHA 2EGAA 2KMAA 4HVVA 2BYVE 1UBIA 2XK5B 2LVQA 4BOZB 1S3SG 3VH3B
chains in the Genus database with same CATH superfamily
5HCKA 3PE0A 4M7AE 4HDOA 4DDID 4F7UF 4M7AB 3GP8A 4E7LA 1I4HA 4NJCA 4N4GA 3QSUA 5IN1A 1SG5A 3HSBA 3EGRA 2IGHA 2KOXA 1GPXA 2FIFA 3DHHC 4G50A 3QPHA 3X23A 1UZXB 3V8LA 2PTKA 1VDVA 3DVGX 4E7HA 4ZYNA 3QJ6A 2QK0A 1XXGA 1NBEB 2K3BA 3META 3IG3A 1FXIA 5BYQA 3EG9A 2K0PA 4FADA 2KXCA 4X1VA 3OW2S 3JB9D 1P92A 5CVIA 4KT0E 2IGGA 3BZDB 3DWMA 1E8ZA 3Q3MC 3LW5E 4GOCA 3P8HA 1QOAA 4Z88A 3ML9A 1UGPB 1V5OA 3QWXX 3CSFA 2H3JA 5GMKm 3GNFB 2RK1A 5G5HA 3QJYA 2QDYB 3WXMB 2LCSA 4ZTJA 3Q3OC 3G71A 4KGZB 4JLGA 1N9SA 2D8JA 1BYMA 2DZCA 4HCBA 4DBRA 3DLLA 1AWWA 4US8A 1WIEA 2UU7A 3C94A 4X57B 2P0PA 5LJ5d 4FU6A 2KTRB 5LJ3j 1M94A 3EG2A 3KLSX 3KWLA 4L2YA 1VR9A 3IAS1 4W9HA 2PZ1A 3E9FA 2J7IA 1LM8B 2EQJA 4LDUA 5I22A 4M7AF 1L7YA 2ZW1A 1KC8R 3HPBA 3P8BB 2A0FB 3DWGC 5CHVC 5IA7A 2BTEA 1VQNT 2RO0A 3UDCA 3OBYA 1QVFA 3H9DA 1GCQA 3CMMB 3VR8B 1VA7A 1UJ0A 1UGRB 1QLYA 4F8CB 3A8GB 2INPE 1WGKA 4UDUC 4EOYA 2OJWA 3K9OB 5LL6S 1YBYA 1TJEA 4HCNB 1ZUD2 3M62B 5J3BA 2P0KA 2K1FA 1QILA 4OVVA 2V8KA 3OMCA 4D6WA 2M8SA 2PTLA 5GAOm 1HE8A 2PVGB 2JZ2A 2BYEA 3VQIA 5FROA 4JS5A 4JRIA 1UD7A 4Z02A 2V1YA 1ZPSA 3VS2A 5JHAA 2BBCA 2MJEA 3SEBA 4XTUA 2ZPGB 2DBKA 1SJHD 3GZNB 1T0HA 1K8AU 2MWSB 1RAXA 2AEHA 4MT5A 3H8ZA 1B07A 2BZYA 1BU1A 4LDTD 4P6VF 1OGWA 4B0EA 1RLFA 4AFSC 1TSFA 5GAN2 1J7CA 2L3RA 3ZGZA 2JS2A 1MVKA 2LD9A 1Y0MA 4IG7B 3O8VA 4RH6A 4AG1C 3MEWA 3QHSA 2KR3A 3BE3A 3TEZA 1JQQA 1YP5A 1VQ5T 2K39A 2E5QA 2O2VB 2B76B 2HKQB 4PZGA 1I4PA 1MV3A 1VQMA 5LXIB 2YLBA 3RNJA 2PU9B 5BMIA 3SHWA 2CS4A 1XTEA 1RADB 2GI9A 2EPDA 5DY9A 2HL5C 2CUBA 2QDFA 4FM4B 2FO0A 3QKJA 3R6NA 3VHTC 4P1BC 1X69A 4RFBA 1Y56A 1FMAD 1VCBA 1STEA 2L7RA 3BY7A 3EUB2 2EQMA 1YJWQ 2KAFA 3W1SC 3FOGA 2JS0A 4FW2A 1BIAA 1OQQA 1WMHB 5LJ5j 4GDKA 4ANXA 2HJ8A 2XD0A 1N8RC 4MACA 4KV2A 3GB1A 1M2VA 2KDSA 3ZDMC 2OTLT 4J9EA 4LE9A 2LUEA 5DLOA 3DBRI 2BE9B 3M3JA 1ZKHA 1UGSB 2CZOA 1C76A 3MFGA 3U52E 2KFJA 4YTPB 1Q81C 1LFDA 2DYMA 1YIJQ 5IP4D 1V86A 1JRIA 3RKWA 2M56B 1WZ3A 2JQRB 4BY6B 3I56A 3E2UA 3OSVA 2DILA 3I9V1 2CP7A 5GAOr 2DYBA 4MGYE 2VC8A 2LDMA 2XK0A 3JCMP 4XU1A 1WRDB 3ONSA 4PS3A 3CPWA 2LCLA 2DHZA 1R8OB 4HPMB 1SF0A 3GE3C 4NJ7A 3AE6B 5KHQA 3Q6BA 1W70A 3CD6T 2Z8LA 3R7RA 2GBRA 2KK4A 3CMAT 4HPLB 2J7QB 2BWFA 1AWOA 5CTRC 4FYXB 2NPTB 4WH4A 5J18A 3ZLZA 1K0SA 1ZUYA 1LGRA 4MJSA 4ZRQA 3DB4A 5FK9C 3SDLC 2KT1A 4LD6A 3PMTA 4C92G 2GMIC 1M9SA 1KD1R 2JT4A 3HFNA 4XAXB 1R0BG 2CU1A 3QO3A 4IUPA 5EE9A 2LEKA 2EVRA 4WWNA 3CCEQ 4C0DC 2QXFA 4DBHA 2BIVA 3PVQA 3DBSA 2RN8A 4EZLA 3J81E 3ML8A 3N1XC 2GLSA 1IRXA 1ISNA 4LK0M 1D5XC 2RHYA 3WAPA 1Q95G 4MZPA 4M78G 2VKNA 4ZYSA 3BK1A 2BWES 2JVVA 2Y5CA 3AM9A 2O4XB 2IIMA 2E70A 2MH7A 4JDSA 4BACA 3MEVA 2RI2A 2KN5A 2V1QA 2V3SA 1BUIC 3TBLD 2OHFA 1FYNA 4EZKA 2BYTA 3WCQA 3TL5A 2A4ZA 1BXTA 1AWDA 2OAWA 4P7IA 1WXMA 1XF5L 1L5PA 2C7HA 2WS3B 3CC7Q 3B1LX 3JB9F 3VUZA 1F2RI 1IHWA 2KO3A 1WE6A 3ZXRA 3EA6A 3EGDB 2L0TA 4HXDA 2QG9B 4DEYA 1VQLA 2Y4XA 4V2SA 5GMVA 2O31A 5T8IA 3EFOA 4RNAA 1JRPA 3P8DA 3SHQA 2Y3AA 4ANJA 3AEAB 3A1PA 1M3BA 4ZGEB 4W9KA 2QA4A 2DETA 2YVCA 1IGCA 4IKFA 2MCNB 3WA0A 4LDTB 1F2RC 3W1YA 3RR6A 1LO5D 3L54A 5GAMg 3MP9A 1GXIE 1V6EA 2M0YA 4RCOA 4ZHOA 1XTNA 2V3PA 2O01E 3HRSA 2DAQA 4FYWB 1T0JA 2H8HA 3Q8FA 1C9FA 2COZA 1D09B 1M4ZA 4DK5A 3APCA 4RTZA 3CCQA 2KBTA 2J06A 2L89A 1V9JA 4KIKB 2M4NA 1MHNA 3M4GA 3NGPA 3DB3A 2OEDA 1PRMC 5LNK1 3T3OA 1VQ7Q 4GU2A 2I2LA 4HT9A 5G55A 3OBWA 1AARA 3L08A 3OG5A 4TSSA 5D7GA 4DXAB 4ME7A 1V5TA 3VYGA 5C3JB 4MDKE 3CCSA 3BFMA 2AK5A 2XDPA 2CKKA 1RAGB 1WXBA 5H8YE 4B9XA 3ZJTA 4CQNA 3QDFA 1YJWT 1U1TA 1I5OB 2JJ9A 2ETTA 1ZLMA 1Q7YR 3E9GA 4MGIE 3AB5A 3PLUA 3EGXB 5FKAC 1FRRA 2O6VD 1WHGA 4D8KA 1NYFA 4E7KA 1ZXHA 1WR1A 2KRNA 2ONQA 3JSVA 1Q81R 1ROEA 2ZAEA 3CMET 2DL7A 3MJ5A 3BVGA 3T9NA 2N9KA 