3NTAA

Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
565
structure length
565
Chain Sequence
MKKILIIGGVAGGASAAARARRLSETAEIIMFERGEYVSFANCGLPYHISGEIAQRSALVLQTPESFKARFNVEVRVKHEVVAIDRAAKLVTVRRLLDGSEYQESYDTLLLSPGAAPIVPPIPGVDNPLTHSLRNIPDMDRILQTIQMNNVEHATVVGGGFIGLEMMESLHHLGIKTTLLELADQVMTPVDREMAGFAHQAIRDQGVDLRLGTALSEVSYQVQTHVASDAAGEDTAHQHIKGHLSLTLSNGELLETDLLIMAIGVRPETQLARDAGLAIGELGGIKVNAMMQTSDPAIYAVGDAVEEQDFVTGQACLVPLAGPANRQGRMAADNMFGREERYQGTQGTAICKVFDLAVGATGKNEKQLKQAGIAFEKVYVHTASHASYYPGAEVVSFKLLFDPVKGTIFGAQAVGKDGIDKRIDVMAVAQRAGMTVEQLQHLELSYAPPYGSAKDVINQAAFVASNIIKGDATPIHFDQIDNLSEDQLLLDVRNPGELQNGGLEGAVNIPVDELRDRMHELPKDKEIIIFCQVGLRGNVAYRQLVNNGYRARNLIGGYRTYKFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FAD-dependent pyridine nucleotide-disulphide oxidoreductase
publication title Characterization of an NADH-Dependent Persulfide Reductase from Shewanella loihica PV-4: Implications for the Mechanism of Sulfur Respiration via FAD-Dependent Enzymes .
pubmed doi rcsb
source organism Shewanella loihica
molecule tags Oxidoreductase
total genus 162
structure length 565
sequence length 565
chains with identical sequence B
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2010-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3ntaA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ntaA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ntaA01
1N4UA 4K22A 2FJEA 4JN9A 4C74A 1H82A 2OAMA 3HWIA 1VDCA 2JK6A 3OLHA 5HBQA 3BHKA 3F8PA 3M0OA 2R0GA 1PN0A 2RGJA 2V6OA 1IJHA 3ADAB 3I3UA 2X8CA 4H4YA 2RGHA 2WHDA 2ZZCA 4PABA 3QSEA 2VSWA 1DODA 3UOXA 2DKIA 3AECA 2GQWA 3CNDA 3AE5A 1S3BA 3UTNX 2R46A 3RP7A 1VEEA 4AOXA 2J3NA 3MZZA 4B1BA 3FIMB 3G5QA 5GSNA 2YQUA 2H89A 1GRHA 1CC6A 2YR6A 4JDRA 1W4XA 3CNPA 2V3AA 4JY2A 3ALJA 3VQRA 1CC2A 1PDHA 3CGBA 1X31B 1P2EA 1NG4A 1HYUA 1ZMCA 4NTDA 1S3EA 4AOSA 2R0PA 2C7GA 2IVEA 4U2SA 3UOYA 4YT0A 1COYA 2VRMA 3BNUA 1RYIA 2XFPA 3DK9A 4J57A 3UP4A 2YLWA 3T37A 1NAAA 4H4UA 1E1LA 2GB0A 5BVAA 2QA1A 1IUVA 1CWRA 1DOCA 1JNRA 1F3PA 2GR3A 2ZBWA 2EG4A 3AEFA 1FL2A 4JNQA 3AAXA 3EANA 2BYBA 2KL3A 3D1PA 2WS3A 3LJPA 4LIIA 4EMWA 3O3WA 3D1CA 