2DYBA

The crystal structure of human p40(phox)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
322
structure length
297
Chain Sequence
b'AESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil cytosol factor 4
publication title Full-length p40phox structure suggests a basis for regulation mechanism of its membrane binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 64
structure length 297
sequence length 322
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00564 PB1 PB1 domain
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dybA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dybA03
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2dybA01
5LXIB 3JV3A 3TMPB 2LVPA 1UGMA 3ULRB 5I22A 5G2NA 2IWLX 2RD0A 1NEBA 2GQIA 2GBJA 2GTJA 3WANA 4JIOU 3VH3B 1K0XA 4JJCA 3ZL7C 1E6HA 4E71A 2C0OA 4JGHB 2R2QA 1S1NA 4ANUA 3ZIMA 4OMLA 2J05A 4II3B 1WYWB 2AZVA 3JW0X 3N30A 4GGQA 3VRYA 4OVUA 1OPKA 4M4ZA 3ZLZA 1K1ZA 4JZ3A 4D8KA 4NAWA 1UFFA 1ZSGA 4DWFA 3H6NA 3VS1A 4KZ0A 4DDGD 2YSQA 4BKSA 2NPTA 3SHQA 2CSIA 4RTUA 4AWJA 3ZRCA 2REAA 2FPDA 5LXHA 5AZFA 3QHTA 4K7UA 2KGTA 1X6BA 3A33B 3PS6A 3QX1A 3AI5A 5IHKA 2K79A 3HK0A 1X27A 2L8JA 4GDLB 5FWBA 1YCSB 1ZLMA 2P4RA 3R3MA 4AFZC 2MWSB 3HPCX 4DHZB 4DK5A 2YUOA 1WMHB 4ZRIA 1YJ1A 1WGDA 3JSVB 2V3SA 4W9KA 2R2OA 4WJNA 1ZUYA 1HSQA 2LASA 2J7QB 3THKA 3DVNV 1GUAB 1X2QA 2ZNVB 2BYVE 2V14A 4W9HA 2KKCA 2GOWA 3A4SC 4IM0A 1GCPA 2CT3A 3ZNID 4TV3A 1Z9ZA 2V1RA 2KX0A 3LJ3A 4MDKE 4MJSA 2K25A 1WI7A 2JRHA 1WH3A 5IXFA 4A3PA 1S3SG 4OXWA 1M3CA 4X1VA 4TUUA 1W1FA 4AFSC 1S1QB 4MM3A 1E8WA 1AEYA 1YN8A 3UIOB 2XK5B 3KVFB 2RPQA 2CT4A 2LZ6B 1AWWA 4EZLA 1U4AA 2F2XA 3OJ4B 1QLYA 4AG2C 4W9IA 3L54A 1GC7A 1V6EA 4Z89A 1IO6A 4DHZE 2W9NA 1WX8A 5D2MB 1C3TA 1RLQC 1HE8A 2BGFA 1UD7A 3H9DA 2LJ0A 2MRPA 2YDLA 4HCPB 3SEMA 3ECIA 5DPSA 2OJ2A 5KHQA 2KQ7A 1QWFA 3QIJA 2K8HA 4LE9A 2IBIB 5I11A 1B07A 5IAAC 2JMCA 4CC4B 2A28A 3L0WB 4FULA 3UATA 1OGWA 2MX2A 2DA9A 3EHQA 4LDTB 5HCKA 2DAFA 3ML8A 3IQLA 2ZPNA 3M0RA 1WXBA 2D11A 5GJVB 1JO8A 3APFA 4F16A 4P7IA 2REDA 3V62A 3GOEA 2FIDA 4GXBA 4PYZA 3L10B 3ZKJC 4I6PA 3ZO5B 2LWPA 2A37A 4BKTA 2ED1A 1V49A 4WJPA 2HJ8A 1MV0B 1OOTA 2JW4A 4J9HA 1WXVA 1NM7A 3PLUA 3EG0A 4K11A 1GFCA 4OMNA 2GBMA 2HTHA 3H7PA 4MH0E 3UF4A 1H8KA 2VKNA 4XZ4A 2G3QB 4WQOB 1NYFA 4RTTA 1MV3A 2WDTB 4HXDA 4DXAB 1UECA 2AZSA 1V80A 5IA7A 1UE9A 2AL6A 2RQTA 2JVCA 3L17A 3VTWA 2DILA 2FG0A 1SE9A 1RFAA 2ENMA 4J6IA 2KWUB 1LCKA 2RMOA 2L0TA 1OEYJ 2FIFA 3QWXX 2PEAA 2D2QA 1O7KA 4AZ9A 2KK8A 1SIFA 3V61A 3JYUA 4JZ4A 1JRUA 2YUNA 2MSED 2QDLA 2EYWA 2PJHA 1OPLA 3V6EB 2NWMA 2N1WA 1PRMC 3M0TA 3NMZC 4F7ZA 1SRMA 1CKAA 2IY0B 3TJPA 2CHZA 4HVBA 4ZNXA 1Y57A 1UZXB 4LNPA 2DYMA 4JPBW 2O2VA 2O2OA 2N4FA 1AWOA 1P98A 1M30A 3SD5A 1WM3A 1VYTA 3PGEA 1J3TA 1WIAA 3CSFA 2XEWA 4W9DA 3TBLD 3HIZA 3NHNA 3PV1A 2DRKA 1OCSA 1RAXA 4B6WA 2REXA 1YWOA 1CKBA 3ENEA 5E6OA 2C7HA 2WX0A 4MGIE 1PKSA 2SRCA 3PRZA 1X6GA 4PYUA 4JJBA 1SHGA 3WAOA 2MBHA 5CHWA 3ZNZB 1Z5SB 4RTZA 3VS6A 3TL5A 2LVOA 3M62B 1WM2A 1UTIA 2F2WA 2CUBA 2ZEQA 1KLVA 3ZDMC 3RBBB 4KV2A 4PZGA 3KUZA 1PNJA 5GJWB 2DYBA 2DE0X 3PHWB 4IM3A 2K7AA 5DPTA 2C9WB 2KNBB 3N32A 4IKDA 1TUDA 2DENB 2LXCA 1HD3A 3RULA 2MQJA 2KYMA 3W1SA 1ZX6A 1Q5WB 1QKWA 4DHJD 2J0KA 3U7DA 1E8YA 4FLHA 4X57B 1WFYA 3X23A 3PZDA 1I0CA 5DPRA 4BKGA 3B0AA 2A36A 1M3BA 2N9PC 3IQ2A 2K6QA 2M8SA 3R66C 3EC8A 4HPMB 2ABLA 3EG1A 2WWZA 3PLVA 2BYEA 3ZTCA 2I1KA 5J2RA 4J9IA 1AARA 2CKHB 2LUEA 2RF0A 1VYUA 3I5RA 1WX7A 4PS8A 3AU4A 2ESWA 3ZDTA 2K6DB 1QKXA 4LUDA 2O9SA 2FCNA 1YNZA 1UHFA 2YVCA 3M95A 4PQPA 2FEIA 2ZVNA 4WAAA 1GRIA 2NBVB 2JZZA 1BK2A 1TG0A 2MW5A 1E7UA 4W9GA 2MBBB 2LRWA 1E8ZA 1L7YA 4CC3A 2JT4A 3QA8A 2ROLA 3UF8A 3TSZA 2NCNA 5BO4B 2KROA 5FR6A 1P0RA 3IG3A 1NYGA 1NEGA 4K1RB 5J17A 3UGBB 2J6KA 2V4LA 1WFWA 2KTFA 3H0IA 3H7SA 1GL5A 4E6RA 1T0YA 3VS4A 2J0JA 4XC2A 1T3LA 2CSQA 3DYTA 1I1JA 2FCMA 4DDID 2FCQA 1M8MA 1W6XA 1LXDA 5AEKB 4NPNA 1KFZA 2IYDB 2WYQA 4P2IA 3D32A 2LRUA 2IZVB 4W9EA 3U23A 4TQ1A 3OLMD 4EEWA 1MUZA 4PQOA 2WX1A 4I6LB 1UH6A 4HJKA 3QJZA 4NAWB 2KT1A 1NDDA 4JL9A 4LDTD 2RSUA 2DZKA 2NPTB 2L3SA 4K7SA 4Z88A 1J0GA 3NY5A 2LMJA 2D8HA 3PRPB 4TQ0A 2JPHA 2JRIB 2DZJA 3DBLI 2I0NA 2PNIA 4IM2A 4FHJA 3HM3A 4BOZB 3M3JA 3UQAA 1VYVA 2DBKA 3EECA 1WGGA 4DEYA 1RUWA 1R4MI 4IKBA 1PHTA 2LI5A 2O6VB 2NBWB 4J9CA 5D7GA 2LJ3A 4HVVA 4EFOA 2FO0A 3O5ZA 4F17A 4LJOB 4KIKB 1SHFA 3PE0A 4GDKA 2KZRA 3JVZX 2D8JA 2WWEA 3DOWA 4HLEA 3I35A 4W9JA 3W1SC 5L95C 5G55A 4OMPA 4M0WB 4CHKA 4MJSB 2ROTA 2HEQA 4RMAA 1UJ0A 3VUXA 1WE6A 1E7VA 2JTEA 1V86A 3A1QA 3SU8X 2EYXA 4N9F4 1ARKA 1WJUA 3FOGA 2K3BA 1N5ZA 2EPDA 3NZSA 3JSVA 2N1VA 3IBEA 1JU5C 3A9JA 4YL8A 2KXCA 4RM9A 4HCNB 2L0FA 2DF6A 2UWQA 1V1CA 4MSQB 1ZW7A 2KC2A 1G6JA 1P1AA 2MP2B 1IYFA 1EUVB 3N3KB 3VTVA 1D3ZA 1AVZC 2JF5A 4M8MA 4W9CA 4J9FA 4NQLB 1RRBA 3GZNI 3MTNB 1AWJA 2D3GA 4G0NB 4HK2A 3VXWA 2N7DA 4ANWA 1EFNA 3CQTA 2CZOA 1M27C 1BBZA 3ZNHB 1XQQA 2CUDA 2GBRA 2FPFA 2C60A 5GMVA 2QHOA 3VS0A 3TIXA 3A98A 2KFJA 2KDEB 5CHVC 2BKFA 4J9EA 1GCQA 4IWOA 4IUMB 3U30A 2D07B 2RQWA 2D0NA 2BZYA 3NZUA 2F2VA 2AKKA 2KOXA 3VRZA 3NOBA 3M0UA 2C7MB 2J06A 3IVFA 