1TQ1A

Solution structure of at5g66040, a putative protein from arabidosis thaliana
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
119
structure length
119
Chain Sequence
AEESRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNTDFLEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords senescence-associated family protein
publication title Solution structure of a single-domain thiosulfate sulfurtransferase from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 20
structure length 119
sequence length 119
ec nomenclature ec 2.8.1.1: Thiosulfate sulfurtransferase.
pdb deposition date 2004-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 1tq1A00
5HBPA 3TG3A 3ICSA 3HZUA 3IWHA 1CWTA 1YMDA 3IPOA 2MRMA 3NHVA 1YMKA 2GWFA 3O3WA 2WLRA 1GMXA 5LAMA 2EG4A 2K0ZA 2FSXA 1QXNA 3FNJA 3HIXA 2MOLA 1BOIA 1YT8A 3D1PA 4JGTA 3AAYA 3HWIA 2J6PA 5HBLA 2KL3A 1TQ1A 2JTRA 1E0CA 1QB0A 1WV9A 3NTDA 1H4KX 2IFVA 3NTAA 3IPPA 3OP3A 2DCQA 1YMLA 2HHGA 3GK5A 2OUCA 3OLHA 1WHBA 1T3KA 5LAOA 1CWSA 2EG4B 5HBOA 2IFDA 1OKGA 1YS0A 3ICTA 3FLHA 2ORAA 3MZZA 3NT6A 2WLXA 3TP9A 3FOJA 1RHDA 1RHSA 3G5JA 3R2UA 4WH7A 1H4MX 3FS5A 3F4AA 1YM9A 3I3UA 2MOIA 1BOHA 3I2VA 2JTSA 2A2KA 5HBQA 1CWRA 2EG3A 3P3AA 1UARA 3TG1B 1HZMA 1C25A 1DP2A 1VEEA 3K9RA 5HPAA 2JTQA 3UTNX 4F67A 1URHA 2VSWA 1GN0A 2UZQA 4OCGA 1ORBA 3ILMA 3AAXA 4WH9A 3ICRA
chains in the Genus database with same CATH superfamily
5HBPA 3TG3A 3ICSA 3HZUA 3IWHA 1CWTA 1YMDA 3IPOA 2MRMA 3NHVA 1YMKA 2GWFA 3O3WA 2WLRA 1GMXA 5LAMA 2EG4A 2K0ZA 2FSXA 1QXNA 3FNJA 3HIXA 2MOLA 1BOIA 1YT8A 3D1PA 4JGTA 3AAYA 3HWIA 2J6PA 5HBLA 2KL3A 1TQ1A 2JTRA 1E0CA 1QB0A 1WV9A 3NTDA 1H4KX 2IFVA 3NTAA 3IPPA 3OP3A 2DCQA 1YMLA 2HHGA 3GK5A 2OUCA 3OLHA 1WHBA 1T3KA 5LAOA 1CWSA 2EG4B 5HBOA 2IFDA 1OKGA 1YS0A 3ICTA 3FLHA 2ORAA 3MZZA 3NT6A 2WLXA 3TP9A 3FOJA 1RHDA 1RHSA 3G5JA 3R2UA 4WH7A 1H4MX 3FS5A 3F4AA 1YM9A 3I3UA 2MOIA 1BOHA 3I2VA 2JTSA 2A2KA 5HBQA 1CWRA 2EG3A 3P3AA 1UARA 3TG1B 1HZMA 1C25A 1DP2A 1VEEA 3K9RA 5HPAA 2JTQA 3UTNX 4F67A 1URHA 2VSWA 1GN0A 2UZQA 4OCGA 2Q82A 1ORBA 3ILMA 3AAXA 4WH9A 3ICRA
chains in the Genus database with same CATH topology
5HBPA 3TG3A 3ICSA 3HZUA 3IWHA 1CWTA 1YMDA 3IPOA 2MRMA 3NHVA 1YMKA 2GWFA 3O3WA 2WLRA 1GMXA 5LAMA 2EG4A 2K0ZA 2FSXA 1QXNA 3FNJA 3HIXA 2MOLA 1BOIA 1YT8A 3D1PA 4JGTA 3AAYA 3HWIA 2J6PA 5HBLA 2KL3A 1TQ1A 2JTRA 1E0CA 1QB0A 1WV9A 3NTDA 1H4KX 2IFVA 3NTAA 3IPPA 3OP3A 2DCQA 1YMLA 2HHGA 3GK5A 2OUCA 3OLHA 1WHBA 1T3KA 5LAOA 1CWSA 2EG4B 5HBOA 2IFDA 1OKGA 1YS0A 3ICTA 3FLHA 2ORAA 3MZZA 3NT6A 2WLXA 3TP9A 3FOJA 1RHDA 1RHSA 3G5JA 3R2UA 4WH7A 1H4MX 3FS5A 3F4AA 1YM9A 3I3UA 2MOIA 1BOHA 3I2VA 2JTSA 2A2KA 5HBQA 1CWRA 2EG3A 3P3AA 1UARA 3TG1B 1HZMA 1C25A 1DP2A 1VEEA 3K9RA 5HPAA 2JTQA 3UTNX 4F67A 1URHA 2VSWA 1GN0A 2UZQA 4OCGA 1ORBA 3ILMA 3AAXA 4WH9A 3ICRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HBP A;  3TG3 A;  3ICS A;  3HZU A;  3IWH A;  1CWT A;  1YMD A;  3IPO A;  2MRM A;  3NHV A;  1YMK A;  2GWF A;  3O3W A;  2WLR A;  1GMX A;  5LAM A;  