1S2YA 2WESA 3NTAA 1GERA 1L9DA 2AR8A 4IVOB 1Y56A 5FMHA 1IUWA 1TDEA 2X8GA 4YSXA 2A89A 4K2XA 4KX6A 3GWDA 1GEUA 1GPEA 4CY6A 3P4QA 4OPDA 1DP2A 3SGLA 4DSHA 2WLRA 3GYIA 2C76A 3DH9A 1KNPA 1RP0A 1V59A 2BK5A 4K7ZA 2B7RA 3CTYA 3S5WA 1NHRA 3COXA 2WOIA 2WPFA 4OPCA 4P9SA 3P4RA 4TLZA 1TDOA 2VVLG 4H4SA 3RP6A 4RSLA 4ECHA 2JBVA 1YMKA 2UZZA 3NLCA 1QXNA 3QJ4A 3K7QX 1TRBA 4IV9A 5KOXA 4A99A 1AOGA 4E0VA 3RHAA 2UZQA 4UDQA 2E5VA 1UKVG 1CJ3A 2EQ8A 4B68A 3UKAA 3ISHA 4Y4MA 2GMJA 2XCGA 3GRSA 3NT6A 2YM2A 3BI2A 4JQ9A 4O5QA 1E39A 1GT8A 1PXAA 2JTQA 4I58A 3GDNA 4A7AA 3PVCA 4WH9A 3IHGA 3AE4A 1D4EA 3WE0A 1GRFA 4Z2UA 1FEAA 3CNTA 3P4SA 1VQWA 4U2TA 4CBQA 5HHFA 4EM3A 4YSHA 5U25A 4M52A 2BACA 4NEVA 1GRBA 4D04A 1L9CA 4Z44A 4B64A 3S61A 5KXJA 1DJNA 1H81A 2QA2A 4RG4A 3UKLA 4OPIA 1DOEA 3KLJA 2BXSA 2GV8A 2VQ7A 2WP5A 2RABA 3OZ2A 4C77A 4HB9A 1IUTA 4J33A 2APGA 3UKQA 1BOHA 1K4QA 2V5ZA 1D4CA 3NYCA 5FS6A 1B37A 1QLBA 3UKFA 5JCKA 3IWAA 1C25A 3NRNA 2WDVA 4U8JA 5TR3A 1F8SA 3CIRA 2IVDA 3AD8B 2BC1A 4Z43A 2YLXA 3GDPA 1D4DA 1FEBA 1YQZA 1RHDA 1CJCA 4BK3A 1GTHA 1XHCA 3F4AA 4JGTA 1IUUA 1H86A 2VRLA 2WPEA 3DK4A 2YG6A 3IF9A 4TLXA 2A2KA 4KPRA 3UOZA 3ICRA 2V61A 1XPQA 2CVJA 1GETA 2GAGB 4U8KA 2DKHA 5LAOA 1JNZA 1YQ4A 2OLOA 3F8RA 1EL9A 1QO8A 3KKJA 1DNCA 5IQ1A 4C3XA 2C70A 3FS5A 4Y4LA 2XLUA 2EQ6A 2Q0LA 3B6DA 3PS9A 1EL7A 3B3RA 2BS3A 2B9WA 3ABVA 3AEEA 3DJJA 3AE6A 4K8DA 1Q1WA 3BI5A 2Y6QA 1PBFA 3QSMA 2C67A 1K0IA 1E1MA 2EG4B 4OCGA 2C66A 2WP6A 3AE7A 5GRTA 4UDPA 4YTPA 5J7XA 5HBOA 3G5RA 4PAAA 2R0CA 3LXDA 2E1MA 1Y56B 4BK1A 1GMXA 1BF3A 2BC0A 4EQWA 2CDUA 4EQSA 4BJZA 1IUXA 1MO9A 1TYTA 2GR0A 5JCNA 3REDA 1VRQB 1NDAA 3QFAA 1KF6A 3NN6X 4J36A 3LOVA 4WH7A 2YLTA 2EQ7A 4GDPA 1O94A 4OPUA 1E1KA 3DGZA 1DJQA 4AP3A 5C3JA 3AE2A 4WX1A 1YMDA 2FJBA 2WU5A 3HIXA 4JNAA 4RG3A 1YMLA 2VOUA 3NYFA 3UTEA 3LADA 4EQXA 3FPZA 2VVLA 2BA9A 3KD9A 3URHA 5HYMA 5KOWA 3ITJA 4ICYA 3GD3A 3KU9A 4J31A 1LTXR 1FOHA 2C64A 3M13A 3UTGA 3AEGA 1RSGA 1PXBA 4J56A 4USRA 1OKGA 2Q7VA 2YLRA 3DK8A 2MOLA 4OVIA 4H4ZA 4DGKA 2B9YA 2WOVA 3UKHA 1E7PA 3K30A 5HBPA 4J2WA 4K5SA 4DNAA 5HBLA 1N4WA 2Z5XA 2ZZBA 2ACZA 5CKUA 3UCLA 2GEWA 4ADWA 2R9ZA 1CWSA 2DCQA 3GK5A 5LAMA 1Q1RA 4NTCA 1TDFA 