2GBQA 4GIVA 2K1FA 3AULA 2LGDA 3DPDA 1GC6A 1T0JA 2EMSA 3L16A 1UUEA 4FJYA 4HWIB 1TZ1A 2DBMA 5J18A 2Z0DB 1I35A 3PT2B 2W10A 3KUDB 3A4RA 4OMOA 4K81A 1WGRA 4BBNC 2HSPA 5E6PA 4AP4C 3H7PB 1GBQA 2KN5A 3TCAA 4W9LA 2IO0B 3U8ZA 1JXOA 2LNHB 3EFUA 2KO3A 2O31A 2FRWA 2K9GA 2YPSA 2YLMA 2DYOA 2AKLA 4I6NB 3QAQA 2V6VA 3B08A 3ZW3A 2IO3B 2VRRB 2AK5A 4OVVA 3EGUA 5CX3A 1X1MA 2BTTA 1OCUA 4BGJA 1RLFA 1EF1A 3ZUNA 2ZVOA 3QC8B 3VFKA 3UA6A 3UINB 1HJDA 2MCNB 2OJRA 2BKRB 2DRMA 3CSTA 2JWZA 2O2VB 4FJVB 1AWXA 4KSKC 3X0WA 1B3QA 4HXJA 2KFKB 3HM6X 2C0TA 4A20A 3IFWB 1G83A 3QWYA 1QWEA 4AFUC 2GBNA 4WWOA 4MSMB 2G4DB 2PZ1A 4F1SA 3KFVA 1H8CA 2Y5BB 4ZDVA 4CC7A 4OMMA 1XT9B 2LVQA 3W1YA 3DVNU 2I4KA 3LH5A 4FJZA 1UHCA 1RLPC 3TSWA 4CC2A 2JM8A 2YUPA 1WXMA 2AEHA 2BYFA 4HVUA 2KHWB 1J8CA 1K8RB 3VAWA 4ANVA 1NBFC 1G2BA 4Y92A 3M0QA 1YIWA 2JZ3B 3VTUA 4MGZE 1KOTA 1SPKA 2DHZA 2Z0EB 2MOXA 2GNCA 2ZCBA 4GMVA 4HDQA 4XX5A 1E8XA 1UGVA 2FPEA 3H1UA 4WJQA 4II2B 4CO7A 2HCKA 3P0CA 3B1LX 3REAB 1GG3A 5AZHA 4WWPA 4MGYE 2CHXA 3A9KB 1TBEA 2KXJA 2ECZA 2O9VA 3VS5A 2LGYA 3ZNGC 1WJ4A 4IG7B 1T3SA 1AZEA 1WYXA 2EKHA 2JXXA 2VVKA 4WCIA 1Q1OA 2CR5A 3BY4B 3WAPA 1K76A 3ZTDA 5EC7A 4NJ7A 3QQ8B 3ZRFA 3T8MA 4F8CB 1GNUA 2A08A 4FA6A 5DPWA 1BT0A 1OEBA 2RN8A 2JS2A 1R4NI 3PREA 2NVUI 2O6VD 1NI2A 3RNJA 5JH5C 2UYZB 2LP5A 2JXBA 4DBGA 1K4US 3R7QA 3KYDD 2EW3A 3VH4B 2PTKA 2KTRB 1UBIA 2I1JA 3NHEB 2DZMA 4HPLB 3S2AA 3LDZE 1K0SA 1WXUA 2KDIA 4MEMA 1CSKA 2EVRA 1WF9A 2AWTA 4MGKE 1QCFA 2K39A 2BZ8A 2DL7A 3GBQA 3RZWC 2JT4B 2DL8A 4BOSC 1H4RA 2MLBA 2BZXA 1V2YA 2D1XA 1UELA 3ML9A 2ZCCA 2BWFA 2KQSA 4HCKA 2MIOA 2SEMA 1SEMA 2W0ZA 2KWCA 2EGAA 4Z8AA 1WGHA 2L7RA 2LQNA 4LN2A 4URKA 2L3QA 2GBKA 2BPSA 1X2KA 2L0AA 1ABQA 2ED0A 2DVJA 2K6DA 2KVRA 4NQKE 4ASWC 2KE9A 3HPBA 2HD5B 3MHSD 1BB9A 2LQWA 2EMTA 3PTFC 2NR2A 4GLMA 2V1YA 3UQBA 1KM7A 1PWTA 2RQVA 2PE6B 1KMDA 1PRLC 2DX5B 2KLGA 1X43A 3P2BA 4GSWA 2D10A 2LCSA 4FHKA 1XTNA 4MELA 3WAMA 4IIOA 2DL5A 1LM8B 3RD2A 2EGCA 2KJRA 2XMFA 2FAZA 3NGPA 1YQBA 1Z9QA 1WR1A 5FWCA 2GTOA 2KRSA 5DCNA 1WDXA 1WR6E 3DVGY 3FJ5A 2IO2B 4AUQC 4RTXA 3DDCB 2MA9B 1ZUKA 1AD5A 1QZEA 2C0IA 1FYNA 4JQWC 4BBNF 1KJTA 3EG3A 3OJ3A 2KX3A 2X3WD 3WIMA 1WXAA 2ETTA 2JS0A 4R0KA 3V60A 3V6CB 1Y8RC 1ZBJA 4KZCA 1IPGA 1YX5B 2M4NA 3H0HA 1BU1A 1OEYA 4IKBB 3PSEB 3HHMA 1PQSA 3PPAA 2KANA 1C1YB 2M51A 3CF6E 2IY1B 2DAJA 4P2JA 4GDKB 2KEAA 4A3OA 5ECAA 2CHWA 1F9JA 4ESRA 1ABOA 4J9DA 4GOCA 3Q3FA 2DM1A 3PHXB 4HASA 4DHJB 4EZKA 4FBJB 2RAIA 1J19A 3SHWA 2KMCA 3DVGX 3A1QB 2RPNA 1LFDA 5KHOA 4ANXA 1Y0MA 4GDLA 2G6FX 3I3TB 4TKNA 5LLIA 2RGFA 2O6VA 4J9BA 2DJQA 2EBPA 1YP5A 3A9JB 4E74A 2RR9A 4EUTA 4KIKA 5C23A 1WMHA 4RTYA 1E90A 3I9QA 2IO1B 4G11A 1TTNA 2ZZPB 2KT8A 4LCDE 2N9XA 3RT3B 1WY8A 1XOVA 4KSLC 2J7IA 2OOBB 4J9GA 5IH2A 3R7RA 1WE7A 1E6GA 1UG1A 1SRLA 3C0RB 1SSHA 1WX9A 2LD9A 1V9JA 3K9OB 1XD3B 3REBB 3RYTA 1UDLA 5CTRC 1JQQA 4FADA 2N9EB 4B9KA 5TR5A 4AJWA 2KXDA 2CDTA 2M0XA 2OI3A 3VQIA 4FSSA 1TUCA 2L3ZA 1ZGUB 3VHTC 1ZUUA 1RI9A 2YUQA 1Q0WB 2XK5A 4JJDA 4HDOA 2LZ6A 2DL4A 2MP2A 2RNAA 1NLPC 3RUIB 1AZGB 3L08A 2LX7A 1V5OA 4W9FA 1WA7A 1A0NB 4EZJA 3CMMB 3UIPB 3VS3A 1Z2MA 2AYOB 3I5SA 4KDIC 1KJWA 2YT6A 4D8DA 3T9LA 5E6NA 3WALA 5L23A 4E3CA 3MJWA 1E5WA 5IXBA 2EYZA 3R6NA 2ZJDA 3O65B 1ZKHA 2EKEC 3NS8A 1EF5A 2RQUA 1W70A 4RTVA 2K8CA 1WX6A 3IHPC 4AFQC 3PVLA 2A5UA 3UA7A 3M63B 1KQ6A 3TVTA 1V5TA 4ZRJA 3EHRA 3DCGA 1VCBA 1FXTB 2PE9A 3VDZA 2FRYA 4AG1C 1OQYA 2OAWA 4EIKA 3NPFA 1OV3A 1WXTA 1VD2A 1X69A 2O88A 5JHAA 4NY0A 4KDLB 4HVWA 2KJHB 4G50A 2LJ5A 1WI0A 4IWPA 3RZFA 3M0PA 4ICUA 3KYCD 3WA0A 1WZ3A 1YX6B 2KD0A 1I42A 2CREA 1CMXB 1EO6A 5AZGA 2BWES 2KR3A 1E7OA 2DX1A 1NLOC 4ZRKA 1TGZB 4BFRA 1P9DU 1H6HA 2L2PA 2J0MA 4G3XB 3DQVA 3VUWA 1XTEA 2DLPA 1LQBA 1WGYA 1U3OA 4LUEA 1VA7A 1OTRB 4FN2A 2L00B 2NUZA 2C7NB 2Z59B 1GBRA 1M3AA 4JLCA 4NNJB 3C0CA 3KW5B 1JEGA 4EOYA 2MCNA 2B86A 2PPHA 2FUHB 3M0SA 4QT7A 4ICVA 1T0HA 3APDA 2LXAA 5D94A 2KLCA 2KFKA 3DBSA 1I07A 2RAJA 2G45B 1M94A 3APCA 2LJ1A 2KBTA 2V1QA 4GBQA 2XBBC 4RM8A 2ZNVC 5HKHA 1WIEA 3QCAA 2RQRA 3L13A 4DEXA 2EQIA 1FMKA 2EGEA 2KJ6A 2NBUA 4WWNA 4BKSD 2AR5A 2H8HA 4GB9A 2C5LC 3QWZB 5CHFA 2E5KA 1H3HA 2RAKA 5C1ZA 1UJYA 2NS5A 2L05A 4F14A 4M8NA 4AOFA 1K9AA 2X3XD 3DBHI 3PRMB 1GCQC 3H41A 3AU5A 5JHBA 2M1MA 4CYEA 4BVUC 2HDAA 2B3AA 2HBWA 3VUYA 2N7EA 2FNJB 3BINA 2L3PA 1MG8A 2A4ZA 1WXSA 3RCZA 4ZYNA 3A9KA 1GJZA 2DNUA 1UBQA 3QK0A 2MBOA 3LUIA 2KRNA 4A63B 4RTWA 2M0YA 1U06A 2DL3A 2KNBA 2KDFB 3VVWB 2BF8B 1A5RA 2JUOA 2J6OA 2DMOA 3PVQA 1WZ0A 2HE7A 2CS4A 1WJ6A 5FW9A 2CH4A 3EHVA 3QARA 3VS2A 1P3QU 2L73A 4PS7A 1PKTA 3OAWA 4EKUA 1H92A 2EYYA 1GFDA 1KSWA 2LGXA 4KRTA 1WJNA 2K8BA 2AL3A 3ALBA 1NG2A 1WLPB 2KYBA 4ORZA 5IHNA 3KH0A 1WRDB 2FCSA 1YWPA 2KTRA 4RUGA 4NJ6A 5L83A 1L2NA 2CSKA 1IP9A 1YD8U 2IIMA 3SDLC 4K7WA 4AJYB 3ONSA 4OMQA 1V81A 5D6JB 2GMIC 2KRMA 4KVGB 2KC1A 4IIMA 2K2MA 4GN1A 4PS3A 2CH4W 3H0FA 3ZVVA 2J6FA 4IWQA 4ON3A 1AOJA 2ASQA 5IHIA 4AKVA 4GU2A 4LJPB 1JXMA 1SGHA 2JY6A 1KIKA 2KMAA 2KDBA 3DBRI 1ISNA 3KUCB 2MBQA 2G4SA 2VWFA 2ZPYA 1GD5A 5JZEB 4IC7B 2L76A 3AXCA 2DZIA 2GGRA 2MBEA 2KWVB 3Q3JA 5EDSA 2CU1A 4B95A 2M17A 2JMAA 1U5SA 3EG2A 4IW0A 4WJOA 2JM9A 3K9PB 3VS7A