2EG4 A;  2K0Z A;  2FSX A;  1QXN A;  3FNJ A;  3HIX A;  2MOL A;  1BOI A;  1YT8 A;  3D1P A;  4JGT A;  3AAY A;  3HWI A;  2J6P A;  5HBL A;  2KL3 A;  1TQ1 A;  2JTR A;  1E0C A;  1QB0 A;  1WV9 A;  3NTD A;  1H4K X;  2IFV A;  3NTA A;  3IPP A;  3OP3 A;  2DCQ A;  1YML A;  2HHG A;  3GK5 A;  2OUC A;  3OLH A;  1WHB A;  1T3K A;  5LAO A;  1CWS A;  2EG4 B;  5HBO A;  2IFD A;  1OKG A;  1YS0 A;  3ICT A;  3FLH A;  2ORA A;  3MZZ A;  3NT6 A;  2WLX A;  3TP9 A;  3FOJ A;  1RHD A;  1RHS A;  3G5J A;  3R2U A;  4WH7 A;  1H4M X;  3FS5 A;  3F4A A;  1YM9 A;  3I3U A;  2MOI A;  1BOH A;  3I2V A;  2JTS A;  2A2K A;  5HBQ A;  1CWR A;  2EG3 A;  3P3A A;  1UAR A;  3TG1 B;  1HZM A;  1C25 A;  1DP2 A;  1VEE A;  3K9R A;  5HPA A;  2JTQ A;  3UTN X;  4F67 A;  1URH A;  2VSW A;  1GN0 A;  2UZQ A;  4OCG A;  1ORB A;  3ILM A;  3AAX A;  4WH9 A;  3ICR A; 
#chains in the Genus database with same CATH topology
 5HBP A;  3TG3 A;  3ICS A;  3HZU A;  3IWH A;  1CWT A;  1YMD A;  3IPO A;  2MRM A;  3NHV A;  1YMK A;  2GWF A;  3O3W A;  2WLR A;  1GMX A;  5LAM A;  2EG4 A;  2K0Z A;  2FSX A;  1QXN A;  3FNJ A;  3HIX A;  2MOL A;  1BOI A;  1YT8 A;  3D1P A;  4JGT A;  3AAY A;  3HWI A;  2J6P A;  5HBL A;  2KL3 A;  1TQ1 A;  2JTR A;  1E0C A;  1QB0 A;  1WV9 A;  3NTD A;  1H4K X;  2IFV A;  3NTA A;  3IPP A;  3OP3 A;  2DCQ A;  1YML A;  2HHG A;  3GK5 A;  2OUC A;  3OLH A;  1WHB A;  1T3K A;  5LAO A;  1CWS A;  2EG4 B;  5HBO A;  2IFD A;  1OKG A;  1YS0 A;  3ICT A;  3FLH A;  2ORA A;  3MZZ A;  3NT6 A;  2WLX A;  3TP9 A;  3FOJ A;  1RHD A;  1RHS A;  3G5J A;  3R2U A;  4WH7 A;  1H4M X;  3FS5 A;  3F4A A;  1YM9 A;  3I3U A;  2MOI A;  1BOH A;  3I2V A;  2JTS A;  2A2K A;  5HBQ A;  1CWR A;  2EG3 A;  3P3A A;  1UAR A;  3TG1 B;  1HZM A;  1C25 A;  1DP2 A;  1VEE A;  3K9R A;  5HPA A;  2JTQ A;  3UTN X;  4F67 A;  1URH A;  2VSW A;  1GN0 A;  2UZQ A;  4OCG A;  2Q82 A;  1ORB A;  3ILM A;  3AAX A;  4WH9 A;  3ICR A; 
#chains in the Genus database with same CATH homology
 5HBP A;  3TG3 A;  3ICS A;  3HZU A;  3IWH A;  1CWT A;  1YMD A;  3IPO A;  2MRM A;  3NHV A;  1YMK A;  2GWF A;  3O3W A;  2WLR A;  1GMX A;  5LAM A;  2EG4 A;  2K0Z A;  2FSX A;  1QXN A;  3FNJ A;  3HIX A;  2MOL A;  1BOI A;  1YT8 A;  3D1P A;  4JGT A;  3AAY A;  3HWI A;  2J6P A;  5HBL A;  2KL3 A;  1TQ1 A;  2JTR A;  1E0C A;  1QB0 A;  1WV9 A;  3NTD A;  1H4K X;  2IFV A;  3NTA A;  3IPP A;  3OP3 A;  2DCQ A;  1YML A;  2HHG A;  3GK5 A;  2OUC A;  3OLH A;  1WHB A;  1T3K A;  5LAO A;  1CWS A;  2EG4 B;  5HBO A;  2IFD A;  1OKG A;  1YS0 A;  3ICT A;  3FLH A;  2ORA A;  3MZZ A;  3NT6 A;  2WLX A;  3TP9 A;  3FOJ A;  1RHD A;  1RHS A;  3G5J A;  3R2U A;  4WH7 A;  1H4M X;  3FS5 A;  3F4A A;  1YM9 A;  3I3U A;  2MOI A;  1BOH A;  3I2V A;  2JTS A;  2A2K A;  5HBQ A;  1CWR A;  2EG3 A;  3P3A A;  1UAR A;  3TG1 B;  1HZM A;  1C25 A;  1DP2 A;  1VEE A;  3K9R A;  5HPA A;  2JTQ A;  3UTN X;  4F67 A;  1URH A;  2VSW A;  1GN0 A;  2UZQ A;  4OCG A;  1ORB A;  3ILM A;  3AAX A;  4WH9 A;  3ICR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...