3AYLA 3DA1A 3Q9TA 4C3YA 2A8XA 3E1TA 4H4TA 1BOIA 3ZDNA 2C3CA 2MOIA 1TYPA 1LVLA 4BURA 4CCRA 4YKGA 2GQFA 3DJDA 1O5WA 3VR8A 1JRZA 2GAHB 2VZ2A 4H4VA 2BK3A 2HQMA 2E4GA 4U8PA 4A79A 3UTHA 2X50A 2PHHA 4OPTA 3P1WA 4GCMA 2YWLA 1MXTA 1PHHA 1NHSA 4YSYA 4FDCB 1ZK7A 2AAQA 2A87A 2I0ZA 4ZCCA 3SM8A 3NHOX 4IA6A 1EL5A 3EPTA 1P2HA 1TDNA 3GSIA 3AD9B 1PJ7A 5CQFA 4REKA 2X8HA 2XLTA 5HPAA 1K0LA 2YG3A 2JAEA 1K0JA 3IPPA 3FMWA 2Z5YA 2MRMA 4YTNA 3IWHA 4EM4A 2YLZA 5U1OA 1ZX9A 5BRTA 3ZYXA 1JEHA 2J6PA 2K0ZA 1KFYA 4H2QA 1GRTA 2GF3A 1DOBA 1E6EA 2XFOA 4U8LA 5JCIA 5DBJA 3M12A 3GD4A 4U8IA 2HHGA 2BABA 5IPYA 4D03A 4AP1A 2NPXA 4ZN0A 2GVCA 1M64A 2GR2A 3AXBA 1Z6LA 2R4JA 5EB4A 1NPXA 3FLHA 3NH3X 2GR1A 5KVIA 2V60A 2ORAA 2WBAA 1JRYA 1QB0A 3H8LA 3QVRA 4UP3A 1JRXA 2YLSA 1H83A 1ORBA 4F67A 3G5JA 1OJDA 2YR4A 4APNA 2VQBA 3VRAA 4H4WA 4H4RA 1WV9A 1BGNA 2IFDA 1PJ6A 3ATQA 2CULA 3KVEA 2XLPA 3HZLA 3KPFA 3TP9A 4A6NA 2XFUA 1XDIA 4AT2A 4H4PA 1NG3A 1PJ5A 3EF6A 1GREA 1ZOYA 4TM4A 5C2TA 3P3AA 1D7LA 4I59A 1BKWA 1BWCA 2C65A 3CNJA 3DGHA 1YY5A 1UARA 3AD7B 3GYJA 1ZMDA 2YR5A 5HY5A 1GTEA 3SFDA 4USQA 1DXLA 3GRTA 1CWTA 1EL8A 3CGDA 3JSKA 2O9ZA 2YM1A 3NYEA 1OJTA 4AT0A 1LJ1A 1F6MA 1ELIA 3LB8A 2XLSA 3AE9A 1OJCA 3Q6JA 4MJWA 4H7UA 4EMIA 2NVKX 1CJ2A 1ZP0A 1TDKA 3AYIA 2BCGG 1H4MX 2R4EA 4BJYA 4B63A 2YG7A 1H4KX 3GMCA 4B66A 4FK1C 2OLNA 3H8IA 1EBDA 3V76A 1JU2A 3UP5A 3C4AA 5J60A 4H2RA 4GUVA 4WCTA 2C73A 3DJGX 4Z25A 2ZZ0A 3AEBA 1D5TA 4GR1A 3CPJG 2FJDA 4B69A 2JKCA 3OC4A 3BI4A 3P9UA 2YVJA 1LV0A 2XFQA 2FJAA 3CGCA 3PO7A 1T3KA 5FS9A 3V3NA 3AAYA 3IPOA 2JTRA 3FNJA 4EMJA 4CCQA 1F8WA 2IIDA 1XANA 1GN0A 2QAEA 4GDEA 4C5OA 3GWFA 2TPRA 3NKSA 4YSZA 2C75A 3UKPA 5M10A 1PBBA 1QJDA 4K5RA 3P4PA 3IHMA 1CF3A 4Y4NA 2WDRA 4JY3A 3CN8A 5ER0A 1YKJA 2AQJA 1BGJA 4NTEA 1ZOVA 2YAUA 1IUSA 2XYOA 3BHFA 3R9UA 2OUCA 5BUKA 4DSGA 4CNJA 3L8KA 1D7YA 4H4QA 1HZMA 4N9XA 3C96A 5EB5A 1WHBA 3DMEA 1YQ3A 4U8NA 1Y0PA 2FBWA 4U8OA 3FG2P 1KDGA 1FECA 2Q0KA 1H84A 5HXIA 3UOVA 3NK0X 4CNKA 2C3DA 1OJ9A 1PS9A 3AYJA 2XDOA 1GESA 4Z26A 1GRAA 3CNSA 1M6IA 2BXRA 1FCDA 1RHSA 2Y6RA 2ARDA 4X9NA 2X99A 5FS8A 2OALA 1F8RA 3QVPA 1S2QA 3FBSA 1VG0A 4LA1A 3UTFA 4H2PA 2R45A 3QSSA 4B67A 2H88A 