chains in the Genus database with same CATH superfamily
1HZ5A 5LXIB 1TYGB 2I2YA 3JV3A 3TMPB 2LVPA 3AE3B 1UGMA 1ZXHA 2GF7A 3ULRB 5I22A 4C7YA 3FJPA 5G2NA 1D1BA 2C06A 2DD5A 3FAHA 3IAS1 4UC4A 4KUIA 3CCSQ 2BQQA 2IWLX 2RD0A 1M90U 2GLSA 1R0CB 1D5MC 1UF0A 3OMCA 4LTUA 1NEBA 2GQIA 2F5KA 2GBJA 2LT4A 2GTJA 3WANA 2BT6A 4JIOU 2MWOA 1L4DB 1YI2Q 3VH3B 3OYYA 1K0XA 4JJCA 2JX5A 3ZL7C 1E6HA 4D6WA 1YHQA 2C0OA 1BIBA 1K9MC 1ZOYB 4K3BA 4E71A 4JGHB 2R2QA 2G1EA 3WXMB 1NJIC 3RMKC 1S1NA 4M75D 4OGEA 3RNGC 3ZIMA 4ANUA 4HKQA 1WNLA 4OMLA 2CP2A 3Q14C 1XF5L 5HI1A 2J05A 4II3B 2F5TX 3EG9A 3GS2A 1WYWB 5GAN6 5GAN8 4XDDA 3URGA 2AZVA 3JW0X 3N30A 4GGQA 3VRYA 4OVUA 2RD1A 1OPKA 4M4ZA 3ZLZA 1K1ZA 4JZ3A 4D8KA 4NAWA 1UFFA 4M7DB 1ZSGA 1N9RA 4C92A 1TS4A 4DWFA 3H6NA 3M58A 1VLBA 3VS1A 4KZ0A 4DDGD 2YSQA 2VASA 4BKSA 4M01A 1WJQA 2NPTA 1Q86C 2YRVA 3N1ZC 2CSIA 3SHQA 4RTUA 1NZ9A 4JPSA 4AWJA 3HVDA 3ZRCA 4KT0E 2REAA 1L6UA 2FPDA 3RMSA 3QUIA 2WXJA 5LXHA 5AZFA 1K51A 1QW1A 1N8RU 2WHIA 1QVFS 3QHTA 1OQKA 1KTKA 4K7UA 3OYBA 2ATCB 1VQMA 2KGTA 4M78E 1X6BA 3A33B 4M02A 4WQMA 5D6XA 3PS6A 3QX1A 3AI5A 5IHKA 2K79A 1SSFA 4TSSA 1TSFA 2QILA 3HK0A 1X27A 3CPWA 2L8JA 4GDLB 5L8RE 4YSYB 5IKCM 4M7DF 1ZQ1A 4ZN1A 5FWBA 1K53A 2L3RA 3M4YA 5GAN5 1WYGA 1YCSB 1ZLMA 2P4RA 1XLNA 3R3MA 2SAKA 2J42A 1JMLA 4AFZC 4M7AC 2YEPB 3RNBC 4KKIA 2X4YA 1WWTA 1MG4A 3QKJA 1FRDA 1MHXA 2MWSB 4DHZB 3HPCX 3L42A 4DK5A 4XU0A 5M9OA 2YUOA 2YWWA 1WMHB 2WS3B 4ZRIA 3CCUA 1IRXA 1YJ1A 1WGDA 3OB9A 1KRHA 1SG5A 3TEXA 1O9SA 3JSVB 3QYHB 1T3QA 4JE3B 3R8BA 1D09B 2V3SA 1ZDXA 3R2TA 2XHCA 4W9KA 2JWUA 2WSFE 2R2OA 4WJNA 1ZUYA 5GAOl 4BE0A 1HSQA 2LASA 2J7QB 4XYCA 3LH0A 3THKA 3DVNV 3CCEQ 3J7AF 3A8LB 1A70A 2JOYA 1DJ7B 4RGOS 2PLPA 1GUAB 3RR6A 1X2QA 3PIPA 2BYVE 2ZNVB 2KKCA 4W9HA 2V14A 2GOWA 3G71T 2YEPF 3A4SC 3QDRB 4IM0A 1GCPA 2CT3A 1L4ZB 1YJ9T 3ZNID 1Q81R 2QMTA 3JB9I 2QJLA 1SJHD 4TV3A 3W5UB 1Z9ZA 2V1RA 4M0WA 2KX0A 3AHUA 3LJ3A 4MDKE 4MJSA 2K25A 1WI7A 1VQNA 2MJEA 1NBEB 2JRHA 2FZGB 1WH3A 2E3IA 1XLQA 4YTPB 5IXFA 2RHYA 5CKHA 1K8AU 4A3PA 2K9XA 3NJTA 5IOIA 1S3SG 4OXWA 3VV0A 1YIJA 1M3CA 4X1VA 2NUTB 4X9DA 4TUUA 1W1FA 1ZA2B 4AFSC 1S1QB 2NYSA 1ZPSA 3DKMA 4QW2A 1ZSZC 4RCCA 2KACA 4MM3A 1QCNA 3Q8FA 1QVFP 1E8WA 1AEYA 3B2FA 5G5GA 1W2BS 1YN8A 3CCMT 3UIOB 2CJNA 2XK5B 3KVFB 4PK4A 3CC4Q 2RPQA 2CT4A 1OQRA 4FT4A 2LZ6B 3OYNA 1AWWA 4EZLA 1U4AA 3OYMA 2F2XA 3RNAC 3OJ4B 2AT1B 1BKBA 5IN1A 5GAOp 1QLYA 4AG2C 4W9IA 3L54A 2JZPA 4QQGA 3CCVA 1W4SA 1YN3A 4C56C 3I56Q 1GC7A 3WVDB 1X6OA 1CJEA 1V6EA 4MH8A 4Z89A 1IO6A 4DHZE 1Y71A 2PVOB 3I9V1 1MMAA 1GAQB 2ON8A 2W9NA 2BE9B 5KYXB 4XTZA 3CCMQ 4YSXB 1WX8A 1YHQQ 3NVWA 5D2MB 2GI9A 3LB8C 2E70A 4YXDB 2IPOB 3EA6A 1C3TA 1D3BA 1RLQC 1UB4A 1XXGA 1ZXIA 1HE8A 2BGFA 1VQKA 1UD7A 3H9DA 4C4VB 1F1BB 3CMEQ 2LJ0A 2YRCA 2M16A 5I21A 2R58A 3VUBA 1FFVA 2MF2A 2MRPA 1VUBA 3FB9A 2YDLA 4HCPB 3CEYA 3SEMA 1MVKA 2WXNA 3ECIA 5DPSA 4A53A 2OJ2A 2FB7A 3SWNC 2KQ7A 5KHQA 3JB9D 1QWFA 3QIJA 2K8HA 4LE9A 4HROA 4FIBA 2IBIB 5I11A 1B07A 5IAAC 2JMCA 4CC4B 2A28A 3ZJTA 4N4HA 4HCBA 2DZCA 2E1HA 3L0WB 4OB1B 4FULA 3UATA 3JCMJ 3C19A 1OGWA 4B9WA 2PUKB 2MX2A 2GFUA 2DA9A 2R61A 3BK2A 3EHQA 4FSXA 4LDTB 1XLPA 4LDVA 5HCKA 2DAFA 1RWSA 3ML8A 3IQLA 5KCHA 2ZPNA 2LGSA 3M0RA 4L23A 2EQUA 1K9MU 4US9A 1WHGA 1WXBA 3EH1A 4C8QD 1NJIU 2D11A 5GJVB 2A0FB 1JO8A 4PKCC 5LJ5g 1FNWA 4F16A 4XTXA 3APFA 1W2BP 2X9HA 2W82A 4P7IA 2REDA 3B9JA 3V62A 2LX9A 3GOEA 3SFDB 3LX7A 2YXYA 5GANj 4KBMB 5CKEA 2FIDA 4DXGA 4GXBA 4PYZA 3L10B 3ZKJC 4E7JA 2QQRA 4I6PA 3W5VB 3ZO5B 2R5MA 1FXIA 2LWPA 3PIOA 5A0GA 1QVGS 2A37A 4BKTA 2ED1A 3P4QB 3X25B 1MMNA 1V49A 2OTJA 4WJPA 2HJ8A 1MV0B 1Q86U 1OOTA 2JW4A 4J9HA 4M75A 4DQ2A 2FBWB 1V1PA 1PGBA 1WXVA 2O4XA 1NM7A 3UDCA 3PLUA 3EG0A 1I4PA 2INCC 2EQKA 4K11A 1YJJA 1N27A 1GFCA 4OMNA 4IUTA 2GBMA 1RABB 3BVZA 4PJNA 4C92C 2HTHA 3H7PA 3MHZA 4MH0E 2QAZA 4JS5A 2ZW0A 4BACA 3CIRB 4PJOG 4J7FA 3UF4A 3L2UA 5GAMj 3CMAA 4L6V5 3OS0A 4JLGA 1H8KA 3NTKA 2VKNA 5GMKj 2G3QB 4XZ4A 2VZKB 3WCQA 1OU8A 3TUOA 3J80E 4RGTA 4PJLA 4RH6A 4WQOB 2L1AA 1NYFA 2K57A 4RTTA 2AIRB 1MV3A 2IGGA 1VJKA 2WDTB 2QGGA 4HXDA 1U8RA 4DXAB 1UECA 2AZSA 2XU8A 1V80A 5IA7A 1UE9A 2AL6A 4WH4A 1M2VA 2RQTA 1VQNQ 4N58A 1WHKA 4ZTFA 2JVCA 3L17A 3VTWA 4L1BA 3VYGA 2GQVA 1SXTA 2DILA 3T3OA 3CPWS 2B8AA 2FG0A 2V26A 3L1AA 1SE9A 2EQJA 1RFAA 2ENMA 4J6IA 2KWUB 1LCKA 1EZZB 2RMOA 2VC8A 3JAME 1OEYJ 2AQ2B 2L0TA 1YIJQ 2FIFA 4ELYC 3QWXX 2PEAA 2D2QA 1O7KA 4AZ9A 1FXAA 2KK8A 5H8YE 1D1AA 1LPLA 4AQ7A 4QVCA 1SIFA 3V61A 3JYUA 4JZ4A 1JRUA 4BB7A 3CC2T 2YUNA 3D7SB 2MSED 3NZ3A 2QDLA 2EYWA 3U2SC 2KQWA 4NZLB 2PJHA 3OYAA 1OPLA 1SF0A 3QZ9B 4QVDA 2NWMA 4A4HA 2N1WA 3V6EB 1PRMC 3M0TA 4FM4B 3NMZC 4F7ZA 1SRMA 1CKAA 1ZDVA 2IY0B 3TJPA 3VJPA 1QOAA 1YN5A 2CHZA 4HVBA 4ZNXA 3CCQA 1Y57A 1UZXB 4LNPA 4XE0A 3AH7A 2E6NA 3PT9A 2DYMA 4LXCA 4JPBW 2O2VA 2D3BA 1QVGP 2O2OA 2N4FA 3VR8B 3BDUA 2E6XA 2BUDA 1VQPT 3IT6B 2PQWA 2EELA 1AWOA 4BD3A 1KLGD 1P98A 2KYWA 1M30A 3S3OA 1WM3A 1VYTA 2JTFA 3SD5A 1V8CA 4M78D 1X01A 1SIJA 1ZA1B 4KGSA 5CKFA 4Z02A 3G4SQ 1J3TA 1WIAA 3PGEA 3RUXA 1VQKQ 3CSFA 2JYTA 2XEWA 4W9DA 4IUPA 1UWMA 1R4MB 2PTLA 2OTLA 1KFYB 1VQ6A 