1KF6B 2D3GA 2ON8A 4K3BA 3DYTA 1K73R 3DBRB 2FL7A 3V8KA 2P0QA 1MG4A 2MBHA 3OS2A 2V4LA 3Q3NC 1X6GA 3KVFB 3U7DA 1YIJT 2N9XA 2LJ1A 2RJFA 3AN1A 3ZUNA 3I35A 2BT6A 2HAXA 3LWIA 4BI4A 2EBPA 1ZE3D 2P4TA 1R0CB 2XI9A 3I9QA 3ZW3A 1LOJA 2KMMA 5CQYA 3EGUA 2DRKA 3A98A 1WJ4A 4H2AA 3UPUA 1KLGD 1EZZB 1QP3A 2RK2A 4KH1B 2QQ9A 4XDDA 1Q86U 3JCMV 3H0HA 1K9MC 1L6UA 4YTLA 2YLMA 1B3QA 2G4SA 2KQ7A 3VUWA 4C00A 1VIFA 4EEWA 1AZEA 3J7AF 2ZEQA 1E7VA 4C0DB 5I11A 1BCOA 4RTWA 1P98A 2AYOB 4RM9A 2DJZA 3G1JA 5CAIA 2HCKA 3ZTCA 3OLMD 3WAMA 4OB2B 1VQOQ 3N30A 2A3LA 4QQDA 2WXFA 4IUMB 2PVDB 1DOYA 3JAME 4MH0E 3OY9A 2B8AA 3SD4A 3DVGY 2EJ9A 3TSSA 5A0DA 2WP9B 1OZ3A 5D3DA 3BDLA 4PFOA 3LB8C 4HASA 2K5IA 2LGSA 1R7SA 1YI2A 2PNIA 1D0YA 5DPTA 5LLIA 2KYBA 2DERA 1IBXA 3P4PB 4ELZC 1X01A 4M77D 2LJ5A 3H9NA 3LH0A 3OW2A 1MJDA 2WXOA 2K57A 1I4GA 2KVRA 1YD8U 5GAOp 1NYGA 2G9HD 1FNUA 3C8YA 3VFKA 1HTQA 3IAM1 1HD3A 1GCQC 2MP2B 1JXMA 4EDUA 1E6EB 3KXTA 4M7DD 3CCVQ 2BKFA 2JX5A 3CQTA 3MJXA 4HCPB 2INNE 2CZ7B 3BIID 4M77C 3CCRT 1VQ8T 1K9AA 2RI3A 3M59A 3CC7T 2IY0B 3TU4K 1ZUUA 2G1EA 3URYA 3OJ3A 3N9YC 4XQ3A 3NVVA 2YXYA 2X51A 1KIKA 4N58A 5JH5C 3HPCX 4M7DC 4TKNA 3CSTA 2KACA 1SKUB 2KGTA 3DDCB 2YUOA 3CC2T 1QVFS 3PTAA 1CK1A 2JXXA 3DOWA 2FG0A 2F5KA 1RAHB 3NPFA 1JBMA 3DBHI 2DD5A 4LD9K 2WXIA 4NJ6A 3MPUB 4HRSA 5J26A 5A2QE 2DFUA 2XG8D 1UB4A 3L2WA 2AWTA 1NJIC 4DHZE 2ECZA 4JLCA 4M0WA 3VS6A 4DQ2A 3PIPA 2FCNA 4LJPB 3RPFC 3QC8B 4DHZB 4LDWA 3QDRB 1JWAD 3I3TB 3PRMB 2WX0A 2LT4A 2MBQA 4YSYB 1H92A 1PYWD 1VQ7T 1C3TA 5GANd 3AECB 4GDLB 1OTRB 1I5LA 1WDXA 4ZN1A 4JJCA 4C5EA 4MSMB 2DMOA 4AJWA 4XU2A 3OYKA 3MO8A 3OWEB 4LUDA 4KGSA 4C92A 5GMKe 2RQUA 2ZPYA 3EH1A 4RG8A 2BS3B 3SDZA 2HSPA 4FJVB 2JYEA 4LLGM 4K1RB 3CEYA 2EYXA 5E6NA 2I0NA 1J7BA 2KDMA 8AT1B 3N20C 4RCBA 2O6VB 4ZGJB 3R3MA 2W0ZA 2ZNVC 4GN1A 4AKVA 2ZCFB 1ZGUB 2FZGB 4HJGE 4FT2A 2N9PC 1KLVA 5G5GA 4URKA 4M78A 3G4SA 1ZP0B 2OJ2A 3VH4B 1P0RA 1GBRA 1V1PB 3I55A 5FR3A 2V6VA 2ATCB 3AEDB 2ASQA 1XLPA 4J9GA 4FN2A 2JXTA 1L6VA 1AW7A 3V7RA 1UEBA 1WIAA 1VQ6T 3QYGB 2MRPA 4GLSC 1WA7A 3M53A 1Z9ZA 4KDIC 2KDBA 1BI0A 5GAOn 4ANUA 4XTXA 1Z2MA 4ZHPA 2V3NA 1N27A 1J8CA 2SRCA 2DAFA 3QX1A 2EYQA 3JB9H 2ED0A 3WIMA 3TIXA 2KXDA 4IUQA 1VQOT 3RT3B 2FPFA 4KGXB 1GRIA 3FKYA 1WHHA 5C0MA 1AZGB 3ZBDA 2ZVNA 1K8AR 3AEFB 3FEOA 4OZBA 1T6BX 4RKUE 4J6XA 2DD4A 3TUOA 3OYNA 1FD6A 4EKUA 3MC0B 4DOWA 1R4NB 2RQTA 4LCDE 3OYMA 3CPWS 1ESFA 3K9PB 5BYRA 1HJDA 3PFSA 1N9RA 2L0AA 2L76A 4M77E 1QLBB 2REDA 1M2OA 4PJOA 4N6EB 3TMPB 2E41A 4M77B 1L0XB 4E7SA 1UNSA 3H0FA 1YIWA 4AP4C 1C77A 1WH3A 2PPHA 2IO0B 2IZVB 4DEXA 1C4AA 4HA8A 2BPSA 1JWUD 3M58A 3A4RA 3HK0A 3V61A 2AIRB 4M7DE 4G3XB 2DZJA 4II2B 4M7DB 4OP0A 3R7QA 5GANj 2KK8A 5L23A 1K8RB 2WXPA 1OX9A 1L0VB 1J7AA 1VYUA 3OS5A 1AOJA 2JRHA 3UA6A 1UFFA 2F2WA 2E65A 3OYHA 4FBJB 3ABVB 1WJUA 2ZZPB 2DEUA 2REXA 2P84A 5JHBA 3G71T 1WHJA 3X28B 3CCEA 1TBEA 3KUZA 2C0OA 2XNAC 1WYXA 2LWPA 1TKGA 4YWGG 4L59A 5KHOA 4Y91A 3L17A 3J9CA 1K76A 1IREB 2VUBA 1X6BA 3JV3A 2BQQA 2PLPA 3W9CB 3D7SB 3DBHB 1H6HA 4A3OA 4IM3A 2L73A 3Q8AA 4RTYA 3TJPA 1TOVA 4M02A 2YSQA 3CCLA 2MOXA 2LQNA 3IT6B 3R8BA 2JSVX 1K51A 3W5VB 4FA6A 4OMQA 5I2MA 5CIUA 1NI3A 4J9BA 2L1AA 2IG0A 3V7CA 2JXBA 1Q7YU 2QILA 2F2XA 1SIJA 1BMLC 2XMFA 4XU3A 1VQKA 3Q8CA 3VUXA 1GCPA 2Y4YA 4E7IA 3UA7A 1Q81U 1VQPA 2WXGA 4M77F 1D0ZA 5HK0A 1WXAA 4LTUA 2DRMA 2ZPEB 2WU2B 2DL3A 2D2QA 2ZNVB 4RGTA 3ZQ4A 4A6QA 1K73U 4FULA 5HHDG 1SE9A 2MAMA 2EMSA 4J9CA 4XTWA 3VUYA 1E7OA 4A3PA 3A8OB 4M7DF 1U4AA 1XLNA 4NAMA 1BKBA 2HDEA 3SFEB 1SSFA 3THKA 5IT9E 3CCJA 1WGRA 4W9DA 5GAN4 2IGDA 4RTTA 2LQWA 4IKDA 3AU4A 2JMAA 2L3ZA 3B0AA 1NE8A 5GMKh 2CT3A 3P4QB 5CR2A 1QT9A 1U5SA 1VYVA 1D4BA 1QVFP 2AZSA 1ZA2B 2DXCA 4XTYA 1NEKB 3E19A 1JW9D 3A9KA 4HDQA 4ICUA 2RR9A 3QXEB 4IM0A 1M1KC 2MWPA 1F52A 2K3YA 1SJED 1TY2A 4OZAA 2WXLA 2KVZA 4ORZA 4F7UG 2DNFA 2MX2A 1Z9QA 2GBNA 