3F8DA 1YS0A 1GSNA 4XWRA 3VRDB 4H2NA 5L46A 3AE8A 1N4VA 3ATRA 3UKKA 4GRTA 2X3NA 3BNMA 1GOSA 1GXFA 4U8MA 4XWZA 1B5QA 1JOAA 2C72A 1L0VA 2PYXA 2JTSA 2EG3A 4A6NB 4B65A 1N1PA 4YWOA 2XVHA 2WEUA 3FOJA 4XXGA 3NK2X 1NEKA 4BK2A 3AEDA 4EIQA 3OP3A 2FSXA 4H50A 3CGEA 1BZLA 1OJAA 3H4KA 3NN0X 4HA6A 4H4XA 4TM0A 2B9XA 2XVIA 4EIPA 1PBDA 1E1NA 1LPFA 1TQ1A 2BS2A 2WQYA 3VRBA 2TMDA 2YVFA 4OPGA 3SFEA 4NEWA 3TG3A 1YM9A 4J34A 3LZXA 2GRTA 2JB2A 5FS7A 2QCUA 2XVFA 3I3LA 1VG9A 3NK1X 4A5LA 3CPHG 4TM3A 1B4VA 1YT8A 4EQRA 1ONFA 2XLRA 1H6VA 2YVGA 2IFVA 2W0HA 2OA1A 2Q6UA 3ILMA 3NG7X 3II4A 4Z24A 1CHUA 1KSUA 1NENA 4O5UA 3NTDA 2CFYA 3K7MX 4LU6A 2RGOA 4YKFA 4ZCDA 1GNDA 2WETA 1CBOA 1LQTA 2XVJA 5JCLA 3KA7A 3K9RA 3AEAA 3L1RA 5KWFA 2GWFA 3CPIG 2B7SA 3NHVA 1B8SA 4YTMA 4A9WA 2BS4A 2F5ZA 4OPLA 1O95A 1SEZA 3RNMA 2GMHA 4YXDA 3AE1A 4FK1A 4X4JA 3O0HA 5U63A 1PBCA 1ZY8A 3R2UA 2EQ9A 5LV9A 1NHQA 3AE3A 2WOWA 4U2LA 4TM1A 3NIXA 2WLXA 2XFNA 4UDRA 3SQPA 3K7TA 1L9EA 4GF7A 1PXCA 3V3OA 1GRGA 3AB1A 2JB1A 1CL0A 3VR9A 3QFBA 2WP9A 1KSSA 5KRQA 3C4NA 1H7XA 1KNRA 3AWIA 3G5SA 3I6DA 4BV6A 4CY8A 1E0CA 3D8XA 1H7WA 2WPCA 5EBKA 5EOWA 3TG1B 3EAOA 2V3BA 1GALA 1ZDLA 3NNEA 4NZHA 4A65A 1URHA 1NHPA 3ICSA 2BK4A 1ZKQA 5M0ZA 2WU2A 2BCPA 1MOKA 4X9MA 3DJEA 2B76A 4CRTA 5IQ4A 1GV4A 1CC4A 2YG5A 2XVEA 4IA5A 3LZWA 4IVMB 1REOA 4Z2TA 3IC9A 2WDQA 5JCMA 3ALMA 4FX9A 2YG4A 3I2VA 2GH5A 3NGCX 1Q9IA 5BULA 5KVHA 4Z2RA 3ICTA 1PBEA 3HZUA 1CJ4A 2VVMA 3ALLA 3GMBA 1LQUA 3RP8A 2JB3A
chains in the Genus database with same CATH superfamily
1N4UA 4K22A 3HYXA 2FJEA 4JN9A 4C74A 1H82A 2OAMA 3HWIA 1VDCA 2JK6A 3OLHA 5HBQA 3BHKA 3F8PA 3M0OA 2R0GA 1PN0A 2RGJA 2V6OA 1IJHA 3ADAB 3I3UA 2X8CA 4H4YA 2RGHA 2WHDA 2ZZCA 4PABA 3QSEA 2VSWA 3GYXA 1DODA 3UOXA 2DKIA 3AECA 2GQWA 3CNDA 3AE5A 1S3BA 3UTNX 2R46A 3RP7A 1VEEA 4AOXA 2J3NA 3MZZA 4B1BA 3FIMB 3G5QA 5GSNA 2YQUA 2H89A 1GRHA 1CC6A 2YR6A 4JDRA 1W4XA 3CNPA 2V3AA 4JY2A 3ALJA 3VQRA 1CC2A 1PDHA 3CGBA 1X31B 1P2EA 4G73A 1NG4A 1HYUA 1ZMCA 4NTDA 1S3EA 4AOSA 2R0PA 2C7GA 2IVEA 4U2SA 3UOYA 4YT0A 1COYA 2VRMA 3BNUA 1RYIA 2XFPA 3DK9A 4J57A 3UP4A 2BRYA 2YLWA 3T37A 1NAAA 4H4UA 1E1LA 2GB0A 5BVAA 2QA1A 1IUVA 1CWRA 1DOCA 1JNRA 