5HHDG 3TBLD 3HIZA 2Q5WD 1N9SA 1YMHE 5BYSA 3NHNA 2B76B 4USAA 1FCLA 1B1ZA 3PV1A 2DRKA 4LD6A 3OMGA 1OCSA 2JNGA 3EGDA 3UT1A 3SDZA 1CK1A 1RAXA 2REXA 4B6WA 3QHSA 1UNSA 1YWOA 3BW1A 2E65A 4DOWA 4E7ZA 1CKBA 3ENEA 2E3HA 5E6OA 2C7HA 2WX0A 3HRDD 1PKSA 4MGIE 2MK5A 2SRCA 3PRZA 3LYIA 2HKQB 1JJ2A 4A55A 1X6GA 4PYUA 2EFIA 3GOXA 2K4YA 4JJBA 3CPWP 3V05A 4FYVB 3ABVB 1SHGA 2FYKA 3WAOA 4LNOA 3BWUD 2MBHA 1V29B 3AE5B 5CHWA 3ZNZB 1Z5SB 2INDC 1N60A 4RTZA 3VS6A 2WXQA 5FK9C 2WU2B 4DBQA 3TL5A 3OYIA 3AE9B 2LVOA 3M62B 3M56A 1RL2A 5D7UA 1VQLA 4HT9A 3OSSC 1WM2A 2RMMA 4B6MA 4QAYA 3CCLA 1UTIA 1VIFA 2F2WA 4M7AB 2OJWA 3AE6B 2MMPA 2M19A 2CUBA 2ZEQA 3MP9A 1KLVA 3ZDMC 3RBBB 4KV2A 2EYQA 2WDVB 2RHXA 4BAXA 4PZGA 3KUZA 1PNJA 1TY2A 5GJWB 2DYBA 5FRNA 2DE0X 3PHWB 5BMIA 1JRPA 4IM3A 2BBCA 2K7AA 1TKEA 4VUBA 4KUDK 5C3JB 3MP8A 5DPTA 3VU3C 2C9WB 3X24B 3AE4B 3CD6A 3U7ZA 4QQDA 3CCJA 2HD0A 2KNBB 3DLLA 3A8HB 3N32A 4A90A 1MPEA 4IKDA 3GNFB 2F69A 3AEBB 1TUDA 4M7AF 1IBXB 2DENB 2LXCA 1BI2A 4M77G 1B34A 1HD3A 1TWBA 1AYFA 3P1MA 3RULA 4HA8A 2MQJA 2KYMA 3W1SA 1ZX6A 5GANf 3R7QA 2HL3A 1Q5WB 1QKWA 4DHJD 2J0KA 2ZW1A 3U7DA 3MJXA 1E8YA 2MPXC 2MYSA 1ZE3D 4FLHA 4X57B 1WFYA 3X23A 3PZDA 2LMCA 1I0CA 3E19A 5DPRA 4S17A 5HY6A 1I4QA 4BKGA 3M5AA 1V97A 3GZNB 1WGKA 1F2RI 9ATCB 3B0AA 2A36A 1M3BA 1YJNT 5IO9A 2N9PC 2ZPGB 4ACFA 3IQ2A 4RKUE 1M90R 2K6QA 2M8SA 3R66C 2DXCA 3JB9G 1ZSZB 3EC8A 3OY9A 4HPMB 4E7KA 2ABLA 3EG1A 2WWZA 3PLVA 5CIUA 2BYEA 3ZTCA 5GANd 4F7UB 4J3OD 1KF6B 2I1KA 5J2RA 3QYGB 2MAMA 4J9IA 3M53A 1AARA 2CKHB 1QT9A 2LUEA 4ME7A 2RF0A 1VYUA 3I5RA 3MP1A 2KQ4X 2DTIA 1WX7A 4PS8A 3AU4A 4TVRA 4M75C 2ESWA 1AWDA 3PO0A 3ZDTA 2K6DB 4LUDA 1QKXA 1WQ7A 4C8QG 2O9SA 1MJDA 2EKIA 2FCNA 1KD1U 4PJJA 1Q7YC 3FLGA 1IUEA 1XNIA 1AT1B 3MO8A 1YNZA 1UHFA 5A0DA 1PM3A 5KYWB 1S72Q 2YVCA 2WSCE 2FEIA 3R6OA 4P5NA 1VQ4T 1BI3A 1VQ9T 2ZVNA 5IN7A 3MCAB 4WAAA 3CCQQ 1GRIA 2NBVB 2JZZA 1BK2A 1TG0A 5LJ3j 2MW5A 2X4XA 1GB1A 1E7UA 5GXGB 4W9GA 1D5XC 2RDBC 1FMVA 2MBBB 4F7UF 2LRWA 1E8ZA 1L7YA 1TKYA 4CC3A 2JT4A 2BTEA 2G9HD 3QA8A 2ROLA 2KMMA 4DQOC 3OYJA 3TU4K 1N8RR 3UF8A 5KYYA 5AT1B 1I4HA 2W55A 1SJED 3TSZA 2M02A 2K5IA 2NCNA 4NL2A 3FC3A 1KQ2A 3EH2A 4C0DC 1SSNA 5BO4B 1ACMB 2AQ3B 2TSSA 1VQ9Q 2KROA 4XTWA 5FR6A 3SWNB 1P0RA 3RFZB 3RIRA 3IG3A 2E4HA 1NYGA 4RCOA 1NEGA 4K1RB 1KH0A 3SEBA 5J17A 2D3AA 4Q5WA 3CCST 2M1HA 3HTRA 3AV8A 3UGBB 1VQ7A 2J6KA 1WFWA 2IVWA 2KTFA 3H0IA 2V4LA 3H7SA 1OQQA 1GL5A 1WHJA 4E6RA 1T0YA 2WXOA 3VS4A 2PVOD 1Y07A 5DY9A 2J0JA 1FFUA 4XC2A 2RHUA 1T3LA 2CSQA 3GPLA 1I1JA 2FCMA 3DYTA 2EJGA 4EPCA 5LJ5d 1FMWA 2DEUA 2FCQA 4DDID 1M8MA 2ZPFB 4OB0B 3F70A 3AEGB 1W6XA 1NYRA 4XTUA 4WURA 1RAHB 1LXDA 3EGXA 1YJWT 3ZBDA 5AEKB 3LXFA 5BMGA 1LOJA 1VQLQ 5CO7A 4NPNA 3AEEB 4QVZA 4ZGJB 3FEOA 1MHNA 3ZJVA 1WGSA 4PL6A 1TTHB 4P1BC 4XWWA 1KFZA 4OVZA 2CP6A 1F0ZA 1QCOA 2IYDB 4KGXB 2WYQA 4P2IA 2KDSA 1YJ9A 3D32A 2LRUA 1RM6C 4C00A 2IZVB 4W9EA 3EG9B 3U23A 1NEKB 4TQ1A 4YWGG 3NVVA 3OLMD 1FIQA 4PJOD 3INZA 4EEWA 1MUZA 4PQOA 5FKAC 4NJCA 4L5GA 3DHIC 2WX1A 4I6LB 2ONQA 3AE8B 1UH6A 2DPPB 3ZYYX 4M78A 3E9GA 1IREB 4JRQA 3JCMW 4HJKA 3RESA 2D6FA 2PIAA 2X4WA 3QJZA 4NAWB 1Q82C 4C92B 2KT1A 1NDDA 1YJWQ 4JL9A 4J5YA 4LDTD 1QVGA 4AS1A 2AQ1B 1K8AR 2RI3A 2RSUA 2LQ8A 2DZKA 2NPTB 2L3SA 4YTNB 4BDZA 3EFRA 4K7SA 3OS2A 1DOYA 4KGRA 4Z88A 1J0GA 2QIEB 2XDPA 3NY5A 3X26B 3FC4A 2LMJA 4IUVA 3ZFJA 2DIGA 4J6WA 1U1SA 1D4BA 4M78G 2WDRB 3BIID 2LHEA 1JJ2S 2EWNA 2Y4YA 3VR9B 4N0AA 2PW9A 3IXSA 2D8HA 3EGRA 1FRRA 3TSSA 5KH6A 3PRPB 3GLXA 1VQ8T 4JWSC 4TQ0A 2JPHA 1WJSA 4RG2A 2SEBD 3V8LA 2JRIB 2DZJA 3DBLI 4PK1A 1JWMD 2K22A 4C92F 2I0NA 2PNIA 1GXIE 3I5JC 4IM2A 3HSBA 2Y90A 3ETRA 4JDSA 2RB6A 2RJDA 1M1KU 3H8HA 4PJMA 3PZ8A 3MEAA 5H92C 4FHJA 1YITT 3HM3A 4MACA 3M3JA 2I38A 1N63A 4IKGA 4BOZB 1VYVA 2DBKA 3UQAA 4ARIA 2FHDA 3EECA 2CKKA 5GAOn 4E7HA 1WGGA 4DEYA 3A8MB 3NG0A 1RUWA 1M8VA 1R4MI 1OYXA 1PHTA 3CCET 2MJDA 4IKBA 2LI5A 3E9FA 2DAQA 1PD0A 1VZ6A 2NBWB 2O6VB 4J9CA 5D7GA 2LJ3A 1VQ8Q 4HVVA 4EFOA 2FO0A 2XKOC 3O5ZA 3L4PA 2EIFA 2VUBA 2VZKD 1ROEA 5CQXA 4F17A 2Y5CA 4LJOB 4KIKB 1SHFA 3PE0A 4X9CA 1VQOA 4GDKA 1YQ4B 3HRTA 2KZRA 4DOVA 1JROA 3UPUA 3JVZX 4EDUA 1YITQ 2D8JA 4MT5A 2WWEA 1XQHA 3DOWA 3I35A 4W9JA 4HLEA 4OB3B 5A0LA 3W1SC 1R7SA 5L95C 1C79A 2D0QB 5G55A 4OMPA 2RM4A 1BXTA 1WXQA 4PT5A 3H6ZA 4M0WB 4PFOA 3T3NA 4CHKA 4MJSB 3L2VA 4P16A 2K3UA 1WQWA 2ROTA 2HEQA 3C4SA 4RMAA 2A7YA 2CP3A 1UJ0A 4OZBA 3VUXA 3MKDA 1AHJB 2ZPIB 1RAAB 1WE6A 5IP4D 4DBHA 3CC4T 1E7VA 4BE2A 1K9MR 2JTEA 1PCXA 2HQEA 1V86A 2ICIA 3A1QA 2LEKA 1D0YA 1NJIR 3BY7A 4M7DE 3SU8X 2EYXA 4N9F4 4MM3B 2L89A 1ARKA 1WJUA 3QBYA 4IKFA 1HXYD 3FOGA 1JJ2P 3QPHA 5GAN2 1VZ8A 1Q7YU 2K3BA 2R57A 4C80A 1N5ZA 2L5QA 3P8BB 3L2RA 2DBYA 5EE1A 2EPDA 3NZSA 3I56T 1HEZE 1OFFA 3I55Q 5KCOA 3RERA 2N1VA 3JSVA 2BB6A 3CBOA 3IBEA 3DBHB 3DB3A 1JU5C 2N9KA 4JUVA 2G3RA 3A9JA 2DZ9A 2ZGWA 5LJ5e 4YL8A 2KXCA 3E9SA 4HCNB 4C0GA 2L0FA 4RM9A 1FMAD 2INNE 5E6JA 5KE3A 3OS5A 4X34A 3JCMg 1SB3C 2X8XX 1Q86R 2DF6A 1YHQT 2UWQA 4ZOHC 1OZ2A 1EX4A 1V1CA 4MSQB 1R77A 1ZW7A 2KC2A 3QJYA 5GANg 1G6JA 1P1AA 2MP2B 3CWIA 1N5XA 1IYFA 1EUVB 3CMET 3HFNA 1WHMA 3N3KB 3VTVA 2DJZA 1F77A 