3HIXA

Crystal structure of the rhodanese_3 like domain from anabaena sp alr3790 protein. northeast structural genomics consortium target nsr437i
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
94
structure length
94
Chain Sequence
AFTILDVRDRSTYNDGHIMGAMAMPIEDLVDRASSSLEKSRDIYVYGAGDEQTSQAVNLLRSAGFEHVSELKGGLAAWKAIGGPTELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Alr3790 protein
publication title Crystal Structure of the Rhodanese_3 like domain from Anabaena sp Alr3790 protein.
rcsb
source organism Anabaena sp.
total genus 25
structure length 94
sequence length 94
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3hixA00
3NT6A 1H4MX 1BOHA 1YMLA 1UARA 3G5JA 2GWFA 2J6PA 5LAOA 3ICTA 1RHSA 4OCGA 3I2VA 1URHA 1BOIA 2IFVA 1C25A 3HWIA 2EG4B 3FNJA 3IPPA 1RHDA 1CWTA 2ORAA 1ORBA 4F67A 2MOIA 3NTDA 3O3WA 3NHVA 1YM9A 1OKGA 2EG4A 2EG3A 3AAYA 1HZMA 1YMDA 1QXNA 3ICSA 3D1PA 2UZQA 3ICRA 5HBPA 3K9RA 2FSXA 3TG1B 3MZZA 3OP3A 2DCQA 1YT8A 1E0CA 3FOJA 3F4AA 1WHBA 1H4KX 3FLHA 2KL3A 4WH7A 2OUCA 4WH9A 5HBOA 1VEEA 1GN0A 3OLHA 2JTRA 2WLRA 5LAMA 3TG3A 2VSWA 3I3UA 5HPAA 3IWHA 1TQ1A 1CWRA 1DP2A 1T3KA 2A2KA 3UTNX 2JTSA 1CWSA 3R2UA 2WLXA 2K0ZA 3FS5A 3HZUA 2IFDA 3ILMA 3NTAA 1YS0A 2MRMA 2HHGA 2MOLA 1YMKA 5HBQA 1QB0A 3GK5A 3P3AA 3IPOA 2JTQA 1GMXA 3HIXA 3AAXA 5HBLA 1WV9A 3TP9A 4JGTA
chains in the Genus database with same CATH superfamily
3NT6A 1H4MX 1BOHA 1YMLA 1UARA 3G5JA 2GWFA 2J6PA 5LAOA 3ICTA 2Q82A 1RHSA 4OCGA 3I2VA 1URHA 1BOIA 2IFVA 1C25A 3HWIA 2EG4B 3FNJA 3IPPA 1RHDA 1CWTA 2ORAA 1ORBA 4F67A 2MOIA 3NTDA 3O3WA 3NHVA 1YM9A 1OKGA 2EG4A 2EG3A 3AAYA 1HZMA 1YMDA 1QXNA 3ICSA 3D1PA 2UZQA 3ICRA 5HBPA 3K9RA 2FSXA 3TG1B 3MZZA 3OP3A 2DCQA 1YT8A 1E0CA 3FOJA 3F4AA 1WHBA 1H4KX 3FLHA 2KL3A 4WH7A 2OUCA 4WH9A 5HBOA 1VEEA 1GN0A 3OLHA 2JTRA 2WLRA 5LAMA 3TG3A 2VSWA 3I3UA 5HPAA 3IWHA 1TQ1A 1CWRA 1DP2A 1T3KA 2A2KA 3UTNX 2JTSA 1CWSA 3R2UA 2WLXA 2K0ZA 3FS5A 3HZUA 2IFDA 3ILMA 3NTAA 1YS0A 2MRMA 2HHGA 2MOLA 1YMKA 5HBQA 1QB0A 3GK5A 3P3AA 3IPOA 2JTQA 1GMXA 3HIXA 3AAXA 5HBLA 1WV9A 3TP9A 4JGTA
chains in the Genus database with same CATH topology
3NT6A 1H4MX 1BOHA 1YMLA 1UARA 3G5JA 2GWFA 2J6PA 5LAOA 3ICTA 1RHSA 4OCGA 3I2VA 1URHA 1BOIA 2IFVA 1C25A 3HWIA 2EG4B 3FNJA 3IPPA 1RHDA 1CWTA 2ORAA 1ORBA 4F67A 2MOIA 3NTDA 3O3WA 3NHVA 1YM9A 1OKGA 2EG4A 2EG3A 3AAYA 1HZMA 1YMDA 1QXNA 3ICSA 3D1PA 2UZQA 3ICRA 5HBPA 3K9RA 2FSXA 3TG1B 3MZZA 3OP3A 2DCQA 1YT8A 1E0CA 3FOJA 3F4AA 1WHBA 1H4KX 3FLHA 2KL3A 4WH7A 2OUCA 4WH9A 5HBOA 1VEEA 1GN0A 3OLHA 2JTRA 2WLRA 5LAMA 3TG3A 2VSWA 3I3UA 5HPAA 3IWHA 1TQ1A 1CWRA 1DP2A 1T3KA 2A2KA 3UTNX 2JTSA 1CWSA 3R2UA 2WLXA 2K0ZA 3FS5A 3HZUA 2IFDA 3ILMA 3NTAA 1YS0A 2MRMA 2HHGA 2MOLA 1YMKA 5HBQA 1QB0A 3GK5A 3P3AA 3IPOA 2JTQA 1GMXA 3HIXA 3AAXA 5HBLA 1WV9A 3TP9A 4JGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NT6 A;  1H4M X;  1BOH A;  1YML A;  1UAR A;  3G5J A;  2GWF A;  2J6P A;  5LAO A;  3ICT A;  1RHS A;  4OCG A;  3I2V A;  1URH A;  1BOI A;  2IFV A;  1C25 A;  3HWI