1F3PA 2GR3A 2ZBWA 2EG4A 3AEFA 1FL2A 4JNQA 3AAXA 3EANA 2BYBA 2KL3A 3D1PA 2WS3A 3LJPA 4LIIA 4EMWA 3O3WA 3D1CA 1S2YA 2WESA 3NTAA 1GERA 1L9DA 2AR8A 4IVOB 1Y56A 4NNJA 5FMHA 1IUWA 1TDEA 2X8GA 4YSXA 2A89A 4K2XA 4KX6A 3GWDA 1GEUA 1GPEA 4CY6A 3P4QA 4OPDA 1DP2A 3HYVA 3SGLA 4DSHA 2WLRA 3GYIA 2C76A 3DH9A 1KNPA 1RP0A 1V59A 2BK5A 4K7ZA 2B7RA 3CTYA 3S5WA 1NHRA 3COXA 2WOIA 2WPFA 4OPCA 4P9SA 3P4RA 4TLZA 1TDOA 2VVLG 4H4SA 3RP6A 4RSLA 4ECHA 2JBVA 1YMKA 2UZZA 3NLCA 1QXNA 3QJ4A 3K7QX 1TRBA 4IV9A 5KOXA 4A99A 1AOGA 4E0VA 3RHAA 2UZQA 4UDQA 2E5VA 1UKVG 1CJ3A 2EQ8A 4B68A 3UKAA 3ISHA 4Y4MA 2GMJA 2XCGA 3GRSA 3NT6A 2YM2A 3BI2A 4JQ9A 4O5QA 1E39A 1GT8A 4II2A 1PXAA 2JTQA 4I58A 3SX6A 3GDNA 4A7AA 3PVCA 5KMPA 4WH9A 3IHGA 3AE4A 1D4EA 3WE0A 1GRFA 4Z2UA 1FEAA 3CNTA 3P4SA 1VQWA 4U2TA 4CBQA 5HHFA 4EM3A 4YSHA 5U25A 4NWZA 4M52A 2BACA 4NEVA 1GRBA 4D04A 3T31A 1L9CA 4Z44A 4B64A 3S61A 5KXJA 1DJNA 1H81A 2QA2A 4RG4A 3UKLA 4OPIA 1DOEA 3KLJA 2BXSA 2GV8A 2VQ7A 2WP5A 2RABA 3OZ2A 4C77A 4HB9A 1IUTA 4J33A 2APGA 3UKQA 1BOHA 1K4QA 2V5ZA 1D4CA 3NYCA 5FS6A 1B37A 1QLBA 3UKFA 5JCKA 3IWAA 1C25A 3NRNA 2WDVA 4U8JA 5TR3A 1F8SA 3CIRA 2IVDA 3AD8B 3T2KA 2BC1A 4Z43A 2YLXA 3GDPA 1D4DA 1FEBA 1YQZA 1RHDA 1CJCA 4BK3A 1GTHA 1XHCA 3F4AA 4JGTA 1IUUA 1H86A 2VRLA 2WPEA 3DK4A 2YG6A 3IF9A 4TLXA 2A2KA 4KPRA 3UOZA 3ICRA 2V61A 1XPQA 2CVJA 1GETA 2GAGB 4U8KA 2DKHA 5LAOA 1JNZA 1YQ4A 2OLOA 3F8RA 1EL9A 4G9KA 1QO8A 3KKJA 1DNCA 5IQ1A 4C3XA 2C70A 3FS5A 4Y4LA 3T0KA 2XLUA 2EQ6A 2Q0LA 3B6DA 3PS9A 1EL7A 3B3RA 2BS3A 2B9WA 3ABVA 3AEEA 3DJJA 3AE6A 4K8DA 1Q1WA 3BI5A 2Y6QA 5KMRA 1PBFA 3QSMA 2C67A 4G74A 1K0IA 1E1MA 2EG4B 4OCGA 2C66A 2WP6A 3AE7A 5GRTA 4UDPA 4YTPA 5J7XA 5HBOA 3G5RA 4PAAA 2R0CA 3LXDA 2E1MA 1Y56B 4BK1A 1GMXA 1BF3A 2BC0A 4EQWA 2CDUA 4EQSA 4BJZA 1IUXA 1MO9A 1TYTA 2GR0A 5JCNA 3SZFA 3REDA 1VRQB 1NDAA 3QFAA 1KF6A 3NN6X 4J36A 3LOVA 4WH7A 2YLTA 2EQ7A 4GDPA 1O94A 4OPUA 1E1KA 3DGZA 1DJQA 4AP3A 5C3JA 3AE2A 4WX1A 1YMDA 2FJBA 2WU5A 3HIXA 4JNAA 4RG3A 1YMLA 2VOUA 3NYFA 3UTEA 3LADA 4EQXA 3FPZA 2VVLA 2BA9A 3KD9A 3URHA 5HYMA 5KOWA 3ITJA 4ICYA 3GD3A 3KU9A 4J31A 1LTXR 1FOHA 2C64A 3M13A 3UTGA 3AEGA 1RSGA 1PXBA 4J56A 4USRA 1OKGA 2Q7VA 2YLRA 