3NS1A 1IHWA 1D3ZA 1EWCA 1AVZC 3JB9H 1KQ1A 1R4NB 4D2KA 2AHJB 1TJEA 2JF5A 3PMTA 1IHVA 5J26A 4M8MA 4J9FA 4W9CA 4NQLB 1RRBA 3GZNI 3MTNB 1AWJA 5CCAA 4IUUA 2D3GA 4G0NB 4HK2A 3VXWA 2N7DA 2RPVA 2DO3A 4ANWA 5J39A 1EFNA 2E64A 3CQTA 1M27C 1BBZA 4M77D 2CZOA 2PMVA 3ZNHB 3LGLA 2QA4A 1XQQA 2N9LA 2CUDA 2GBRA 3AN1A 2FPFA 3SR6A 3GP8A 5D6YA 2C60A 2JZ2A 5GMVA 2QHOA 5GAMg 3VS0A 1KC8C 1MNEA 3A98A 5IAYA 5FROA 2KDEB 2VXEA 1VQMT 2KFJA 3DHHC 3AMZA 1JRIA 3O8VA 5CHVC 2BKFA 5KYUA 4J9EA 1GCQA 4HKZE 2RJCA 4IWOA 4IUMB 3U30A 2L83A 1BMLC 3URYA 4PNOA 1VDVA 2D07B 2RQWA 2D0NA 4OGCA 3BK1A 4BI3A 3CC2A 2BZYA 3NZUA 2F2VA 2KY9A 2AKKA 2V8JA 4LDXA 2KOXA 3ER0A 3VRZA 3Q8BA 3M59A 3MC8A 3NOBA 4HEA1 1BI0A 3M0UA 4ZGDB 1CZPA 2C7MB 1WPYA 2J06A 3IVFA 1UGQB 2I2LA 2GBQA 2K1FA 2MJ3A 4GIVA 4LLGM 3AULA 2LGDA 2QASA 1MFWA 2P0QA 1HZ6A 3DPDA 1GC6A 1T0JA 1M5Q1 1VQMQ 2EMSA 3L16A 1UUEA 2JJ9A 4FJYA 5GMKl 1KQSA 3QZ5B 1NE8A 4N6EB 4HWIB 1TZ1A 1Q82U 1YBYA 2X38A 2DBMA 5J18A 2Z0DB 1I35A 3PT2B 3MC9A 2W10A 4M75B 3KUDB 3A4RA 1V76A 5LJ5h 4OMOA 2NMQA 3OWEB 4K81A 1WGRA 1SE3A 1XCQL 4BBNC 4LNFA 1WZOA 2HSPA 5E6PA 1XJWB 4A54A 1QKZA 4PJOA 3PGGA 4AP4C 5GMKm 4MZPA 3H7PB 2M9UA 1GBQA 1RI0A 3LW5E 4JRPA 4E7IA 2KN5A 3TCAA 1VQOQ 2FUG1 3P4PB 4W9LA 5EE3A 3CCUQ 2LDMA 1VQNT 3HL8A 4KH0B 4HRSA 2NUPA 2DKGA 1JWSD 3V3XA 3J9CA 2IO0B 2UU7A 3X28B 2KT7A 1JXOA 3U8ZA 2LNHB 3EFUA 2KO3A 2O31A 2FRWA 2K9GA 4N0AC 2CYZB 4QKUA 1YIJT 4YSZB 4M75F 3Q3MC 2YPSA 1M2VB 2WLBA 2E6ZA 1C4CA 2YLMA 1TT5B 2DWQA 3BZDB 2DYOA 3A8OB 1LGRA 2IPKD 2AKLA 4I6NB 2QXFA 3QAQA 3PZ7A 2V6VA 2CP0A 1QOBA 3Q6BA 2BS3B 1IB8A 3JCMP 3QJ6A 1HA5A 1JWAD 1K73C 4BY6C 3B08A 3LWHA 2V9HA 3ZW3A 4E2FB 3CC7A 2IO3B 2QGFB 1RYJA 2VRRB 2AK5A 3KQ4A 4IOIE 3FDRA 4MDXA 1E6EB 1Q95G 2WXHA 1IXDA 4XU2A 1D5ZC 4OVVA 3EGUA 2QQSA 5CX3A 1VQ5A 1X1MA 2BTTA 2CS7A 3AEDB 1OCUA 3G6EA 3CCRA 4BGJA 1B7TA 1PSFA 2HKNA 1RLFA 1EF1A 1FXXA 3ZUNA 5CKDA 1Y56A 2ZVOA 5HK3A 3QC8B 3VFKA 3UA6A 4LNKA 3UINB 1HJDA 2VB6A 2OHFA 3TEWA 1Y96B 4JJNK 2MCNB 1YFNA 5MPOA 2VH1A 2X51A 5IT9E 2OJRA 2COYA 2BKRB 2DRMA 4NS5A 3G4ST 3CSTA 2JWZA 1VQKT 2J4XA 1AWXA 2O2VB 4FJVB 4KSKC 1B3QA 4HXJA 2KFKB 3HM6X 2LRQA 2C0TA 2QQBA 3QDFA 4H2AA 1NPRA 1Q10A 3IFWB 4A20A 1G83A 2QTXA 1E10A 2RA2A 3QWYA 1QWEA 2WXIA 2WXPA 4AFUC 3CCVQ 2DVEA 2GBNA 1TH7A 2LVMA 4WWOA 2H3JA 2RJEA 1QLBB 4MSMB 3OSVA 2YHTA 2G4DB 2PZ1A 3DWGC 4F1SA 2FZCB 3KFVA 2QC8A 2DD4A 1H8CA 2Y5BB 3OYDA 4ZDVA 1R8OB 4CC7A 1RAGB 4OMMA 4OVAA 1XT9B 2LVQA 3W1YA 3PFSA 2ZPBB 4NL3A 3DVNU 2I4KA 3N20C 3LH5A 2WSEE 2DNFA 1UHCA 4FJZA 2QA4Q 1RLPC 3TSWA 1YJNA 2BIVA 3DLMA 2DXUA 2K3YA 3EGDB 3M57A 1M1GA 4J7IA 3RDVA 3RMQA 1X75C 2JM8A 4CC2A 4EMGA 2YUPA 1WXMA 5FR3A 2AEHA 2BYFA 4HVUA 2KHWB 1J8CA 2HMAA 3TQ7P 1K8RB 3I63C 3VAWA 4ANVA 1NBFC 2J53A 3BFMA 3DB4A 1G2BA 2BS2B 3NUHB 2DFUA 1QP3A 4Y92A 2EJFA 3M0QA 4L59A 1YIWA 2JZ3B 3VTUA 4Y28E 4E7SA 4MGZE 1KOTA 4OZCA 2QK0A 4S0RA 3TCJA 4C0FA 1SPKA 3W2DA 3C95A 1WHLA 2DHZA 3DWMA 3HHTB 1NI3A 2Z0EB 2MOXA 2GNCA 2ZCBA 1D1CA 5GAN3 4GMVA 4HDQA 5FU6C 3RN9C 1KD1R 2HTME 4ANJA 1L5PA 4ARCA 4XX5A 1E8XA 4DXFA 3N1YC 2QEXA 1UGVA 2FPEA 2XD0A 1FWZA 2M0AA 3QSUA 3H1UA 4OZAA 4WJQA 3CBPA 4HCCA 2D3CA 3EAEA 1XTDA 3U52E 2ZPHB 4JRKA 1AN8A 4II2B 4CO7A 1H641 2HCKA 3OYLA 2JVVA 3QXEB 3P0CA 1KC8U 3B1LX 2VGMA 3REAB 1GG3A 5AZHA 1XLOA 3META 4WWPA 1L0XB 4BE1A 2BVCA 4MGYE 2CHXA 3GIBA 3A9KB 1VRAB 2BYTA 4ITKA 1TBEA 2KXJA 1BCMA 1YNTE 2XIDA 2ECZA 1P92A 1MMGA 2O9VA 4M77A 5LJ3g 4M7DD 2WXGA 4WAFA 3VS5A 1UUPA 4RF0A 2RHIA 3OW2S 1JQ4A 2GFAA 2LGYA 3ZNGC 1OULA 1WJ4A 2CU3A 2QQAA 3TEEA 2OTJQ 3FILB 5CKBA 4IG7B 1T3SA 1AZEA 3OBWA 1WYXA 2EKHA 2QCZA 2JXXA 2VVKA 4WCIA 4PFPA 2X35A 1Q1OA 2YLCA 2CR5A 3BY4B 1M4ZA 1K76A 3WAPA 1QMCA 3HPWA 5EC7A 5CAIA 3ZTDA 4NJ7A 1FX7A 3JCMf 3QQ8B 1VOMA 4EMKA 1YI2A 2CZ7B 4KX6B 3ZRFA 1B9RA 4N4IA 2MEKA 3T8MA 3P8HA 4R56A 4F8CB 3CMAQ 3CXCA 1F2RC 1GNUA 2WP9B 4MMKA 2A08A 4FA6A 2YLBA 5DPWA 4LNNA 1BT0A 3TREA 4C5GA 1OEBA 4OW0A 2RN8A 4XK8E 2JS2A 1R4NI 1T0RC 3PREA 2NVUI 3RNEC 2O6VD 4XQ3A 1NI2A 3RNJA 1KQSS 1LJOA 5JH5C 1ENFA 4AT1B 3JB9F 1PFDA 1QP2A 4ZN3A 1L0YB 2UYZB 3EFSA 2HAXA 3W9CB 3NVZA 2LP5A 1S72T 4RG8A 2JXBA 4DBGA 1VQ5Q 3L2ZA 4C8QA 3CCQT 1K4US 3G6EQ 3JCMd 1QQRA 3KYDD 3OYCA 4M7AG 2EW3A 3J81E 1BIAA 2N7JA 4XGAB 3VH4B 3C12A 2PTKA 2KTRB 3V7SA 3JRZA 1UBIA 2I1JA 3NHEB 5GAMf 2DZMA 4HPLB 3S2AA 1IBXA 1L6VA 4PJOC 3OYGA 1GB4A 5EG2A 5GAOq 1N61A 3LDZE 1K0SA 1WXUA 3Q1JA 5J3BA 3A1PA 4C7ZA 1RAEB 2EJ9A 4OF1A 1HTOA 2KDIA 2H89B 4MEMA 1CSKA 2EVRA 3PMIA 2BE7D 2ZZDA 4M7AE 1SE2A 1WF9A 2OAUA 2YRDA 2AWTA 2AX5A 4MGKE 2MI6A 1QCFA 1TS3A 1QILA 2K39A 2BZ8A 2DL7A 3GBQA 1N5WA 3RZWC 4YTMB 2OTLT 2JT4B 1VQ6T 2DL8A 1FD6A 3GE3C 4C5IA 2WXMA 4BOSC 1H4RA 1YQ3B 2MLBA 1K73U 2BZXA 4KH1B 2LCCA 3G7ZA 1V2YA 4C5HA 2F1LA 1UGRB 1F52A 3U4EG 2D9TA 2D1XA 1UELA 5KYYB 2ZCCA 1DOIA 3ML9A 1WHHA 3NFCA 2DXTA 3EFOA 1HTQA 2BWFA 1ACCA 3OW2P 2KQSA 2E41A 1V1OA 5GAMd 4HCKA 3MPUB 2MIOA 2SEMA 3NVYA 1SEMA 2VH2A 2W0ZA 4QQ6A 1SKUB 2KWCA 2EGAA 4AMCA 5CQYA 5D3DA 8AT1B 4Z8AA 1QVPA 4KULA 2X4JA 3JCMX 1C4AA 1WGHA 2L7RA 2LHDA 2LQNA 3KBGA 4LN2A 2L3QA 1PYWD 4URKA 4XU3A 2GBKA 1M1KR 1LO5D 4FYXB 5D6WA 3M54A 3ZXVA 2OTLQ 2QDYB 