A;  2EG4 B;  3FNJ A;  3IPP A;  1RHD A;  1CWT A;  2ORA A;  1ORB A;  4F67 A;  2MOI A;  3NTD A;  3O3W A;  3NHV A;  1YM9 A;  1OKG A;  2EG4 A;  2EG3 A;  3AAY A;  1HZM A;  1YMD A;  1QXN A;  3ICS A;  3D1P A;  2UZQ A;  3ICR A;  5HBP A;  3K9R A;  2FSX A;  3TG1 B;  3MZZ A;  3OP3 A;  2DCQ A;  1YT8 A;  1E0C A;  3FOJ A;  3F4A A;  1WHB A;  1H4K X;  3FLH A;  2KL3 A;  4WH7 A;  2OUC A;  4WH9 A;  5HBO A;  1VEE A;  1GN0 A;  3OLH A;  2JTR A;  2WLR A;  5LAM A;  3TG3 A;  2VSW A;  3I3U A;  5HPA A;  3IWH A;  1TQ1 A;  1CWR A;  1DP2 A;  1T3K A;  2A2K A;  3UTN X;  2JTS A;  1CWS A;  3R2U A;  2WLX A;  2K0Z A;  3FS5 A;  3HZU A;  2IFD A;  3ILM A;  3NTA A;  1YS0 A;  2MRM A;  2HHG A;  2MOL A;  1YMK A;  5HBQ A;  1QB0 A;  3GK5 A;  3P3A A;  3IPO A;  2JTQ A;  1GMX A;  3HIX A;  3AAX A;  5HBL A;  1WV9 A;  3TP9 A;  4JGT A; 
#chains in the Genus database with same CATH topology
 3NT6 A;  1H4M X;  1BOH A;  1YML A;  1UAR A;  3G5J A;  2GWF A;  2J6P A;  5LAO A;  3ICT A;  2Q82 A;  1RHS A;  4OCG A;  3I2V A;  1URH A;  1BOI A;  2IFV A;  1C25 A;  3HWI A;  2EG4 B;  3FNJ A;  3IPP A;  1RHD A;  1CWT A;  2ORA A;  1ORB A;  4F67 A;  2MOI A;  3NTD A;  3O3W A;  3NHV A;  1YM9 A;  1OKG A;  2EG4 A;  2EG3 A;  3AAY A;  1HZM A;  1YMD A;  1QXN A;  3ICS A;  3D1P A;  2UZQ A;  3ICR A;  5HBP A;  3K9R A;  2FSX A;  3TG1 B;  3MZZ A;  3OP3 A;  2DCQ A;  1YT8 A;  1E0C A;  3FOJ A;  3F4A A;  1WHB A;  1H4K X;  3FLH A;  2KL3 A;  4WH7 A;  2OUC A;  4WH9 A;  5HBO A;  1VEE A;  1GN0 A;  3OLH A;  2JTR A;  2WLR A;  5LAM A;  3TG3 A;  2VSW A;  3I3U A;  5HPA A;  3IWH A;  1TQ1 A;  1CWR A;  1DP2 A;  1T3K A;  2A2K A;  3UTN X;  2JTS A;  1CWS A;  3R2U A;  2WLX A;  2K0Z A;  3FS5 A;  3HZU A;  2IFD A;  3ILM A;  3NTA A;  1YS0 A;  2MRM A;  2HHG A;  2MOL A;  1YMK A;  5HBQ A;  1QB0 A;  3GK5 A;  3P3A A;  3IPO A;  2JTQ A;  1GMX A;  3HIX A;  3AAX A;  5HBL A;  1WV9 A;  3TP9 A;  4JGT A; 
#chains in the Genus database with same CATH homology
 3NT6 A;  1H4M X;  1BOH A;  1YML A;  1UAR A;  3G5J A;  2GWF A;  2J6P A;  5LAO A;  3ICT A;  1RHS A;  4OCG A;  3I2V A;  1URH A;  1BOI A;  2IFV A;  1C25 A;  3HWI A;  2EG4 B;  3FNJ A;  3IPP A;  1RHD A;  1CWT A;  2ORA A;  1ORB A;  4F67 A;  2MOI A;  3NTD A;  3O3W A;  3NHV A;  1YM9 A;  1OKG A;  2EG4 A;  2EG3 A;  3AAY A;  1HZM A;  1YMD A;  1QXN A;  3ICS A;  3D1P A;  2UZQ A;  3ICR A;  5HBP A;  3K9R A;  2FSX A;  3TG1 B;  3MZZ A;  3OP3 A;  2DCQ A;  1YT8 A;  1E0C A;  3FOJ A;  3F4A A;  1WHB A;  1H4K X;  3FLH A;  2KL3 A;  4WH7 A;  2OUC A;  4WH9 A;  5HBO A;  1VEE A;  1GN0 A;  3OLH A;  2JTR A;  2WLR A;  5LAM A;  3TG3 A;  2VSW A;  3I3U A;  5HPA A;  3IWH A;  1TQ1 A;  1CWR A;  1DP2 A;  1T3K A;  2A2K A;  3UTN X;  2JTS A;  1CWS A;  3R2U A;  2WLX A;  2K0Z A;  3FS5 A;  3HZU A;  2IFD A;  3ILM A;  3NTA A;  1YS0 A;  2MRM A;  2HHG A;  2MOL A;  1YMK A;  5HBQ A;  1QB0 A;  3GK5 A;  3P3A A;  3IPO A;  2JTQ A;  1GMX A;  3HIX A;  3AAX A;  5HBL A;  1WV9 A;  3TP9 A;  4JGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...