1QCFA 4MJSB 2RI5A 3ZNGC 1U06A 2RHIA 5BMGA 3MC9A 1EX4A 1PSEA 3RZWC 5CHWA 4KVGB 1JROA 1XLQA 1S72T 2KN4A 3PGEA 1LCKA 1MHXA 2XIDA 2D9TA 2A7YA 3FILA 4HXJA 2L8DA 4NQKE 1KHIA 3DQVA 2QC8A 4PK4A 2QIEB 1XCQL 2COWA 3CC4A 2KT8A 4KBMB 5HG2A 4ANVA 1G6JA 1GL5A 5FU7C 2X4WA 2R57A 1PGBA 4JQWC 1FX7A 1HTOA 2JTMA 4E7ZA 4IDIA 2JW4A 1HSQA 2EFIA 4C8QD 1PD0A 1WX6A 3OYIA 1O7KA 1TG0A 2RJCA 4BKSA 3KUDB 1PM3A 2R5MA 2Z0DB 1B7TA 4NAWA 3JCMQ 2MQJA 1RRBA 3JW0X 3RNBC 1QKZA 1S1NA 4YSZB 3DPDA 1YJJA 4GB9A 1IZ6A 1GFCA 2LFIA 3MC8A 3U7ZA 2LGIA 1QVPA 2HSEB 4C8QC 4E6RA 3I56T 3RNFC 4IWQA 1RM6C 1Y96B 1CJEA 5FLXE 2Z0EB 1UBQA 1OQYA 2INCC 1PGAA 3PGGA 1BI1A 2OTLQ 3A9JA 3WVEB 4ZRKA 4J6IA 2QQRA 2MW5A 2E12A 4M7AG 4X9DA 3CCMA 1AN8A 4MSQB 3BYTB 1FRDA 3PVLA 1E0ZA 1PSFA 1I4RA 3AV8A 1H3HA 4WURA 1E8XA 2HBWA 2RAJA 5LJ3g 4M75D 4OMMA 1HA5A 1OCUA 2HD5B 1YITT 2V26A 5FRNA 1GC6A 3UF8A 3OYLA 1BCMA 3INZA 4ESRA 2LX7A 4QVCA 3CD6Q 2SEBD 3N1YC 3NRZA 4KSKC 1WRIA 2MYSA 3CMAQ 3V62A 2EGCA 3BDUA 3C95A 1SB3C 2E3TA 5CKDA 3JCMd 2DXUA 4J9FA 1TUGB 3CPWP 4C7ZA 2BZ8A 2L3QA 2RHZA 5I2SA 4A4FA 4WWMA 1EF1A 4M75C 1Q86R 2YRDA 4KSLC 3RKYA 4CC4B 2YUPA 3IBEA 1K50A 3FAHA 1J0GA 1P1AA 1D3BA 4E71A 1RAIB 2KX0A 2K8BA 2LJ3A 3HVZA 3NVYA 2V4IB 4F16A 3JSVB 5GAMe 5D94A 2DEQA 1F0ZA 2BKRB 4DBQA 2JRIB 3A8HB 1YHQA 1K52A 1HQRD 1D0XA 2AHJB 1YJ9A 3ULRB 2QEXA 2BS4B 1VIEA 1M27C 1K9MU 3PHWB 2O88A 1WX7A 4CO7A 4PYZA 1PRLC 4TVRA 3HP9A 4AJYB 5CCAA 3OYFA 1E10A 4QQGA 1E7UA 1M1KR 2LGYA 3E9SA 1BIBA 1HXYD 3GBQA 4ON3A 5TSSA 4WAAA 2VASA 1MMDA 1AWXA 1MMNA 1ZSGA 1Z5SB 4C80A 2YDLA 4W9IA 4J9IA 1M4VA 2QJLA 2ZPBB 5IOIA 5C2TB 4KUDK 4M4ZA 2O2OA 3NHNA 4MGKE 3ZJUA 2RAKA 1OPLA 2L5QA 4WTOB 2DKGA 5GAN5 2AZVA 1C6VX 1KH0A 4NOYA 2MIOA 3SWNB 1TWBA 4FYVB 1CZPA 2X4XA 1WGHA 4TV3A 5GJWB 2KC2A 2ACZB 5E6PA 2WXRA 3UGBB 4B95A 2MF2A 4RF1A 1SBBB 2BKDN 4OGEA 2DZ9A 4PLLA 4OVUA 4NL3A 1UWMA 4J9HA 3V8JA 2ZJDA 2QQSA 1ZSZA 1WXVA 2KRSA 3EG1A 4BFRA 4YTMB 1WR6E 1IYFA 4LDXA 1MHHE 3JCMg 1TS5A 5EE0A 1M90C 2LZ6B 3CCST 2FUG1 4A55A 2VZKB 4LNIA 3H7SA 1QMCA 2GFAA 4US9A 4KGRA 4EE2A 2QQAA 2JNGA 1KJWA 4MZMA 3S3OA 4O1NA 4F1SA 5LJ5g 3TVTA 4XC2A 4Q2JA 2CP6A 1T5XD 2EJFA 5EE3A 2MK5A 4C8QE 5GAMf 5KYYB 3OJ4B 4C8QB 3DKMA 2RGFA 4FSSA 1T3LA 4PJOC 2XBBC 3P0CA 4A54A 2EKOA 1KG1A 2I2YA 3CF6E 2QTVA 3AE7B 4OGCA 2UYZB 1BB9A 4MZTA 4HROA 2X35A 1TT5B 2RF0A 3G6EA 1VQ4A 4WJOA 5HI1A 3L2QA 2AT1B 3V6EB 2CGHA 2DK3A 2NUTA 4L23A 1G3TA 3CMEQ 2WLBA 2FCQA 3NZUA 1QCNA 5DLQE 1QOGA 3RZFA 1V29B 2EQKA 5D6JB 2V0GA 3AEBB 3RNEC 1G8XA 2BB6A 1B9RA 3FDRA 1VQ9Q 4M8NA 4FHJA 1J3TA 3UIPB 4M01A 3RI7C 2EQIA 4J5YA 4C0GA 2K9XA 3A1QB 1WJQA 2KX3A 3PZ7A 1V97A 4M75E 4B6WA 2WXQA 1OYXA 2FRWA 1G3WA 2BYFA 4M75B 2WXKA 4N0AA 2M16A 3MP6A 3OYDA 2EIFA 1B34A 1TZOA 1RUWA 3MHSD 2KD0A 5HFYA 1I35A 4MMKA 3RDVA 3TSZA 2BUDA 4IKGA 1RI9A 2BF8B 2ZZDA 1YI2T 2EGEA 2BGFA 2G6FX 3NOBA 4F7UA 2NBWB 4IKBB 1FCLA 3PREA 2IJ0A 3JB9G 1OOTA 3VTVA 1PG5B 3QYHB 1G3SA 1FNWA 4C8QF 3AMZA 5JXVA 1OEBA 5D2MB 5E6JA 3EHRA 2X3WD 1YCYA 4MELA 1JJ2S 1D5ZC 4HLEA 2K2MA 4JWSC 1SXTA 2A37A 1OI1A 3SB2A 1FO4A 2DF6A 2ZW0A 2J0MA 3L42A 1WFWA 2FZCB 3VR9B 2KNBA 2JTEA 2F2VA 2N9LA 3NMZC 2QGGA 2K6DA 5IH2A 1ZBXA 1YQ4B 1V1OA 4KH0B 5GAMh 2ROTA 4N59A 4HCKA 3OW2P 2JM8A 2LTOA 1QWFA 4JZ4A 2VRRB 2W55A 3CCRQ 1VQ8Q 5CKEA 3KUFA 4J9DA 1PCXA 1YMHE 1YN3A 4ZOHC 1WXTA 2RJDA 3OMGA 3VTWA 2KJHB 3X0WA 1FFUA 4JIOU 4BKTA 3JVZX 1VD2A 4M75F 1YJNA 4BD3A 2OTJT 1ZA1B 3TCJA 1U3OA 1XJWB 5CKFA 1GC7A 4W9LA 5GJVB 2CDTA 1M90R 3CC2Q 1V2YA 1JO8A 1ZXIA 5C23A 3VS7A 3UIOB 3R2TA 1NYQA 4M7AA 4KGTA 2GGRA 1T3SA 4FIBA 3UINB 2A5UA 1VQNA 4ZNXA 2M0AA 1X1MA 4WQMA 4PJOE 3L4PA 3AEEB 2FBWB 1GOZA 2NTTA 3A4SC 3KH0A 4BBNC 2AQ3B 4C4VB 4N9F4 4EIKA 1ZUKA 3V3XA 2Y90A 1UGJA 2EKEC 2KWVB 2MBEA 4Q5WA 2C9WB 3O65B 2MA9B 2HBPA 1K53A 1WJSA 1QQRA 2N7DA 1ET9A 3M9QA 2KDIA 2MPXC 1UGQB 2LGXA 1G5VA 1C78A 3QAQA 1N8RR 