1VQ6Q 3ZJUA 5JXVA 2E5QA 2BPSA 3VUZA 3GNGA 1X2KA 2L0AA 4OHJA 1ABQA 2ED0A 2DVJA 2K6DA 2KVRA 2WXRA 4NQKE 4ASWC 1RADB 2KE9A 2D5GA 1TS9A 1VQLT 3CCEA 1FCCC 5I2SA 3HPBA 2HNIA 2HD5B 3MHSD 4V2SA 1BB9A 2LQWA 2EMTA 3TIXA 2E3TA 4F7UG 4KGVB 1K50A 3EGXB 3OBYA 3Q3NC 2ZAEA 1OI1A 1KQSP 1E0ZA 1RAIB 3MJ5A 3PTFC 1MI0A 2HZYA 4GLMA 2NR2A 2V1YA 3UQBA 1KM7A 1PWTA 2RQVA 4A4GA 3LWIA 1TU0B 2KMTA 1M4VA 4HPPA 2QEXQ 2PE6B 1KMDA 1FNUA 4O5VA 4US8A 4BUGA 4F7UE 1PRLC 4JLIA 5TSSA 2R5AA 4FYWB 2DX5B 2KDMA 1N62A 2KLGA 1X43A 3Q2AC 3HFOA 3P2BA 4GSWA 1NENB 4PLIA 2LCSA 2D10A 2LFIA 4FHKA 1XTNA 4RNAA 3CCLQ 2VV5A 4MELA 3WAMA 4IIOA 1XCTL 2DL5A 1LM8B 3G71A 2PKOA 1J7CA 1G3TA 3RD2A 5CK9A 3BYTB 2EGCA 1HYOA 3RKYA 2KJRA 4WF2A 5HG2A 1C1AA 2XMFA 3NGPA 2FAZA 1YQBA 1Z9QA 1PDXA 1WR1A 5FWCA 2GTOA 2KRSA 2NTTA 1WDXA 5DCNA 1WR6E 3DVGY 3FJ5A 5EE0A 2IO2B 4AUQC 2INPE 5KYNA 4RTXA 3ME9A 1F1HA 2E10A 3DDCB 3A5ZB 2QG9B 2MA9B 3GP7A 1ZUKA 1Q7YR 1AD5A 4TMAB 5I2MA 2DIQA 2XI9A 2Z0WA 3I56A 3CD6Q 3RI7C 3CCJQ 2MH7A 3FRNA 1QZEA 2HDEA 2C0IA 1FYNA 4JQWC 5CVIA 4BBNF 4M78F 1G3YA 1ZHIA 1KJTA 3EG3A 3OYFA 3OJ3A 2KX3A 2X3WD 3CCMA 4M00A 3WIMA 3P42A 1WXAA 4ATOA 2K3XA 1Q81C 2JS0A 2ETTA 4R0KA 4BY6B 3V60A 3V6CB 1Y8RC 1ZBJA 2KWDA 4KZCA 2GB1A 4HKEA 1IPGA 4YTLA 1YX5B 2DTHA 1HXDA 3EFCA 2XDDA 3CMEA 2M56B 2M4NA 3V7CA 2Z8LA 3M4GA 3H0HA 5GAN4 3AM9A 1BU1A 5LL6S 1OEYA 3ZQ4A 2K2VA 1G8XA 1TUGB 4IKBB 3PSEB 3JCMe 3HHMA 1T0SC 1KHCA 1QQJA 3AE7B 4K3CA 2QYZA 2LUMA 1TZOA 1UGPB 2PVDB 5GANe 1PQSA 3PPAA 4B9XA 2KANA 2A3LA 1C1YB 2M51A 5FU7C 2Y5PA 3CF6E 1EU3A 2IY1B 2DAJA 3P4SB 4M77C 1FO4A 4P2JA 2H88B 4GDKB 4R55A 2KEAA 4A3OA 2HQXA 5ECAA 2CHWA 4M7DA 4ESRA 1F9JA 1ABOA 4J9DA 2RI5A 1WSPA 3VRAB 2JYEA 1LNXA 4GOCA 3X20B 3Q3FA 1C4PA 4C92G 3QO3A 3P63A 2CP7A 2DM1A 3S3MA 3PHXB 3N5BB 2RK2A 4HASA 1WRIA 3HKSA 4DHJB 4EMKC 4EZKA 1P7EA 3AE1B 4FBJB 1ZBXA 4ZYSA 5GAMe 2JU6X 2RAIA 1J19A 3SHWA 2KMCA 2DLBA 3DVGX 5GMKe 3CXCS 3A1QB 4RFBA 1C6VX 4KGZB 2RPNA 1ET6A 1LFDA 1OX9A 3V7RA 5KHOA 3MEWA 4M7DG 4MZTA 4RF1A 4C92E 3I55T 4YT0B 1VQ7T 4WIPA 3PNWC 2EKOA 1M1FA 1XO3A 4ZRQA 4ANXA 5HK0A 1Y0MA 1JWUD 2WNMA 3UWNA 2LTOA 2G6FX 4GDLA 3I3TB 3LGFA 1YOVB 5FLXE 4II1A 4TKNA 3AB5A 5LLIA 2LC4A 2PVGC 2RGFA 4NOYA 4J9BA 2O6VA 2DJQA 1MGQA 3E1SA 2IDYA 2EBPA 2RDGA 1Q82R 1YP5A 1ZP0B 3A9JB 3SD4A 4C8QC 3BYYB 3B2GA 4E74A 2LT1A 1UWXA 2RH2A 3SFMA 2RR9A 4KIKA 4EUTA 1IZ6A 5C23A 2KVZA 1WMHA 5LJ3f 4NAMA 4RTYA 3VKIA 1E90A 1FM0D 3JCMQ 5FU6B 2FZKB 3I9QA 1MNDA 4ZGEB 1M9SA 4BI4A 1VQ7Q 2IO1B 1TTNA 2ZZPB 4G11A 3NTHA 4R3DA 4EE2A 1I81A 2KT8A 1QOGA 4LCDE 2N9XA 4PLLA 1PGXA 2M0OA 1EU4A 3JB9J 3C8YA 3SB2A 4HJGE 2L8DA 1WJRA 3E56A 3RT3B 1BYMA 5GAOm 1WY8A 3GE8C 2XN9C 1XOVA 4KSLC 2LGIA 5T8IA 2CGHA 2J7IA 5GMKi 4OP0A 4ZTJA 2OOBB 4J9GA 5IH2A 1TS2A 2K0PA 3R7RA 2VGNA 1WE7A 1E6GA 1UG1A 4EMHA 1SRLA 1ESFA 1SEBD 2VYTA 3C0RB 4A9AA 3JCMh 1D6EC 5GAOr 2LJIA 3OS1A 3KWVA 4FXCA 4LNIA 1E9MA 1SSHA 1WX9A 1UEBA 5LJ3d 2LD9A 3NTIA 5GANh 2HSEB 1V9JA 1TKGA 1XD3B 3K9OB 1GPXA 3HP9A 3JCMV 3G71Q 3REBB 2CZ1B 3A8GB 1D3BB 3RYTA 1UDLA 5CTRC 1JQQA 1TXQA 3H8ZA 4OB2B 1YJ9Q 2N9EB 4FADA 1UGJA 1U1TA 4B9KA 3V8JA 2K5FA 5TR5A 1L0VB 4AJWA 2KXDA 2CDTA 2M0XA 1I4K1 2OI3A 3HRSA 1PSEA 4FSSA 5KYUB 1TUCA 1J7BA 2MHJA 3N9YC 2L3ZA 1ZGUB 2NUTA 3VHTC 3AEFB 2P4TA 1ZUUA 2V8IA 1RI9A 2PUOB 2YUQA 4IUQA 2QQ9A 1Q0WB 2K5PA 1HK9A 3CXCP 2XK5A 3RNFC 3OW2A 4JJDA 4HDOA 2LZ6A 3JCMb 1EM7A 2DTOA 5EE9A 3ZEHA 5GAMh 2DL4A 2MP2A 2RNAA 1NLPC 5GMKh 1I4GA 1PG5B 3RUIB 4A6QA 2XNAC 3KUFA 1AZGB 2ZCFB 3L08A 4RGMA 2LX7A 2NLUA 1V5OA 2HQHA 5A2QE 4W9FA 1WA7A 3IAM1 1A0NB 4M7AD 4UDUC 4KKJA 4GLSC 3G4SA 4EZJA 3Q69A 4FYYB 3CMMB 3UIPB 3VS3A 2JXTA 2W54A 4MMLA 4Y91A 1FPYA 1Z2MA 2AYOB 4RGNA 5KYXA 3I5SA 2V3NA 4KDIC 1I5LA 1KJWA 2YT6A 4D8DA 8ATCB 3T9LA 5E6NA 4C0ZA 3WALA 1IGUA 1VQOT 3Q8EA 4Q2JA 5L23A 3CCUT 1OZ3A 4E3CA 2CZ0B 1T5XD 2L32A 1TY0A 1LVKA 1VIEA 3MJWA 4PJOB 1E5WA 4C4VA 2QTVA 4CI0C 1VQPA 5IXBA 3BVGA 1BI1A 2EYZA 3R6NA 4P1CC 3Q3OC 1QOFA 4MZMA 2ZJDA 4XU1A 2QDFA 1V1PB 2WACA 3O65B 2O4XB 2JUFA 4XWTA 1ZKHA 2LCLA 2EKEC 3NS8A 2NUPB 4M78C 1EF5A 1OU9A 2RQUA 1W70A 4RTVA 4FCYA 1Q81U 3LYYA 1NPPA 1WX6A 2K8CA 3IHPC 3X0WA 1NVID 4AFQC 3PVLA 2KAFA 4XAXB 2IGHA 2A5UA 1OX8A 1I4XA 4FL6A 3UA7A 3M63B 1KQ6A 3TVTA 1V5TA 1VR9A 2W3RA 2FL7A 1D0XA 1I5OB 4GY5A 4ZRJA 3EHRA 3P4RB 4PJOF 2KN4A 5FRMA 3DCGA 2RDHA 1JWBD 2WU5B 1VCBA 6AT1B 3DBRB 3TEYA 4J8OA 1FXTB 2PE9A 3EUB2 3HRUA 3VDZA 2FRYA 3G1JA 4O6JA 2RJFA 1P7FA 4FU6A 1SBBB 4AG1C 1OQYA 1R0BG 1DOXA 2OAWA 4EIKA 2HJ1A 3NPFA 1OV3A 3E2UA 2XG8D 2NTSA 4C0DB 1WXTA 1VD2A 1X69A 2O88A 4ZRPA 5JHAA 4NY0A 2FVUA 2QSDA 2DK3A 1PC0A 4KDLB 4B0MA 4HVWA 3MP6A 2KJHB 3H9NA 3CPFA 3T9NA 4G50A 2LJ5A 1KC8R 1WI0A 3C94A 4IWPA 3RZFA 2XDBA 2DERA 3M0PA 4ICUA 3KYCD 2L52A 3CCVT 3MHXA 3WA0A 1WZ3A 4ELZC 1YX6B 1KG1A 3OYHA 3ZGZA 2Y3AA 2KD0A 4DBFA 4JS4A 1I42A 4RCBA 1KD1C 4ZHOA 4M75G 2CREA 1CMXB 2WXFA 1EO6A 5AZGA 2V0GA 2KVQG 1KHIA 2BWES 4M7DC 4F04B 2KR3A 5DLQE 4HCZA 1E7OA 2DX1A 1NLOC 4PJOE 2QA4T 4ZRKA 1IGDA 1TGZB 2WDQB 4BFRA 3OG5A 1P9DU 4BI8B 1H6HA 5LJ3e 1I8FA 5DLOA 4M75E 2L2PA 2CZ6B 1C76A 1YJIA 2J0MA 4KGTA 5G5HA 4G3XB 3DQVA 3VUWA 2Y4XA 1XTEA 2DLPA 