3DK8A 2MOLA 4OVIA 4H4ZA 4DGKA 2B9YA 2WOVA 3UKHA 1E7PA 3K30A 5HBPA 4J2WA 4K5SA 4DNAA 5HBLA 1N4WA 2Z5XA 2ZZBA 2ACZA 5CKUA 3UCLA 2GEWA 4ADWA 2R9ZA 1CWSA 2DCQA 3GK5A 5LAMA 1Q1RA 4NTCA 4II3A 1TDFA 3AYLA 3DA1A 3Q9TA 4C3YA 2A8XA 3E1TA 4H4TA 1BOIA 3ZDNA 2C3CA 2MOIA 1TYPA 1LVLA 4BURA 4CCRA 4YKGA 2GQFA 3T2YA 3DJDA 1O5WA 3VR8A 1JRZA 2GAHB 2VZ2A 3T2ZA 4H4VA 2BK3A 2HQMA 2E4GA 4U8PA 4A79A 3UTHA 2X50A 2PHHA 4OPTA 3P1WA 4GCMA 2YWLA 1MXTA 1PHHA 1NHSA 4YSYA 4FDCB 1ZK7A 2AAQA 2A87A 2I0ZA 4ZCCA 3SM8A 3NHOX 4IA6A 1EL5A 3EPTA 1P2HA 1TDNA 3GSIA 3AD9B 1PJ7A 5CQFA 4REKA 2X8HA 2XLTA 5HPAA 1K0LA 2YG3A 2JAEA 1K0JA 3IPPA 3FMWA 2Z5YA 2MRMA 4YTNA 3IWHA 4EM4A 2YLZA 5U1OA 1ZX9A 5BRTA 3ZYXA 1JEHA 2C4CA 2J6PA 2K0ZA 1KFYA 4H2QA 1GRTA 2GF3A 1DOBA 1E6EA 2XFOA 4U8LA 5JCIA 5DBJA 3M12A 3GD4A 4U8IA 2HHGA 2BABA 5IPYA 4D03A 4AP1A 2NPXA 4ZN0A 2GVCA 1M64A 2GR2A 3AXBA 1Z6LA 2R4JA 5EB4A 1NPXA 3FLHA 3NH3X 2GR1A 5KVIA 2V60A 2ORAA 2WBAA 3CMMA 1JRYA 1QB0A 3H8LA 3QVRA 4UP3A 1JRXA 2Q82A 1H83A 1ORBA 4F67A 3G5JA 1OJDA 2YLSA 2YR4A 4G6HA 4APNA 2VQBA 3VRAA 4H4WA 4H4RA 1WV9A 1BGNA 2IFDA 1PJ6A 3ATQA 2CULA 3KVEA 2XLPA 3HZLA 3KPFA 3TP9A 4A6NA 2XFUA 1XDIA 2BRAA 4H4PA 4AT2A 1NG3A 1PJ5A 3EF6A 1GREA 1ZOYA 4TM4A 5C2TA 3P3AA 1D7LA 4I59A 1BKWA 1BWCA 2C65A 3CNJA 3DGHA 1YY5A 1UARA 3AD7B 3GYJA 5KNLA 1ZMDA 2YR5A 5HY5A 1GTEA 3SFDA 4USQA 1DXLA 3GRTA 1CWTA 1EL8A 3CGDA 3JSKA 2O9ZA 2YM1A 3NYEA 1OJTA 4AT0A 1LJ1A 1F6MA 1ELIA 3LB8A 2XLSA 3AE9A 1OJCA 3Q6JA 4MJWA 4H7UA 4EMIA 2NVKX 1CJ2A 1ZP0A 1TDKA 3AYIA 2BCGG 1H4MX 2R4EA 4BJYA 4B63A 2YG7A 1H4KX 3GMCA 4B66A 4FK1C 2OLNA 3H8IA 1EBDA 3V76A 1JU2A 3UP5A 3C4AA 5J60A 4H2RA 4GUVA 4WCTA 2C73A 3DJGX 4Z25A 2ZZ0A 3AEBA 1D5TA 4GR1A 3CPJG 2FJDA 4B69A 2JKCA 3OC4A 3BI4A 3P9UA 2YVJA 1LV0A 2XFQA 2FJAA 3CGCA 3PO7A 1T3KA 4GAPA 5FS9A 3V3NA 3AAYA 3IPOA 2JTRA 3FNJA 4EMJA 4CCQA 1F8WA 2IIDA 1XANA 1GN0A 2QAEA 4GDEA 4C5OA 3GWFA 3HYWA 2TPRA 3NKSA 4YSZA 2C75A 3T14A 3UKPA 5M10A 1PBBA 1QJDA 4K5RA 3P4PA 3IHMA 1CF3A 4Y4NA 2WDRA 4JY3A 3CN8A 5ER0A 1YKJA 2AQJA 1BGJA 4NTEA 1ZOVA 2YAUA 1IUSA 2XYOA 3BHFA 3R9UA 2OUCA 5BUKA 4DSGA 4CNJA 3L8KA 1D7YA 4H4QA 1HZMA 4N9XA 3C96A 5EB5A 1WHBA 3DMEA 1YQ3A 5KMSA 