3G4ST 2JWUA 2BVCA 1WYGA 2Q5WD 1F1BB 3TREA 2L00B 2RMOA 3NUHB 4ZRPA 1A5RA 4O5VA 2FIDA 1FPYA 3OYAA 2NLUA 4NQLB 4CYEA 4P5NA 2YT6A 5FU6C 2GBKA 3AE2B 2PIAA 3Q3FA 5FR6A 2Y5PA 5E6OA 2NWMA 1YX6B 3PTFC 3P42A 5D3IB 1E9MA 2DTHA 4ZTFA 4BOSC 3VRYA 1VQ5A 3SFMA 1CKBA 1WZOA 3B2FA 5CKHA 1MGQA 1VQ9T 3NZSA 2COYA 4XWWA 2FYKA 5KCHA 4DOVA 2OJRA 2GQIA 3AHUA 1SHGA 1PGXA 2KTRA 2FCMA 2KFKB 1WHMA 1MMGA 1SHFA 1UHCA 1VQ6Q 1KJTA 4A9AA 1WSPA 3RYTA 4R56A 1WY8A 4LJOB 4ZRIA 1WWTA 4WCIA 4A4GA 1F1HA 1M1GA 3M55A 5KYWB 8ATCB 2FB7A 4ELYC 2KANA 2VYTA 2WGSA 5GMKl 4PJOF 4OZCA 2RPNA 1X27A 3RULA 1E5WA 5G2NA 4JX1C 5GXGB 4IUUA 1OEYA 3MKDA 2FZKB 2IY1B 1WI0A 2F1LA 4F14A 2FE8A 2LMJA 1I81A 2OTLA 1WNLA 5KYUA 3ME9A 2CJNA 2HDAA 1M1KU 2PE6B 3IVFA 2RMMA 2CT4A 4PLIA 1I4XA 1MPEA 3L0WB 4W9CA 1QF6A 2D10A 3MHZA 4MEMA 3S3NA 4A4KA 5KE2A 1WGYA 2D0NA 2EMTA 1EWYC 4YT0B 4BI3A 3ZDTA 2KAJA 3VVWB 4P16A 4QT7A 4L5GA 5L83A 1AHJB 1L4DB 3A8MB 1KFYB 5GANf 1I4K1 1PDXA 1TY0A 2LJIA 3N1ZC 2K2VA 5AUIA 2WDVB 3Q2AC 2IPOB 2X38A 4OVZA 4W9GA 3H7PB 3HHMA 4GGQA 3EFSA 2WXNA 2O2VA 2L3SA 2PE9A 1FXAA 5GAOl 1JALA 2K7AA 2RDBC 4MM3B 2DLPA 2MLBA 1EWCA 3GNGA 3HFOA 1UJYA 3X26B 3G71Q 5DCNA 4BKGA 4HVUA 1N63A 4I6LB 2CU3A 3NG0A 3QZ9B 1PKSA 2F69A 3R6OA 2ZGWA 4HT8A 2TSSA 4II1A 1YQ3B 3AE4B 4IM2A 4QVDA 2WXHA 1TZ1A 2SEMA 1V80A 4AUQC 4NS5A 2VB6A 2KLCA 3NTHA 2A08A 4BUGA 2L52A 1MV0B 2E3HA 2K4YA 4M8MA 1VQPT 2QI2A 2X4YA 1ZSZC 4J7IA 3FC3A 3SU8X 1U1SA 3SFDB 4JJBA 1WMHA 1QCOA 2PVOD 1KQ1A 4KGVB 1XOVA 2JY6A 4N4IA 5KYXB 1WPYA 3EH2A 4IW0A 1X2KA 2KEAA 3L2UA 4FL6A 2DX5B 5D7UA 2M1MA 2N1VA 3RUIB 3T3NA 2Y5BB 1UH6A 1SE4A 3REAB 2AQ2B 1RLPC 2DZKA 4WQOB 1UDLA 2DVEA 3SR6A 1MFWA 4AS1A 1UTIA 2BTTA 5FU6B 2C7MB 1RL2A 2MI6A 3FRNA 3HPWA 1VYTA 5D6WA 3TEXA 3REBB 3RNCC 1CKAA 1QKXA 4LUEA 1EFNA 2JTFA 3W5UB 2LMCA 2NR2A 5IN7A 1SPKA 2DE0X 1UF0A 2D6FA 1SF9A 1UUEA 3EG9B 2CH4W 1QP2A 4K3CA 1LVKA 2AKLA 3Q1JA 5BO4B 3N3KB 2EELA 1M8MA 1HYOA 2KYMA 1N6AA 4B9WA 5A0LA 4BAXA 3AE1B 1ARKA 2NPTA 4VUBA 3PRPB 4OVAA 2ZCCA 4ANWA 2N9EB 3KQ4A 5JZEB 2J6OA 1EU4A 4QKUA 1RWSA 1K9MR 1YWOA 3HRDD 3EFUA 3P4RB 4BBNF 1HXDA 2PUKB 1EIFA 2M1HA 1VUBA 1TS3A 2ZCBA 3CCUT 1ZQ1A 1V8CA 1WJNA 4N0AC 3R2IA 1VQMQ 4N4HA 5IHKA 2EW3A 2GTOA 4LN2A 1S72Q 1YJWA 1PHTA 2VGNA 2ZVOA 1TS2A 3I57A 3F70A 2O4XA 3S6WA 2YUNA 3M57A 1K1ZA 2LQKA 4RF0A 3UATA 2GTJA 3VRBB 3DLMA 4BB7A 4RCCA 3CMEA 2KDEB 3ZVVA 2R58A 2E10A 2D11A 5LJ3e 4WF2A 5GANg 4IIOA 2JZPA 1YIJA 2EKHA 5BMHA 1TU0B 2MSED 1A0NB 5FWCA 3EGDA 3M0UA 4W9EA 4EPCA 2CZ1B 2IWLX 2AKKA 2GF7A 5AYFA 1NVID 2W54A 3I5SA 1L4ZB 2J6FA 3PSEB 1E7PB 3PNWC 2MCNA 4LDYA 5GAN6 2QCZA 3LDZE 5CX3A 5H92C 2CSQA 1GJZA 5AUKA 4NPNA 2YRVA 2LQ8A 1GBQA 4A90A 4PFZA 3I56Q 2AQ1B 1RAFB 2K9GA 3NTKA 1M90U 2J0JA 4PT5A 1OU8A 2HQHA 2R5AA 4AG2C 2DZMA 2IO1B 2NS5A 3OB9A 2RQRA 4J8OA 1ZOYB 4IIMA 4M77G 3IQ2A 4KIKA 3M0QA 2HNIA 5GMKi 3OYEA 2LC4A 1NPPA 5BYSA 2RSUA 1I07A 1ZSZB 4L1BA 3GPLA 3W1SA 1P7EA 1RLQC 1DOIA 1T0SC 3RD2A 3RKXA 5TR5A 2DIQA 1HEZE 1UG1A 3M0RA 1JJ2A 4M7DG 1NJIR 2RAIA 1NENB 2M02A 4LDVA 3A33B 1W2BA 1VJKA 3QJZA 1FMKA 2KXJA 2EYYA 1WXSA 1YITQ 1N6ZA 3IHPC 2A36A 4KZ0A 3T8MA 1U8RA 2X9HA 3EGXA 2WXMA 4CC3A 5KYNA 3LXFA 2Z59B 3OYJA 4DHJD 1SEBD 2MHJA 1N8RU 1UECA 1D1BA 1NPRA 2PVOB 2CP0A 1WGDA 1YHQT 4C5GA 4C0FA 4IUVA 3KWVA 2WWZA 7AT1B 5LJ3f 2D0QB 1VQ8A 2L8JA 3CC7A 4PJNA 4LNPA 2D3BA 1C1YB 1TS9A 3FJ5A 1N5ZA 3BYYB 4GDKB 4JJNK 3L2ZA 2VH1A 3BWUD 3M4YA 4IUTA 4A53A 1M1FA 1G83A 1JB0E 2DL8A 3C4SA 2C7NB 4AOFA 1M2VB 3ZXVA 2KYWA 2DBMA 3ZEHA 1YJIA 1Y07A 4XGAB 3JCMe 1E8WA 1YNZA 2FUHB 1KHCA 3C0CA 5LJ5e 1FXTB 4ZRJA 4PQOA 4XU0A 1V1CA 2YEPB 4FLHA 4OMLA 3NVWA 1KQSA 4MDXA 1UGVA 1IXDA 2M9UA 4MMLA 4TQ1A 1GB4A 1B34B 2KJ6A 2WYQA 2C06A 1D1CA 2VVKA 4G0NB 4LNKA 1Y71A 1VQ7A 3RMQA 1T3QA 2NUPA 3AE5B 1EM7A 1FCCC 2QTXA 2L2PA 2JU6X 3M54A 3U30A 3TEWA 1KC8C 2LXAA 1MUZA 4IURA 1XLOA 4CRIA 1RACB 4J3OD 