1LQBA 1WGYA 4XTYA 1U3OA 1YCYA 4LUEA 1VA7A 2V4IB 2WXLA 4IURA 1OTRB 1E7PB 2RI2A 4FN2A 2L00B 3LLRA 2NUZA 3R2IA 2C7NB 5C2TB 2OX7A 1M2OA 1K52A 5LJ5j 2Z59B 4A4FA 1GBRA 1M3AA 3FKYA 4JLCA 2DYIA 3HUIA 4NNJB 1XEEA 1S72A 3AEAB 4P6VF 3C0CA 1N6ZA 3KW5B 4IDIA 3AECB 3FIFA 1JEGA 1Y96A 3V8KA 1RFKA 1NYQA 4EOYA 2MCNA 2B86A 2PPHA 4O1NA 4DA4A 2FUHB 2ACZB 3M0SA 1KLUD 3DBLB 3KWLA 4QT7A 4ICVA 1T0HA 3APDA 2LXAA 5D94A 2CSKA 2KLCA 2KFKA 3DBSA 1C78A 1I07A 2RAJA 2G45B 2RK1A 1M94A 3APCA 3CC2Q 1PUTA 4A4KA 1DGJA 2LJ1A 4B0EA 2DETA 2QEJC 2KBTA 1PD1A 2V1QA 4GBQA 1CQVA 2XBBC 3BVMA 4RM8A 1EWYC 3QIIA 2ZNVC 5BMHA 4XTVA 5HKHA 4JRIA 1WIEA 4FW1A 1VQ4A 1VQ9A 3ASKA 1M90C 3QCAA 1QF6A 1K73R 2RQRA 3L13A 2OTJT 4DEXA 2EQIA 1FMKA 1DYQA 5FU7B 3OYKA 2V3PA 2EGEA 1G3SA 2CP5A 4M77B 4C92D 5I4DA 2KJ6A 2NBUA 3MFGA 2IJ0A 1RACB 3RKWA 4FT2A 3MEUA 3OA6A 1VQPQ 1VZ7A 4WWNA 4BKSD 1C77A 2AR5A 1I7HA 2H8HA 4GB9A 5BYQA 4N59A 2BB5A 2C5LC 2QI2A 4FW2A 3CMAT 4XDCA 3QWZB 1SE4A 3M55A 5GAN7 5CHFA 2E5KA 1H3HA 2V8KA 2RAKA 4BZAA 4DBRA 4MDWA 1UJYA 5C1ZA 2JQRB 4LDYA 4EMKB 2L05A 2NS5A 4A8XC 4F14A 1B34B 4M8NA 1K9AA 5C0MA 5LJ3h 3S6WA 1UGSB 1QVFA 2X3XD 4AOFA 1JW9D 3DBHI 2DXBA 3PRMB 1GCQC 4JWUC 3CC7T 3H41A 3CCSA 2GCXA 4M77F 1PGAA 3AU5A 1FNVA 2K5LA 3QG1A 3OYEA 5JHBA 2M1MA 1VQ5T 2J52A 4LK0M 4CYEA 4BVUC 3RPFC 2HDAA 2IGDA 3G6ET 2IG0A 3CCRT 2XK0A 2MWPA 2B3AA 4L2YA 2HBWA 4RMOA 1N8RC 3VUYA 4HT8A 2LNVA 2N7EA 2FNJB 3VQIA 1C9FA 2PVGB 1M1KC 3SFEB 2L3PA 2DEQA 1MG8A 2A4ZA 2KK4A 1WXSA 3BINA 3RNCC 4M7AA 3DHGC 3RCZA 2COZA 3N1XC 1T6BX 4ZYNA 1SF9A 4C8QB 3A9KA 4E47A 4E7LA 1GJZA 3GF5A 1YJWA 2DNUA 2KAJA 4OMFB 1UBQA 5HFYA 1BUIC 3Q8AA 4LDUA 3QK0A 1MMDA 4J6YA 3Q8CA 3CC7Q 4WTOB 2MBOA 5AUIA 3AT1B 3LUIA 5LNK1 2KRNA 3OQ5A 4A63B 3BDLA 3FILA 3VYHB 4RTWA 1O75A 1I4RA 2P0KA 3M95A 3WVEB 2M0YA 3CCRQ 2KI7A 4PQPA 4WWMA 1U06A 2DL3A 2KNBA 2KDFB 3VVWB 2BF8B 2BS4B 4CQNA 4A4EA 1IGCA 3S3NA 1JBMA 2RO0A 1A5RA 2LQKA 3RKXA 4M77E 2JUOA 1JB0E 1MHHE 2J6OA 2DMOA 3PVQA 3JSCA 5AYFA 4C8QF 3CBMA 2WXKA 2JTMA 1WZ0A 2HE7A 5D3IB 2CS4A 3KLSX 1WJ6A 3EFOB 5FW9A 2CH4A 3EHVA 2E12A 3AE2B 3QARA 1C0MA 3VS2A 3ZXRA 1P3QU 3NRZA 4J6XA 2L73A 4PS7A 1STEA 1G5VA 1PKTA 2CJOA 1TOVA 2P0PA 3OAWA 2XICA 4EKUA 5KE2A 3JCMc 1H92A 1EIFA 2H3EB 1TS5A 2EYYA 1YN4A 5C6SA 1GFDA 1KSWA 3VRBB 2HBPA 2LGXA 4KRTA 1ZSZA 1VQ8A 1WJNA 2K8BA 2N0SB 1T0QC 4PFZA 2AL3A 3ALBA 1NG2A 1WLPB 4ORZA 4LDWA 2KYBA 5IHNA 1W2BA 1GOZA 2EAYA 2KSSA 1AW7A 2BKDN 1WRDB 2FCSA 3KH0A 1YWPA 2KTRA 4RUGA 1YJNQ 3HVZA 4NJ6A 5L83A 4F7UA 4LD9K 1Y7XA 1ET9A 2ZPEB 5DM7R 1L2NA 1K8AC 3P8DA 1IP9A 2COWA 1YD8U 2IIMA 4REZA 2WQYB 5CR2A 3SDLC 3I57A 4K7WA 2O01E 4AJYB 2QEXT 3ONSA 1YITA 4OMQA 1V81A 3TEZA 5D6JB 2JSVX 2GMIC 2KRMA 4KVGB 2P84A 4C8QE 2KC1A 4IIMA 2K2MA 1ZUD2 4GN1A 1IGQA 5BYRA 4PS3A 3PTAA 5KYWA 2CH4W 1H3ZA 3H0FA 1J7AA 1TIFA 3CCLT 3ZVVA 2J6FA 4IWQA 1FEHA 1N6AA 3L2QA 3KXTA 4ON3A 1AOJA 1JALA 5LJ5f 2ASQA 3BE3A 5IHIA 4AKVA 4GU2A 5AUKA 4LJPB 1D0ZA 1JXMA 1BCOA 4CRIA 1RAFB 4BDYA 1VQ4Q 1SGHA 2JY6A 1KIKA 2KMAA 2KDBA 3M9QA 4J83A 3DBRI 1ISNA 4ZHPA 4N4GA 7AT1B 2JN0A 2MBQA 3KUCB 4GLKA 3MC0B 2G4SA 2W3SA 2GRIA 2RHZA 2VWFA 2ZPYA 3IT4B 1GD5A 2EQMA 2VXFA 1JCKB 3O13A 5JZEB 3CD6T 2OEDA 3I55A 3CCJT 5HKCA 4C5EA 1HQRD 4IC7B 2HL5C 2L76A 3AXCA 4M78B 2DZIA 3SWNA 3L2WA 1YI2T 2PU9B 2GGRA 2MBEA 1G3WA 4JX1C 2FE8A 2KWVB 3Q3JA 3GB1A 5EDSA 3CC4A 2CU1A 4B95A 2M17A 2JMAA 3K9PB 3UI3A 1U5SA 3EG2A 4IW0A 3MEVA 4WJOA 2JM9A 2BW2A 2WGSA 3VS7A 1KK7A
chains in the Genus database with same CATH topology
5LXIB 3JV3A 3TMPB 2LVPA 1UGMA 3ULRB 5I22A 5G2NA 2IWLX 2RD0A 1NEBA 2GQIA 2GBJA 2GTJA 3WANA 4JIOU 3VH3B 1K0XA 4JJCA 3ZL7C 1E6HA 4E71A 2C0OA 4JGHB 2R2QA 1S1NA 4ANUA 3ZIMA 4OMLA 2J05A 4II3B 1WYWB 2AZVA 3JW0X 3N30A 4GGQA 3VRYA 4OVUA 1OPKA 4M4ZA 3ZLZA 1K1ZA 4JZ3A 4D8KA 4NAWA 1UFFA 1ZSGA 4DWFA 3H6NA 3VS1A 4KZ0A 4DDGD 2YSQA 4BKSA 2NPTA 3SHQA 2CSIA 4RTUA 4AWJA 3ZRCA 2REAA 2FPDA 5LXHA 5AZFA 3QHTA 4K7UA 2KGTA 1X6BA 3A33B 3PS6A 3QX1A 3AI5A 5IHKA 2K79A 3HK0A 1X27A 2L8JA 4GDLB 5FWBA 1YCSB 1ZLMA 2P4RA 3R3MA 4AFZC 2MWSB 3HPCX 4DHZB 4DK5A 2YUOA 1WMHB 4ZRIA 1YJ1A 1WGDA 3JSVB 2V3SA 4W9KA 2R2OA 4WJNA 1ZUYA 1HSQA 2LASA 2J7QB 3THKA 3DVNV 1GUAB 1X2QA 2ZNVB 2BYVE 2V14A 4W9HA 2KKCA 2GOWA 3A4SC 4IM0A 1GCPA 2CT3A 3ZNID 4TV3A 1Z9ZA 2V1RA 2KX0A 3LJ3A 4MDKE 4MJSA 2K25A 1WI7A 2JRHA 1WH3A 5IXFA 4A3PA 1S3SG 4OXWA 1M3CA 4X1VA 4TUUA 1W1FA 4AFSC 1S1QB 4MM3A 1E8WA 1AEYA 1YN8A 3UIOB 2XK5B 3KVFB 2RPQA 2CT4A 2LZ6B 1AWWA 4EZLA 1U4AA 2F2XA 3OJ4B 1QLYA 4AG2C 4W9IA 3L54A 1GC7A 1V6EA 4Z89A 1IO6A 4DHZE 2W9NA 1WX8A 5D2MB 1C3TA 1RLQC 1HE8A 2BGFA 1UD7A 3H9DA 2LJ0A 2MRPA 2YDLA 4HCPB 3SEMA 3ECIA 5DPSA 2OJ2A 5KHQA 2KQ7A 1QWFA 3QIJA 2K8HA 4LE9A 2IBIB 5I11A 1B07A 5IAAC 2JMCA 4CC4B 2A28A 3L0WB 4FULA 3UATA 1OGWA 2MX2A 2DA9A 3EHQA 4LDTB 5HCKA 2DAFA 3ML8A 3IQLA 2ZPNA 3M0RA 1WXBA 2D11A 5GJVB 1JO8A 3APFA 4F16A 4P7IA 2REDA 3V62A 3GOEA 2FIDA 4GXBA 4PYZA 3L10B 3ZKJC 4I6PA 3ZO5B 2LWPA 2A37A 4BKTA 2ED1A 1V49A 4WJPA 2HJ8A 1MV0B 1OOTA 2JW4A 4J9HA 1WXVA 1NM7A 3PLUA 3EG0A 4K11A 1GFCA 4OMNA 2GBMA 2HTHA 3H7PA 4MH0E 3UF4A 1H8KA 2VKNA 4XZ4A 2G3QB 4WQOB 1NYFA 4RTTA 1MV3A 2WDTB 4HXDA 