2IWLX

Structure of the px domain of phosphoinositide 3-kinase-c2alpha
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
131
structure length
121
Chain Sequence
LSFSPKTYSFRQDGRIKEVSVFTYHKKYNPDKHYIYVVRILREGQIEPSFVFRTFDEFQELHNKLSIIFPLWKLPGFPNDVAAKRKIELNSYLQSLMNASTDVAECDLVCTFFHPLLRDEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHATIDYLINOSITOL-4-PHOSPHATE 3-KINASE C2 DOMAIN-CONTAINI
publication title Structural and Membrane Binding Analysis of the Phox Homology Domain of Phosphoinositide 3-Kinase- C2{Alpha}.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 32
structure length 121
sequence length 131
ec nomenclature ec 2.7.1.154: Phosphatidylinositol-4-phosphate 3-kinase.
pdb deposition date 2006-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2iwlX00
4P2IA 2V6VA 3IQ2A 2RAKA 1OCUA 3LUIA 4AZ9A 4P2JA 4PQPA 2IWLX 4PQOA 1XTNA 4IKBA 4BGJA 1O7KA 2I4KA 3P0CA 4ON3A 2CSKA 4PZGA 1XTEA 4IKDA 1KQ6A 2AR5A 2ETTA 2RAIA 2RAJA 2YPSA 2DYBA 3DYTA 1OCSA 1KMDA 3HPBA 2REDA 2REAA 2CZOA 3FOGA 4IKBB 3HPCX 2V14A 1GD5A 4OXWA 2WWEA 4AKVA 2L73A 4HASA 1H6HA
chains in the Genus database with same CATH superfamily
4P2IA 2V6VA 3IQ2A 2RAKA 1OCUA 3LUIA 4AZ9A 4P2JA 4PQPA 2IWLX 4PQOA 1XTNA 4IKBA 4BGJA 1O7KA 2I4KA 3P0CA 4ON3A 2CSKA 4PZGA 1XTEA 4IKDA 1KQ6A 2AR5A 2ETTA 2RAIA 2RAJA 2YPSA 2DYBA 3DYTA 1OCSA 1KMDA 3HPBA 2REDA 2REAA 2CZOA 3FOGA 4IKBB 3HPCX 2V14A 1GD5A 4OXWA 2WWEA 4AKVA 2L73A 4HASA 1H6HA
chains in the Genus database with same CATH topology
4P2IA 2V6VA 3IQ2A 2RAKA 1OCUA 3LUIA 4AZ9A 4P2JA 4PQPA 2IWLX 4PQOA 1XTNA 4IKBA 4BGJA 1O7KA 2I4KA 3P0CA 4ON3A 2CSKA 4PZGA 1XTEA 4IKDA 1KQ6A 2AR5A 2ETTA 2RAIA 2RAJA 2YPSA 2DYBA 3DYTA 1OCSA 1KMDA 3HPBA 2REDA 2REAA 2CZOA 3FOGA 4IKBB 3HPCX 2V14A 1GD5A 4OXWA 2WWEA 4AKVA 2L73A 4HASA 1H6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P2I A;  2V6V A;  3IQ2 A;  2RAK A;  1OCU A;  3LUI A;  4AZ9 A;  4P2J A;  4PQP A;  2IWL X;  4PQO A;  1XTN A;  4IKB A;  4BGJ A;  1O7K A;  2I4K A;  3P0C A;  4ON3 A;  2CSK A;  4PZG A;  1XTE A;  4IKD A;  1KQ6 A;  2AR5 A;  2ETT A;  2RAI A;  2RAJ A;  2YPS A;  2DYB A;  3DYT A;  1OCS A;  1KMD A;  3HPB A;  2RED A;  2REA A;  2CZO A;  3FOG A;  4IKB B;  3HPC X;  2V14 A;  1GD5 A;  4OXW A;  2WWE A;  4AKV A;  2L73 A;  4HAS A;  1H6H A; 
#chains in the Genus database with same CATH topology
 4P2I A;  2V6V A;  3IQ2 A;  2RAK A;  1OCU A;  3LUI A;  4AZ9 A;  4P2J A;  4PQP A;  2IWL X;  4PQO A;  1XTN A;  4IKB A;  4BGJ A;  1O7K A;  2I4K A;  3P0C A;  4ON3 A;  2CSK A;  4PZG A;  1XTE A;  4IKD A;  1KQ6 A;  2AR5 A;  2ETT A;  2RAI A;  2RAJ A;  2YPS A;  2DYB A;  3DYT A;  1OCS A;  1KMD A;  3HPB A;  2RED A;  2REA A;  2CZO A;  3FOG A;  4IKB B;  3HPC X;  2V14 A;  1GD5 A;  4OXW A;  2WWE A;  4AKV A;  2L73 A;  4HAS A;  1H6H A; 
#chains in the Genus database with same CATH homology
 4P2I A;  2V6V A;  3IQ2 A;  2RAK A;  1OCU A;  3LUI A;  4AZ9 A;  4P2J A;  4PQP A;  2IWL X;  4PQO A;  1XTN A;  4IKB A;  4BGJ A;  1O7K A;  2I4K A;  3P0C A;  4ON3 A;  2CSK A;  4PZG A;  1XTE A;  4IKD A;  1KQ6 A;  2AR5 A;  2ETT A;  2RAI A;  2RAJ A;  2YPS A;  2DYB A;  3DYT A;  1OCS A;  1KMD A;  3HPB A;  2RED A;  2REA A;  2CZO A;  3FOG A;  4IKB B;  3HPC X;  2V14 A;  1GD5 A;  4OXW A;  2WWE A;  4AKV A;  2L73 A;  4HAS A;  1H6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...