1VQMT 5DPSA 1V49A 4W9FA 2JT4B 2LRQA 5EE1A 3GF5A 4HJKA 4EMKA 2GB1A 2I1JA 2RDGA 2RPVA 4ICVA 4DDGD 1GUAB 4JPSA 1X2QA 5I4DA 2MP2A 2VZKD 2LVMA 4G11A 3CCSQ 2M0XA 3H6ZA 1QQJA 3B2GA 4BE2A 3JSCA 1LPLA 1V81A 3LJ3A 1D5MC 2KNBB 2WSCE 3MTNB 1LQBA 4LXCA 1QVGA 2REAA 2IVWA 2IDYA 2PVGC 2WX1A 2K6DB 1VQ4T 2G3RA 3M0SA 3ZO5B 5IAYA 3LH5A 3E56A 1G3YA 4OMFB 3PRZA 3TEYA 1GG3A 2LT1A 3JCMf 1UWXA 1ZW7A 6AT1B 5FW9A 5AZHA 2OI3A 2CH4A 5LJ3h 2N7JA 2L83A 2LUMA 1I1JA 2YEPF 5LJ5f 3DHGC 1RFAA 1Q82C 5KE3A 1IGDA 2LRUA 3FB9A 2E5KA 2RHXA 2PJHA 3AULA 4WJNA 1OEYJ 4JWUC 3EFOB 1OFFA 1SE3A 3V6CB 4KUIA 3H0IA 4QW2A 1VQOA 3U8ZA 4ASWC 5IXFA 3RN9C 4P1CC 4JJDA 5GMKj 3PT9A 3RNAC 2V8IA 4HK2A 3BK2A 5MPOA 3AEGB 1Y57A 2W3SA 2VWFA 4FJYA 1SEMA 1YJ1A 2RD0A 1MMAA 4GDLA 1XNIA 2LASA 3C12A 3CBOA 1VRAB 1VLBA 2CJOA 5HKHA 2RB6A 2LGDA 2DX1A 4JLIA 2ZPFB 1IB8A 2E3IA 3W2DA 5M9OA 2K25A 1NM7A 4OHJA 1FMVA 2NYSA 5CK9A 4ARCA 2VV5A 4HKEA 3QZ5B 1YI2Q 4HVWA 3CCVA 2O6VA 4RM8A 4DHJB 3CXCA 1EO6A 2V1RA 4C92D 3JB9I 1TH7A 5D6XA 2BW2A 4REZA 2L05A 4B9KA 1L2NA 3AI5A 3GP7A 4CC7A 1V1PA 3OA6A 1IUEA 2J53A 2X4JA 4WWOA 3MJWA 2H88B 4BDZA 3A8LB 5J2RA 1KM7A 2KLGA 4HCCA 4PS7A 2KI7A 1PQSA 3R66C 3T9LA 4M78D 1WYWB 5DPWA 1C0MA 2P4RA 4BY6C 1CQVA 4C92C 2MBBB 2JOYA 3HHTB 3NTIA 4XWTA 3EAEA 1H4RA 4BVUC 3HTRA 3VKIA 1Q0WB 2CHWA 2K5FA 1NDDA 2ABLA 4XDCA 1WHKA 2PMVA 4MH8A 3IQLA 3ZIMA 4PJLA 2PKOA 3FLGA 1YJNT 1VQLT 3L10B 4J6WA 4M78C 1BI3A 2N4FA 2QA4T 3JCMh 4W9JA 1UHFA 2GQVA 4F04B 1H3ZA 2K3XA 2W82A 3EFRA 1KD1C 3P4SB 1IHVA 3QHTA 1RAEB 5LJ5h 2QGFB 1SE2A 2DPPB 2KZRA 3EC8A 4B0MA 4FCYA 3PV1A 2VGMA 4E74A 4XTVA 3BVZA 1ZX6A 3KBGA 2B3AA 1X43A 1JCKB 3EG3A 1WQWA 3RESA 3CCQT 2OTJQ 1GAQB 3JB9J 4KX6B 2CUDA 3AH7A 4RTXA 2X8XX 2V14A 4M77A 2W9NA 2ZPNA 5LXHA 5FU7B 1QW1A 4PK1A 1AD5A 1C4PA 3C0RB 1BBZA 2FRYA 3TSWA 2NMQA 1K0XA 2K3UA 2DA9A 4BE1A 5KYUB 3JCMW 3U2SC 3V60A 4AQ7A 2RQWA 4NNJB 3PZ8A 5HKCA 1PKTA 1MI0A 3VU3C 3NJTA 4PJOD 4HKQA 1IBXB 2XU8A 1S1QB 4MGZE 4M7DA 1OULA 1JWBD 1VZ6A 4K7UA 1O75A 2XDBA 5L95C 4DBGA 2DXBA 2LI5A 5CHFA 3GE8C 1E6GA 2WDQB 3HM3A 3C19A 4ACFA 2HZYA 3OYCA 2KTFA 2YUQA 4KDLB 1Q82R 2RDHA 2JPHA 4HWIB 1NG2A 2H89B 3L13A 1EUVB 2J6KA 4FYYB 4UC4A 2YLCA 1D3ZA 3ZTDA 3G4SQ 1C79A 4A20A 4K7WA 5AEKB 2IO3B 2DXTA 2DVJA 3I5RA 4FW1A 3I55Q 1M3AA 1XTDA 4J83A 2LRWA 3VS0A 2M19A 1S72A 1MG8A 3ZKJC 2FHDA 1BI2A 3U4EG 1I42A 3M0TA 1OCSA 1NJIU 3X25B 1PC0A 4FJZA 4KZCA 4C8QG 1FMWA 2JUFA 3HL8A 5CKBA 4S0RA 3N32A 4KKIA 1C1AA 4PJJA 2WHIA 4RG2A 1GFDA 1P3QU 2I1KA 4AT1B 4WAFA 4HCZA 5FWBA 3MP8A 1J19A 3QUIA 3CIRB 3ETRA 4YSXB 4OXWA 4F17A 2QSDA 2DZIA 1ACMB 2CP5A 3AXCA 3RBBB 4WJQA 3UT1A 4M0WB 4GSWA 1XQQA 4WJPA 2JZZA 4IWOA 1Q7YC 2JM9A 3FJPA 2WDTB 4A63B 1N61A 1ACCA 5FRMA 1UELA 1TIFA 5C1ZA 2M51A 1D1AA 4TMAB 1OU9A 4GLMA 2GRIA 1QZEA 1XO3A 4B6MA 1N5XA 3MEUA 3JCMX 1YFNA 1KSWA 4C92E 2NCNA 5L8RE 3L2VA 2DTOA 3H6NA 2DL4A 4C92B 3DCGA 2AL3A 1OV3A 3ZFJA 1K73C 4RGOS 2RQVA 1W1FA 3BINA 3OYGA 4M75G 3TEEA 2G45B 2FPEA 5GAMd 4KRTA 3QA8A 3APDA 1W2BS 4M78E 2G3QB 4OF1A 4AFUC 2CS7A 2JVCA 2K6QA 2N7EA 4M78B 2E4HA 2QYZA 2J0KA 3ZNZB 2CZ6B 2LNVA 2QASA 4JGHB 3UWNA 4E47A 4PL6A 1TYGB 3ECIA 1FXXA 1AYFA 5J39A 1JQ4A 2FVUA 3M95A 1YITA 1UGMA 2FPDA 2WWEA 1SGHA 5GAN3 2RNAA 3OAWA 1LJOA 4BGJA 2K8HA 5HK3A 3RCZA 2D3CA 1I8FA 2HEQA 1YWPA 2QQBA 3LLRA 2AX5A 2WXJA 4C5HA 2KROA 2MBOA 1PUTA 1OQRA 3KYDD 1WGSA 2JZ3B 3DBLI 2PW9A 5GAOq 3H1UA 4X34A 2WU5B 4IOIE 2K5LA 4HKZE 3AU5A 2O9SA 2XK5A 3SEMA 1ABQA 1OPKA 5KCOA 4ZGDB 3CCLQ 3PO0A 1WJ6A 3PS6A 3UQBA 4CHKA 4E7JA 3QK0A 5HY6A 1JWSD 3PLVA 2WSEE 1YN4A 4EMKC 1VQKQ 1N5WA 2K8CA 4ZDVA 2E1HA 3X24B 4BZAA 2CP3A 1JXOA 2KJRA 3BVMA 1KQSS 3IFWB 1N62A 4BKSD 1VQPQ 4C92F 2M17A 1OX8A 1KRHA 3UF4A 4FXCA 2V9HA 4PJOB 2EQUA 3UI3A 4K7SA 2J52A 1KTKA 2RPQA 3JYUA 5A0GA 1Y96A 2QHOA 2IBIB 4LNNA 3M56A 2I4KA 1M3CA 1WLPB 3TQ7P 3A5ZB 2L32A 2NTSA 2WDRB 3N5BB 4C56C 