3KPKA 4U8NA 1Y0PA 2FBWA 4U8OA 3FG2P 1KDGA 1FECA 2Q0KA 1H84A 5HXIA 3UOVA 3NK0X 4CNKA 2C3DA 1OJ9A 1PS9A 3AYJA 2XDOA 1GESA 4Z26A 1GRAA 3CNSA 1M6IA 2BXRA 1FCDA 1RHSA 2Y6RA 2ARDA 4X9NA 2X99A 5FS8A 2OALA 1F8RA 3QVPA 1S2QA 3FBSA 1VG0A 4LA1A 3UTFA 4H2PA 2R45A 3QSSA 4B67A 2H88A 3F8DA 1YS0A 1GSNA 4XWRA 3VRDB 4H2NA 5L46A 3AE8A 1N4VA 3ATRA 3UKKA 4GRTA 2X3NA 3BNMA 1GOSA 1GXFA 4U8MA 4XWZA 1B5QA 1JOAA 2C72A 1L0VA 2PYXA 2JTSA 3SZ0A 2EG3A 4A6NB 4B65A 1N1PA 4YWOA 2XVHA 2WEUA 3FOJA 4XXGA 3NK2X 1NEKA 4BK2A 3AEDA 4EIQA 3OP3A 2FSXA 4H50A 3CGEA 1BZLA 1OJAA 3H4KA 3NN0X 4HA6A 4H4XA 4TM0A 2B9XA 2XVIA 4EIPA 4GAVA 1PBDA 1E1NA 1LPFA 1TQ1A 2BS2A 2WQYA 3VRBA 2TMDA 2YVFA 4OPGA 3SFEA 4NEWA 3TG3A 1YM9A 4J34A 3LZXA 2GRTA 2JB2A 5FS7A 2QCUA 2XVFA 3I3LA 1VG9A 3NK1X 4A5LA 3CPHG 4TM3A 1B4VA 1YT8A 3SXIA 1ONFA 4EQRA 2XLRA 1H6VA 2YVGA 2IFVA 2W0HA 2OA1A 2Q6UA 4G6GA 3ILMA 3NG7X 3SZWA 3II4A 4Z24A 1CHUA 1KSUA 1NENA 4O5UA 3NTDA 2CFYA 3K7MX 4LU6A 3SZCA 2RGOA 4YKFA 4ZCDA 1GNDA 2WETA 1CBOA 1LQTA 2XVJA 5JCLA 3KA7A 3K9RA 3AEAA 3L1RA 5KWFA 2GWFA 3CPIG 2B7SA 3NHVA 1B8SA 4YTMA 4A9WA 2BS4A 2F5ZA 4OPLA 1O95A 1SEZA 3RNMA 2GMHA 4YXDA 3AE1A 4FK1A 3SYIA 4X4JA 3O0HA 5U63A 1PBCA 1ZY8A 3R2UA 2EQ9A 5LV9A 1NHQA 3AE3A 2WOWA 4U2LA 4TM1A 3NIXA 2WLXA 2XFNA 4UDRA 3SQPA 3K7TA 1L9EA 4GF7A 1PXCA 3V3OA 1GRGA 3AB1A 2JB1A 1CL0A 3VR9A 3QFBA 2WP9A 1KSSA 5KRQA 3C4NA 1H7XA 1KNRA 3AWIA 3G5SA 3I6DA 4BV6A 4CY8A 1E0CA 3D8XA 1H7WA 2WPCA 5EBKA 5EOWA 3TG1B 3EAOA 2V3BA 1GALA 1ZDLA 3NNEA 4NZHA 4A65A 3SY4A 1URHA 1NHPA 3ICSA 2BK4A 1ZKQA 5M0ZA 2WU2A 2BCPA 1MOKA 4X9MA 3DJEA 2B76A 4CRTA 5IQ4A 1GV4A 1CC4A 2YG5A 2XVEA 4IA5A 3LZWA 4IVMB 1REOA 4Z2TA 3IC9A 5KMQA 2WDQA 5JCMA 3ALMA 4FX9A 2YG4A 3I2VA 2GH5A 3NGCX 1Q9IA 5BULA 5KVHA 4Z2RA 3ICTA 1PBEA 3HZUA 1CJ4A 2VVMA 3ALLA 3GMBA 1LQUA 3RP8A 2JB3A
chains in the Genus database with same CATH topology