4DXAB 1UECA 2AZSA 1V80A 5IA7A 1UE9A 2AL6A 2RQTA 2JVCA 3L17A 3VTWA 2DILA 2FG0A 1SE9A 1RFAA 2ENMA 4J6IA 2KWUB 1LCKA 2RMOA 2L0TA 1OEYJ 2FIFA 3QWXX 2PEAA 2D2QA 1O7KA 4AZ9A 2KK8A 1SIFA 3V61A 3JYUA 4JZ4A 1JRUA 2YUNA 2MSED 2QDLA 2EYWA 2PJHA 1OPLA 3V6EB 2NWMA 2N1WA 1PRMC 3M0TA 3NMZC 4F7ZA 1SRMA 1CKAA 2IY0B 3TJPA 2CHZA 4HVBA 4ZNXA 1Y57A 1UZXB 4LNPA 2DYMA 4JPBW 2O2VA 2O2OA 2N4FA 1AWOA 1P98A 1M30A 3SD5A 1WM3A 1VYTA 3PGEA 1J3TA 1WIAA 3CSFA 2XEWA 4W9DA 3TBLD 3HIZA 3NHNA 3PV1A 2DRKA 1OCSA 1RAXA 4B6WA 2REXA 1YWOA 1CKBA 3ENEA 5E6OA 2C7HA 2WX0A 4MGIE 1PKSA 2SRCA 3PRZA 1X6GA 4PYUA 4JJBA 1SHGA 3WAOA 2MBHA 5CHWA 3ZNZB 1Z5SB 4RTZA 3VS6A 3TL5A 2LVOA 3M62B 1WM2A 1UTIA 2F2WA 2CUBA 2ZEQA 1KLVA 3ZDMC 3RBBB 4KV2A 4PZGA 3KUZA 1PNJA 5GJWB 2DYBA 2DE0X 3PHWB 4IM3A 2K7AA 5DPTA 2C9WB 2KNBB 3N32A 4IKDA 1TUDA 2DENB 2LXCA 1HD3A 3RULA 2MQJA 2KYMA 3W1SA 1ZX6A 1Q5WB 1QKWA 4DHJD 2J0KA 3U7DA 1E8YA 4FLHA 4X57B 1WFYA 3X23A 3PZDA 1I0CA 5DPRA 4BKGA 3B0AA 2A36A 1M3BA 2N9PC 3IQ2A 2K6QA 2M8SA 3R66C 3EC8A 4HPMB 2ABLA 3EG1A 2WWZA 3PLVA 2BYEA 3ZTCA 2I1KA 5J2RA 4J9IA 1AARA 2CKHB 2LUEA 2RF0A 1VYUA 3I5RA 1WX7A 4PS8A 3AU4A 2ESWA 3ZDTA 2K6DB 1QKXA 4LUDA 2O9SA 2FCNA 1YNZA 1UHFA 2YVCA 3M95A 4PQPA 2FEIA 2ZVNA 4WAAA 1GRIA 2NBVB 2JZZA 1BK2A 1TG0A 2MW5A 1E7UA 4W9GA 2MBBB 2LRWA 1E8ZA 1L7YA 4CC3A 2JT4A 3QA8A 2ROLA 3UF8A 3TSZA 2NCNA 5BO4B 2KROA 5FR6A 1P0RA 3IG3A 1NYGA 1NEGA 4K1RB 5J17A 3UGBB 2J6KA 2V4LA 1WFWA 2KTFA 3H0IA 3H7SA 1GL5A 4E6RA 1T0YA 3VS4A 2J0JA 4XC2A 1T3LA 2CSQA 3DYTA 1I1JA 2FCMA 4DDID 2FCQA 1M8MA 1W6XA 1LXDA 5AEKB 4NPNA 1KFZA 2IYDB 2WYQA 4P2IA 3D32A 2LRUA 2IZVB 4W9EA 3U23A 4TQ1A 3OLMD 4EEWA 1MUZA 4PQOA 2WX1A 4I6LB 1UH6A 4HJKA 3QJZA 4NAWB 2KT1A 1NDDA 4JL9A 4LDTD 2RSUA 2DZKA 2NPTB 2L3SA 4K7SA 4Z88A 1J0GA 3NY5A 2LMJA 2D8HA 3PRPB 4TQ0A 2JPHA 2JRIB 2DZJA 3DBLI 2I0NA 2PNIA 4IM2A 4FHJA 3HM3A 4BOZB 3M3JA 3UQAA 1VYVA 2DBKA 3EECA 1WGGA 4DEYA 1RUWA 1R4MI 4IKBA 1PHTA 2LI5A 2O6VB 2NBWB 4J9CA 5D7GA 2LJ3A 4HVVA 4EFOA 2FO0A 3O5ZA 4F17A 4LJOB 4KIKB 1SHFA 3PE0A 4GDKA 2KZRA 3JVZX 2D8JA 2WWEA 3DOWA 4HLEA 3I35A 4W9JA 3W1SC 5L95C 5G55A 4OMPA 4M0WB 4CHKA 4MJSB 2ROTA 2HEQA 4RMAA 1UJ0A 3VUXA 1WE6A 1E7VA 2JTEA 1V86A 3A1QA 3SU8X 2EYXA 4N9F4 1ARKA 1WJUA 3FOGA 2K3BA 1N5ZA 2EPDA 3NZSA 3JSVA 2N1VA 3IBEA 1JU5C 3A9JA 4YL8A 2KXCA 4RM9A 4HCNB 2L0FA 2DF6A 2UWQA 1V1CA 4MSQB 1ZW7A 2KC2A 1G6JA 1P1AA 2MP2B 1IYFA 1EUVB 3N3KB 3VTVA 1D3ZA 1AVZC 2JF5A 4M8MA 4W9CA 4J9FA 4NQLB 1RRBA 3GZNI 3MTNB 1AWJA 2D3GA 4G0NB 4HK2A 3VXWA 2N7DA 4ANWA 1EFNA 3CQTA 2CZOA 1M27C 1BBZA 3ZNHB 1XQQA 2CUDA 2GBRA 2FPFA 2C60A 5GMVA 2QHOA 3VS0A 3TIXA 3A98A 2KFJA 2KDEB 5CHVC 2BKFA 4J9EA 1GCQA 4IWOA 4IUMB 3U30A 2D07B 2RQWA 2D0NA 2BZYA 3NZUA 2F2VA 2AKKA 2KOXA 3VRZA 3NOBA 3M0UA 2C7MB 2J06A 3IVFA 2GBQA 4GIVA 2K1FA 3AULA 2LGDA 3DPDA 1GC6A 1T0JA 2EMSA 3L16A 1UUEA 4FJYA 4HWIB 1TZ1A 2DBMA 5J18A 2Z0DB 1I35A 3PT2B 2W10A 3KUDB 3A4RA 4OMOA 4K81A 1WGRA 4BBNC 2HSPA 5E6PA 4AP4C 3H7PB 1GBQA 2KN5A 3TCAA 4W9LA 2IO0B 3U8ZA 1JXOA 2LNHB 3EFUA 2KO3A 2O31A 2FRWA 2K9GA 2YPSA 2YLMA 2DYOA 2AKLA 4I6NB 3QAQA 2V6VA 3B08A 3ZW3A 2IO3B 2VRRB 2AK5A 4OVVA 3EGUA 5CX3A 1X1MA 2BTTA 1OCUA 4BGJA 1RLFA 1EF1A 3ZUNA 2ZVOA 3QC8B 3VFKA 3UA6A 3UINB 1HJDA 2MCNB 2OJRA 2BKRB 2DRMA 3CSTA 2JWZA 2O2VB 4FJVB 1AWXA 4KSKC 3X0WA 1B3QA 4HXJA 2KFKB 3HM6X 2C0TA 4A20A 3IFWB 1G83A 3QWYA 1QWEA 4AFUC 2GBNA 4WWOA 4MSMB 2G4DB 2PZ1A 4F1SA 3KFVA 1H8CA 2Y5BB 4ZDVA 4CC7A 4OMMA 1XT9B 2LVQA 3W1YA 3DVNU 2I4KA 3LH5A 4FJZA 1UHCA 1RLPC 3TSWA 4CC2A 2JM8A 2YUPA 1WXMA 2AEHA 2BYFA 4HVUA 2KHWB 1J8CA 1K8RB 3VAWA 4ANVA 1NBFC 1G2BA 4Y92A 3M0QA 1YIWA 2JZ3B 3VTUA 4MGZE 1KOTA 1SPKA 2DHZA 2Z0EB 2MOXA 2GNCA 2ZCBA 4GMVA 4HDQA 4XX5A 1E8XA 1UGVA 2FPEA 3H1UA 4WJQA 4II2B 4CO7A 2HCKA 3P0CA 3B1LX 3REAB 1GG3A 5AZHA 4WWPA 4MGYE 2CHXA 3A9KB 1TBEA 2KXJA 2ECZA 2O9VA 3VS5A 2LGYA 3ZNGC 1WJ4A 4IG7B 1T3SA 1AZEA 1WYXA 2EKHA 2JXXA 2VVKA 4WCIA 1Q1OA 2CR5A 3BY4B 3WAPA 1K76A 3ZTDA 5EC7A 4NJ7A 3QQ8B 3ZRFA 3T8MA 4F8CB 1GNUA 2A08A 4FA6A 5DPWA 1BT0A 1OEBA 2RN8A 2JS2A 1R4NI 3PREA 2NVUI 2O6VD 1NI2A 3RNJA 5JH5C 2UYZB 2LP5A 2JXBA 4DBGA 1K4US 3R7QA 3KYDD 2EW3A 3VH4B 2PTKA 2KTRB 1UBIA 2I1JA 3NHEB 2DZMA 4HPLB 3S2AA 3LDZE 1K0SA 1WXUA 2KDIA 4MEMA 1CSKA 2EVRA 1WF9A 2AWTA 4MGKE 1QCFA 2K39A 2BZ8A 2DL7A 3GBQA 3RZWC 2JT4B 2DL8A 4BOSC 1H4RA 2MLBA 2BZXA 1V2YA 2D1XA 1UELA 3ML9A 2ZCCA 2BWFA 2KQSA 4HCKA 2MIOA 2SEMA 1SEMA 2W0ZA 2KWCA 2EGAA 4Z8AA 1WGHA 2L7RA 2LQNA 4LN2A 4URKA 2L3QA 2GBKA 2BPSA 1X2KA 2L0AA 1ABQA 2ED0A 2DVJA 2K6DA 2KVRA 4NQKE 4ASWC 2KE9A 3HPBA 2HD5B 3MHSD 1BB9A 2LQWA 2EMTA 3PTFC 2NR2A 4GLMA 2V1YA 3UQBA 1KM7A 1PWTA 2RQVA 2PE6B 1KMDA 1PRLC 2DX5B 2KLGA 1X43A 3P2BA 4GSWA 2D10A 2LCSA 4FHKA 1XTNA 4MELA 3WAMA 4IIOA 2DL5A 1LM8B 3RD2A 2EGCA 2KJRA 2XMFA 2FAZA 3NGPA 1YQBA 1Z9QA 1WR1A 5FWCA 2GTOA 2KRSA 5DCNA 1WDXA 1WR6E 3DVGY 3FJ5A 2IO2B 4AUQC 4RTXA 3DDCB 2MA9B 1ZUKA 1AD5A 1QZEA 2C0IA 1FYNA 4JQWC 4BBNF 1KJTA 3EG3A 3OJ3A 2KX3A 2X3WD 3WIMA 1WXAA 2ETTA 2JS0A 4R0KA 3V60A 3V6CB 1Y8RC 1ZBJA 4KZCA 1IPGA 1YX5B 2M4NA 3H0HA 1BU1A 1OEYA 4IKBB 3PSEB 3HHMA 1PQSA 3PPAA 2KANA 1C1YB 2M51A 3CF6E 2IY1B 2DAJA</