4M78F 1R4MI 2C0TA 4OB1B 4PNOA 3CCJQ 3PHXB 3CBMA 1NEGA 3VAWA 2KKCA 3I55T 2OAUA 1LNXA 3ZYYX 4TUUA 4PJOG 3VUBA 3BY4B 5CQXA 3KFVA 2JN0A 2XKOC 3RNGC 2EAYA 3ZL7C 4YL8A 3LX7A 2KQ4X 2EWNA 2LJ0A 1YOVB 2FEIA 2E6XA 1KQ2A 4BI8B 5GANe 1F9JA 1QVGS 2LVOA 4MDWA 5GAMj 2A28A 1GNUA 5GAN8 4DXGA 3Q69A 4BDYA 2ROLA 3I5JC 3Q8EA 3QARA 3VS3A 5IHNA 1KQ6A 4PQPA 4EUTA 4A4HA 4AZ9A 2CZ0B 2CKHB 2LP5A 1RAAB 3ALBA 1Q10A 4PKCC 1WZ0A 3DVNV 2D07B 2KWDA 2XHCA 4GBQA 1JMLA 4JL9A 3CC4Q 1VOMA 3V05A 2HTME 2Z0WA 3M0PA 3LGFA 3HRUA 5D6YA 3CCUQ 1I4QA 3APFA 2GOWA 4EMHA 1AVZC 2KVQG 3NFCA 3PT2B 4I6NB 1CSKA 2KT7A 2GNCA 1WGGA 3DVNU 4RGNA 1WI7A 3FIFA 3VV0A 1WE7A 2UWQA 1T0QC 1C4CA 4P2IA 2DNUA 1HZ5A 1NEBA 4Z89A 2SAKA 4ZN3A 2KE9A 3NS8A 2CSIA 4RMOA 3HVDA 4AFQC 3QBYA 4WIPA 1PWTA 2DLBA 3RMKC 1QOFA 3CPFA 1YCSB 3VRZA 1KC8U 2RJEA 2GBMA 5IAAC 3JCMc 2EJGA 3WVDB 3SWNA 5I21A 3B08A 1YN5A 1KK7A 2PEAA 1NLPC 2IO2B 3CXCS 3H41A 4EMGA 4D2KA 3HKSA 3A9KB 1FFVA 1DYQA 3L2RA 3CCET 5EDSA 3CD6A 3FC4A 3P63A 3CCMQ 1R4NI 3CMAA 2EKIA 3LUIA 2NUPB 4NZLB 4EFOA 4HEA1 5CO7A 3D32A 2K22A 2JYTA 2LZ6A 4I6PA 4C7YA 1K8AC 3DHIC 3VS5A 1AEYA 1O9SA 1YX5B 4QAYA 3DBLB 4K11A 4AWJA 1KMDA 5AT1B 3ZJVA 2OX7A 3MHXA 4EMKB 3LWHA 1T0RC 2CHZA 3ENEA 1WJRA 1KLUD 4NY0A 4F7ZA 3NZ3A 2EYZA 2IYDB 3FILB 4R3DA 3CCLT 1ZDVA 2WSFE 1TKYA 2RM4A 4II3B 1RABB 4JRPA 4XE0A 5KYYA 3KW5B 1XD3B 1X75C 1R77A 1W4SA 4C8QA 3JRZA 3NS1A 2CHXA 4PS8A 9ATCB 2K79A 4L6V5 2KQWA 1VQKT 1Q1OA 5DPRA 3VS4A 2BB5A 4C5IA 2RA2A 2DTIA 2ENMA 4KKJA 2VXFA 3KYCD 2MJDA 1Q82U 1E90A 1WF9A 5KH6A 1JJ2P 4OMPA 1ET6A 1NZ9A 4HPPA 1G2BA 3UQAA 2ESWA 5IXBA 1YHQQ 1W2BP 1YJ9Q 4NAWB 4USAA 2ZPHB 2QEXQ 2MEKA 2DBYA 4JUVA 2W10A 1IGUA 2J42A 2LHDA 3ZRCA 2CYZB 3GLXA 2LXCA 3VXWA 1FWZA 5DM7R 3VYHB 3OYBA 3CCJT 1R4MB 2DENB 3EHVA 1UUPA 2LVPA 4YTNB 2QMTA 3ER0A 1GD5A 4JRKA 2F5TX 4RUGA 2LHEA 2YWWA 2WACA 1YNTE 4C0ZA 3A9JB 3Q14C 2DAJA 3B9JA 3A1QA 2OTJA 1M30A 4R55A 1FM0D 2PQWA 2XICA 3PPAA 3SD5A 2VXEA 1ZBJA 1Y8RC 4M75A 2N1WA 1UE9A 2MJ3A 1B1ZA 4R0KA 4Y92A 5C6SA 3QWYA 2YPSA 3G7ZA 1PNJA 4XZ4A 2DYIA 1F77A 2FCSA 2I38A 3IT4B 2DIGA 1EF5A 4P2JA 1HK9A 1NLOC 1JU5C 1WFYA 4S17A 1E8YA 2HMAA 4FSXA 4FT4A 2DJQA 1RI0A 2INDC 3WAOA 2ZPIB 4IKBA 2DM1A 1PD1A 3ASKA 4RMAA 1M5Q1 4OB0B 4K81A 1D6EC 1Q5WB 4A4EA 4LNFA 1SIFA 3QQ8B 4QVZA 3HM6X 5GAN7 3VDZA 4ATOA 5GANh 1AWJA 1XEEA 1I0CA 3CC4T 1KQSP 2DYOA 1WX8A 4X9CA 2KHWB 1DGJA 4NL2A 4E2FB 3VJPA 3Q8BA 3ZNHB 1M8VA 1IPGA 3OYYA 1VZ8A 1ZHIA 3AE9B 1TUDA 2CP2A 3RUXA 1D3BB 2M0OA 2JF5A 3ZNID 1NI2A 4OW0A 3VS1A 4TQ0A 5J17A 4FHKA 4XK8E 3AT1B 2W3RA 2BE7D 3VRAB 1Y7XA 3QG1A 5IO9A 3LYIA 2KWCA 2GFUA 4RTVA 2E6ZA 3M5AA 3IXSA 3LGLA 1KD1U 2JWZA 1TGZB 4GMVA 2D1XA 5AZFA 2D5GA 1XCTL 1QOBA 3G6EQ 2HL3A 1VQ4Q 1VQ9A 3CWIA 2QDLA 2CSKA 2DL5A 2H3EB 4E3CA 2L0FA 3LYYA 3OSSC 1OQKA 2X3XD 3V7SA 2LX9A 3L16A 1SRMA 4OMNA 1QVGP 4XTZA 3RERA 2KQSA 3X20B 1TTNA 4KULA 2R2OA 4JPBW 5EG2A 3CCMT 2ICIA 2CR5A 2RH2A 3URGA 2BS2B 1MNDA 3S3MA 2LCCA 4AMCA 4J7FA 2NUZA 5EC7A 1JWMD 1YN8A 3WALA 1H641 1DOXA 3HRTA 2KMTA 2IPKD 3PMIA 1TXQA 4Y28E 2XDDA 2YHTA 1H8KA 1FEHA 3HIZA 2E64A 4M7AD 4C4VA 1W6XA 3M63B 4OB3B 1FIQA 3QWZB 3H8HA 2C0IA 2C5LC 3NVZA 1QWEA 4DA4A 3CCVT 2JUOA 1WXQA 3RIRA 3EG0A 1HZ6A 1TS4A 2O9VA 2GCXA 3GOXA 4JRQA 2ED1A 3ZRFA 2HQEA 4EZJA 1XT9B 1BT0A 2QEJC 3U23A 4M7AC 4PJMA 2J4XA 4CC2A 3O5ZA 1P9DU 4M00A 4QQ6A 1TUCA 1CMXB 1I7HA 1RYJA 4CI0C 2WNMA 1IO6A 3OQ5A 1JEGA 4DQOC 4PFPA 4JE3B 4LNOA 1YJ9T 1TTHB 3JCMb 2QEXT 2E6NA 1SRLA 1VZ7A 3TCAA 2XN9C 3CCRA 3QCAA 2KDFB 2R2QA 2B86A 4HVBA 3QIJA 2HD0A 1SSNA 4ITKA 4XYCA 4GLKA 3AE8B 5ECAA 4RTUA 3CXCP 2NVUI 2DWQA 2K5PA 1WQ7A 2CREA 2NUTB 4PYUA 2KFKA 2HQXA 2PUOB 3Q3JA 5AZGA 2R61A 4GIVA 3WANA 2KMCA 4ARIA 2OOBB 1H8CA 1WM3A 3CC2A 2HTHA 4DBFA 2QAZA 1MNEA 1WHLA 5KYWA 3GOEA 1A70A 3RFZB 1L0YB 1K4US 3I63C 1YJNQ 1VQLQ 3P2BA 1XQHA 4RGMA 4D8DA 3BW1A 1TKEA 1NYRA 3GS2A 3HUIA 3NY5A 2QA4Q 1Q86C 1P7FA 4XX5A 2MWOA 1WX9A 2LNHB 1V76A 3RMSA 5IHIA 4F7UE 4JS4A 2HJ1A 3KUCB 2KRMA 3CBPA 2MMPA 2JMCA 1VQNQ 4BE0A 1YQBA 4F7UB 4IWPA 1GB1A 3EECA 1KFZA 2J05A 2YRCA 3CCQQ 1QKWA 4GXBA 1ABOA 1BK2A 3QIIA 2DO3A 2FNJB 2HE7A 3VTUA 2EYWA 3EFCA 4GY5A 1JRUA 1KOTA 2KY9A 1IP9A 2XEWA 2AL6A 5IKCM 3NHEB 4OMOA 3S2AA 2BZXA 2GBQA 4JZ3A 1WXUA 3E1SA 1ZDXA 4AFZC 1ENFA 4O6JA 2AR5A 2VH2A 3PZDA 2D8HA 3GZNI 4DWFA 2KC1A 2WQYB 2RHUA 1PFDA 1WM2A 2D3AA 5LJ3d 2NBVB 3H7PA 3EHQA 4Z8AA 3G6ET 2NBUA 2V8JA 3L1AA 3O13A 4J6YA 2HKNA 2RD1A 1EU3A 3AE3B 4MM3A 2GBJA 4IC7B 4WWPA 1X6OA 1LXDA 3MCAB 4A8XC 1NBFC 1VQ6A 4YXDB 3OS1A 2G4DB 2FAZA 2L3PA 3SWNC 1E6HA 2N0SB 1VQ5Q 3JCMJ 1T0YA 2KWUB 3MEAA 2C60A 3CCUA 1RFKA 1DJ7B 3J80E 1SSHA 1IGQA 2EGAA 3OS0A 4HVVA 1OZ2A 2BYVE 2KMAA 4DXFA 1AT1B 3GIBA 1UBIA 1N60A 2LVQA 2XK5B 1FNVA 3P1MA 3MP1A 3PIOA 4BOZB 1S3SG 5KYXA 3VH3B 2KSSA
chains in the Genus database with same CATH topology
5HCKA 3PE0A 4HDOA 4DDID 2KOXA 2FIFA 4G50A 3X23A 1UZXB 2PTKA 3DVGX 4ZYNA 2K3BA 3IG3A 4FADA 2KXCA 4X1VA 1E8ZA 4GOCA 4Z88A 3ML9A 3CSFA 1V5OA 3QWXX 2LCSA 2D8JA 1AWWA 1WIEA 4X57B 2KTRB 1M94A 3EG2A 4W9HA 2PZ1A 2J7IA 1LM8B 5I22A 1L7YA 3HPBA 5CHVC 5IA7A 3H9DA 1GCQA 3CMMB 1VA7A 1UJ0A 4F8CB 1QLYA 4EOYA 3K9OB 4HCNB 3M62B 2K1FA 4OVVA 2M8SA 1HE8A 2BYEA 3VQIA 1UD7A 2V1YA 3VS2A 5JHAA 2DBKA 1T0HA 2MWSB 1RAXA 2AEHA 1B07A 2BZYA 1BU1A 4LDTD 1OGWA 1RLFA 4AFSC 2JS2A 2LD9A 1Y0MA 4IG7B 4AG1C 2KR3A 1YP5A 1JQQA 2K39A 2O2VB 4PZGA 1MV3A 5LXIB 3RNJA 3SHWA 2CS4A 1XTEA 2EPDA 2CUBA 2FO0A 3R6NA 3VHTC 1X69A 1VCBA 2L7RA 3W1SC 3FOGA 2JS0A 1WMHB 4GDKA 4ANXA 2HJ8A 4KV2A 3ZDMC 4J9EA 4LE9A 2LUEA 3M3JA 3DBRI 1ZKHA 2CZOA 2KFJA 1LFDA 2DYMA 1V86A 1WZ3A 2DILA 4MGYE 2DYBA 4PS3A 1WRDB 3ONSA 2DHZA 4HPMB 4NJ7A 5KHQA 1W70A 3R7RA 2GBRA 4HPLB 2J7QB 2BWFA 1AWOA 5CTRC 2NPTB 5J18A 3ZLZA 1K0SA 1ZUYA 4MJSA 3SDLC 2KT1A 2GMIC 2JT4A 2CU1A 4WWNA 2EVRA 3PVQA 3DBSA 2RN8A 4EZLA 3ML8A 1ISNA 3WAPA 2VKNA 2BWES 2IIMA 2KN5A 2V1QA 2V3SA 3TBLD 4EZKA 1FYNA 3TL5A 2A4ZA 2OAWA 4P7IA 1WXMA 2C7HA 3B1LX 2KO3A 1WE6A 2L0TA 4HXDA 4DEYA 5GMVA 2O31A 3SHQA 1M3BA 4W9KA 2YVCA 2MCNB 3WA0A 4LDTB 3W1YA 3L54A 1XTNA 1V6EA 2M0YA 1T0JA 2H8HA 4DK5A 3APCA 4RTZA 2KBTA 2J06A 1V9JA 4KIKB 2M4NA 3NGPA 1PRMC 4GU2A 5G55A 1AARA 3L08A 4DXAB 5D7GA 1V5TA 4MDKE 2AK5A 1WXBA 2ETTA 1ZLMA 4MGIE 3PLUA 2O6VD 4D8KA 1NYFA 1WR1A 2KRNA 3JSVA 2DL7A 2D3GA 3DYTA 2MBHA 2V4LA 1X6GA 3KVFB 3U7DA 2N9XA 2LJ1A 3ZUNA 3I35A 2EBPA 3ZW3A 3I9QA 3EGUA 2DRKA 3A98A 1WJ4A 3H0HA 2YLMA 1B3QA 2G4SA 2KQ7A 3VUWA 4EEWA 1AZEA 2ZEQA 1E7VA 5I11A 4RTWA 1P98A 2AYOB 4RM9A 2HCKA 3ZTCA 3OLMD 3WAMA 3N30A 4IUMB 4MH0E 3DVGY 4HASA 2PNIA 5DPTA 5LLIA 2KYBA 2LJ5A 2KVRA 1YD8U 1NYGA 3VFKA 1HD3A 1GCQC 2MP2B 1JXMA 2BKFA 3CQTA 4HCPB 1K9AA 2IY0B 1ZUUA 3OJ3A 1KIKA 5JH5C 3HPCX 4TKNA 3CSTA 2KGTA 3DDCB 2YUOA 2JXXA 3DOWA 2FG0A 3NPFA 3DBHI 4NJ6A 2AWTA 4DHZE 2ECZA 4JLCA 3VS6A 4DHZB 4LJPB 2FCNA 3QC8B 3I3TB 3PRMB 2WX0A 2MBQA 1H92A 1C3TA 4GDLB 1OTRB 1WDXA 4JJCA 4MSMB 2DMOA 4AJWA 4LUDA 2RQUA 2ZPYA 2HSPA 4FJVB 4K1RB 2EYXA 5E6NA 2I0NA 3R3MA 2O6VB 2W0ZA 2ZNVC 4GN1A 4AKVA 1ZGUB 2N9PC 1KLVA 4URKA 3VH4B 2OJ2A 1P0RA 1GBRA 2V6VA 2ASQA 4J9GA 4FN2A 1WIAA 2MRPA 1WA7A 1Z9ZA 4KDIC 2KDBA 4ANUA 1Z2MA 1J8CA 2SRCA 2DAFA 3QX1A 3WIMA 2ED0A 3TIXA 2KXDA 3RT3B 2FPFA 1GRIA 1AZGB 2ZVNA 4EKUA 2RQTA 4LCDE 3K9PB 1HJDA 2L0AA 2L76A 2REDA 3TMPB 4AP4C 3H0FA 1YIWA 1WH3A 2PPHA 2IO0B 2IZVB 4DEXA 2BPSA 3A4RA 3HK0A 3V61A 4G3XB 2DZJA 4II2B 3R7QA 2KK8A 5L23A 1K8RB 1VYUA 1AOJA 2JRHA 3UA6A 1UFFA 2F2WA 4FBJB 1WJUA 2ZZPB 5JHBA 2REXA 1TBEA 3KUZA 2C0OA 1WYXA 2LWPA 5KHOA 3L17A 1K76A 3JV3A 1X6BA 1H6HA 4A3OA 4IM3A 2L73A 4RTYA 3TJPA 2YSQA 2MOXA 2LQNA 4FA6A 4OMQA 4J9BA 2JXBA 2F2XA 2XMFA 3VUXA 1GCPA 3UA7A 1WXAA 2DRMA 2DL3A 2D2QA 2ZNVB 4FULA 1SE9A 2EMSA 4J9CA 3VUYA 4A3PA 1E7OA 1U4AA 3THKA 4W9DA 1WGRA 4RTTA 2LQWA 4IKDA 3AU4A 2JMAA 2L3ZA 3B0AA 2CT3A 1U5SA 1VYVA 2AZSA 3A9KA 4HDQA 4ICUA 4IM0A 2RR9A 4ORZA 2MX2A 1Z9QA 2GBNA 1QCFA 4MJSB 3ZNGC 1U06A 3RZWC 5CHWA 4KVGB 3PGEA 1LCKA 4HXJA 4NQKE 3DQVA 2KT8A 4ANVA 1G6JA 1GL5A 4JQWC 2JW4A 1HSQA 1WX6A 1O7KA 1TG0A 4BKSA 3KUDB 2Z0DB 4NAWA 2MQJA 1RRBA 3JW0X 1S1NA 3DPDA 4GB9A 1GFCA 4E6RA 4IWQA 2Z0EB 1UBQA 1OQYA 3A9JA 4ZRKA 4J6IA 2MW5A 4MSQB 3PVLA 1H3HA 1E8XA 2HBWA 2RAJA 4OMMA 1OCUA 2HD5B 1GC6A 3UF8A 4ESRA 2LX7A 4KSKC 3V62A 2EGCA 4J9FA 2BZ8A 2L3QA 1EF1A 4KSLC 4CC4B 2YUPA 3IBEA 1J0GA 1P1AA 4E71A 2KX0A 2K8BA 2LJ3A 4F16A 3JSVB 5D94A 2BKRB 2JRIB 3ULRB 1M27C 3PHWB 2O88A 1WX7A 4CO7A 4PYZA 1PRLC 4AJYB 2LGYA 1E7UA 3GBQA 4ON3A 4WAAA 1AWXA 1ZSGA 1Z5SB 2YDLA 4W9IA 4J9IA 4M4ZA 2O2OA 3NHNA 4MGKE 2RAKA 1OPLA 2AZVA 2MIOA 1WGHA 4TV3A 5GJWB 2KC2A 5E6PA 3UGBB 4B95A 4OVUA 4J9HA 2ZJDA 1WXVA 2KRSA 3EG1A 4BFRA 1WR6E 1IYFA 2LZ6B 3H7SA 1KJWA 4F1SA 3TVTA 4XC2A 3OJ4B 2RGFA 4FSSA 1T3LA 2XBBC 3P0CA 3CF6E 2UYZB 1BB9A 2RF0A 4WJOA 3V6EB 2FCQA 3NZUA 3RZFA 5D6JB 4M8NA 4FHJA 1J3TA 3UIPB 2EQIA 3A1QB 2KX3A 4B6WA 2FRWA 2BYFA 3MHSD 1RUWA 2KD0A 1I35A 3TSZA 1RI9A 2BF8B 2EGEA 2BGFA 2G6FX 3NOBA 2NBWB 4IKBB 3PREA 1OOTA 3VTVA 1OEBA 5D2MB 3EHRA 2X3WD 4MELA 4HLEA 2K2MA 2A37A 2DF6A 2J0MA 1WFWA 2KNBA 2JTEA 2F2VA 3NMZC 2K6DA 5IH2A 2ROTA 4HCKA 2JM8A 1QWFA 4JZ4A 2VRRB 4J9DA 1WXTA 3VTWA 2KJHB 3X0WA 4JIOU 4BKTA 3JVZX 1VD2A 1U3OA 1GC7A 4W9LA 5GJVB 2CDTA 1V2YA 1JO8A 5C23A 3VS7A 3UIOB 2GGRA 1T3SA 2A5UA 4ZNXA 1X1MA 3A4SC 3KH0A 4BBNC 4N9F4 4EIKA 1ZUKA 2EKEC 2KWVB 2MBEA 2C9WB 3O65B 2MA9B 2N7DA 2KDIA 2LGXA 3QAQA 2L00B 2RMOA 1A5RA 2FIDA 4NQLB 4CYEA 2YT6A 3Q3FA 2GBKA 5FR6A 5E6OA 2NWMA 1YX6B 3PTFC 4BOSC 3VRYA 1CKBA 3NZSA 2OJRA 2GQIA 2KTRA 1SHGA 2FCMA 2KFKB 1SHFA 1UHCA 1KJTA 3RYTA 1WY8A 4LJOB 4ZRIA 4WCIA 2KANA 2RPNA 1X27A 3RULA 1E5WA 5G2NA 1OEYA 2IY1B 1WI0A 4F14A 2LMJA 2HDAA 2PE6B 3IVFA 2CT4A 4W9CA 3L0WB 2D10A 4MEMA 1WGYA 2D0NA 2EMTA 3ZDTA 3VVWB 4QT7A 5L83A 4W9GA 3H7PB 3HHMA 4GGQA 2O2VA 2L3SA 2PE9A 2K7AA 2DLPA 2MLBA 4BKGA 1UJYA 5DCNA 4HVUA 4I6LB 1PKSA 4IM2A 1TZ1A 2SEMA 1V80A 4AUQC 2KLCA 2A08A 1MV0B 4M8MA 3SU8X 4JJBA 1WMHA 2JY6A 1XOVA 3UINB 4IW0A 1X2KA 2KEAA 2DX5B 2N1VA 2M1MA 3RUIB 2Y5BB 1UH6A 3REAB 1RLPC 2DZKA 4WQOB 1UDLA 1UTIA 2BTTA 2C7MB 1VYTA 3REBB 1CKAA 1QKXA 4LUEA 1EFNA 2NR2A 1SPKA 2DE0X 1UUEA 2CH4W 2AKLA 5BO4B 3N3KB 1M8MA 2KYMA 1ARKA 2NPTA 3PRPB 2ZCCA 4ANWA 2N9EB 5JZEB 2J6OA 1YWOA 3EFUA 4BBNF 2ZCBA 1WJNA 5IHKA 2EW3A 2GTOA 4LN2A 1PHTA 2ZVOA 2YUNA 1K1ZA 3UATA 2GTJA 2KDEB 3ZVVA 2D11A 4IIOA 2EKHA 2MSED 1A0NB 5FWCA 3M0UA 4W9EA 2IWLX 2AKKA 3I5SA 2J6FA 3PSEB 2MCNA 3LDZE 5CX3A 2CSQA 1GJZA 4NPNA 1GBQA 2K9GA 2J0JA 4AG2C 2DZMA 2IO1B 2NS5A 2RQRA 4IIMA 3IQ2A 4KIKA 3M0QA 2RSUA 1I07A 3W1SA 1RLQC 3RD2A 5TR5A 1UG1A 3M0RA 2RAIA 3A33B 3QJZA 1FMKA 2KXJA 2EYYA 1WXSA 3IHPC 3T8MA 4KZ0A 2A36A 4CC3A 2Z59B 4DHJD 1UECA 1WGDA 2WWZA 2L8JA 4LNPA 1C1YB 3FJ5A 1N5ZA 4GDKB 1G83A 2DL8A 2C7NB 4AOFA 2DBMA 1E8WA 1YNZA 2FUHB 3C0CA 1FXTB 4ZRJA 4PQOA 1V1CA 4FLHA 4OMLA 1UGVA 4TQ1A 2KJ6A 2WYQA 4G0NB 2VVKA 2L2PA 3U30A 2LXAA 1MUZA 5DPSA 1V49A 4W9FA 2JT4B 4HJKA 2I1JA 4ICVA 4DDGD 1GUAB 1X2QA 2MP2A 4G11A 2M0XA 1V81A 3LJ3A 2KNBB 3MTNB 1LQBA 2REAA 2WX1A 2K6DB 3M0SA 3ZO5B 3LH5A 3PRZA 1GG3A 5AZHA 1ZW7A 5FW9A 2OI3A 2CH4A 1I1JA 1RFAA 2LRUA 2E5KA 2PJHA 3AULA 4WJNA 1OEYJ 3V6CB 3U8ZA 3H0IA 4ASWC 5IXFA 4JJDA 4HK2A 1Y57A 2VWFA 4FJYA 1SEMA 1YJ1A 2RD0A 4GDLA 2LASA 5HKHA 2LGDA 2DX1A 2K25A 1NM7A 4HVWA 2O6VA 4RM8A 4DHJB 1EO6A 2V1RA 2L05A 4B9KA 1L2NA 3AI5A 4CC7A 4WWOA 3MJWA 5J2RA 1KM7A 2KLGA 4PS7A 1PQSA 3R66C 3T9LA 1WYWB 5DPWA 2P4RA 2MBBB 1H4RA 4BVUC 1Q0WB 2CHWA 1NDDA 2ABLA 3IQLA 3ZIMA 3L10B 2N4FA 4W9JA 1UHFA 3QHTA 2KZRA 3EC8A 3PV1A 4E74A 1ZX6A 2B3AA 1X43A 3EG3A 2CUDA 4RTXA 2V14A 2W9NA 2ZPNA 5LXHA 1AD5A 3C0RB 1BBZA 2FRYA 3TSWA 1K0XA 3V60A 2DA9A 2RQWA 4NNJB <