1N4UA 4K22A 3HYXA 2FJEA 4JN9A 4C74A 1H82A 2OAMA 3HWIA 1VDCA 2JK6A 3OLHA 5HBQA 3BHKA 3F8PA 3M0OA 2R0GA 1PN0A 2RGJA 2V6OA 1IJHA 3ADAB 3I3UA 2X8CA 4H4YA 2RGHA 2WHDA 2ZZCA 4PABA 3QSEA 2VSWA 3GYXA 1DODA 3UOXA 2DKIA 3AECA 2GQWA 3CNDA 3AE5A 1S3BA 3UTNX 2R46A 3RP7A 1VEEA 4AOXA 2J3NA 3MZZA 4B1BA 3FIMB 3G5QA 5GSNA 2YQUA 2H89A 1GRHA 1CC6A 2YR6A 4JDRA 1W4XA 3CNPA 2V3AA 4JY2A 3ALJA 3VQRA 1CC2A 1PDHA 3CGBA 1X31B 1P2EA 4G73A 1NG4A 1HYUA 1ZMCA 4NTDA 1S3EA 4AOSA 2R0PA 2C7GA 2IVEA 4U2SA 3UOYA 4YT0A 1COYA 2VRMA 3BNUA 1RYIA 2XFPA 3DK9A 4J57A 3UP4A 2BRYA 2YLWA 3T37A 1NAAA 4H4UA 1E1LA 2GB0A 5BVAA 2QA1A 1IUVA 1CWRA 1DOCA 1JNRA 1F3PA 2GR3A 2ZBWA 2EG4A 3AEFA 1FL2A 4JNQA 3AAXA 3EANA 2BYBA 2KL3A 3D1PA 2WS3A 3LJPA 4LIIA 4EMWA 3O3WA 3D1CA 1S2YA 2WESA 3NTAA 1GERA 1L9DA 2AR8A 4IVOB 1Y56A 4NNJA 5FMHA 1IUWA 1TDEA 2X8GA 4YSXA 2A89A 4K2XA 4KX6A 3GWDA 1GEUA 1GPEA 4CY6A 3P4QA 4OPDA 1DP2A 3HYVA 3SGLA 4DSHA 2WLRA 3GYIA 2C76A 3DH9A 1KNPA 1RP0A 1V59A 2BK5A 4K7ZA 2B7RA 3CTYA 3S5WA 1NHRA 3COXA 2WOIA 2WPFA 4OPCA 4P9SA 3P4RA 4TLZA 1TDOA 2VVLG 4H4SA 3RP6A 4RSLA 4ECHA 2JBVA 1YMKA 2UZZA 3NLCA 1QXNA 3QJ4A 3K7QX 1TRBA 4IV9A 5KOXA 4A99A 1AOGA 4E0VA 3RHAA 2UZQA 4UDQA 2E5VA 1UKVG 1CJ3A 2EQ8A 4B68A 3UKAA 3ISHA 4Y4MA 2GMJA 2XCGA 3GRSA 3NT6A 2YM2A 3BI2A 4JQ9A 4O5QA 1E39A 1GT8A 4II2A 1PXAA 2JTQA 4I58A 3SX6A 3GDNA 4A7AA 3PVCA 5KMPA 4WH9A 3IHGA 3AE4A 1D4EA 3WE0A 1GRFA 4Z2UA 1FEAA 3CNTA 3P4SA 1VQWA 4U2TA 4CBQA 5HHFA 4EM3A 4YSHA 5U25A 4NWZA 4M52A 2BACA 4NEVA 1GRBA 4D04A 3T31A 1L9CA 4Z44A 4B64A 3S61A 5KXJA 1DJNA 1H81A 2QA2A 4RG4A 3UKLA 4OPIA 1DOEA 3KLJA 2BXSA 2GV8A 2VQ7A 2WP5A 2RABA 3OZ2A 4C77A 4HB9A 1IUTA 4J33A 2APGA 3UKQA 1BOHA 1K4QA 2V5ZA 1D4CA 3NYCA 5FS6A 1B37A 1QLBA 3UKFA 5JCKA 3IWAA 1C25A 3NRNA 2WDVA 4U8JA 5TR3A 1F8SA 3CIRA 2IVDA 3AD8B 3T2KA 2BC1A 4Z43A 2YLXA 3GDPA 1D4DA 1FEBA 1YQZA 1RHDA 1CJCA 4BK3A 1GTHA 1XHCA 3F4AA 4JGTA 1IUUA 1H86A 2VRLA 2WPEA 3DK4A 2YG6A 3IF9A 4TLXA 2A2KA 4KPRA 3UOZA 3ICRA 2V61A 1XPQA 2CVJA 1GETA 2GAGB 4U8KA 2DKHA 5LAOA 1JNZA 1YQ4A 2OLOA 3F8RA 1EL9A 4G9KA 1QO8A 3KKJA 1DNCA 5IQ1A 4C3XA 2C70A 3FS5A 4Y4LA 3T0KA 2XLUA 2EQ6A 2Q0LA 3B6DA 3PS9A 1EL7A 3B3RA 2BS3A 2B9WA 3ABVA 3AEEA 3DJJA 3AE6A 4K8DA 1Q1WA 3BI5A 2Y6QA 5KMRA 1PBFA 3QSMA 2C67A 4G74A 1K0IA 1E1MA 2EG4B 4OCGA 2C66A 2WP6A 3AE7A 5GRTA 4UDPA 4YTPA 5J7XA 5HBOA 3G5RA 4PAAA 2R0CA 3LXDA 2E1MA 1Y56B 4BK1A 1GMXA 1BF3A 2BC0A 4EQWA 2CDUA 4EQSA 4BJZA 1IUXA 1MO9A 1TYTA 2GR0A 5JCNA 3SZFA 3REDA 1VRQB 1NDAA 3QFAA 1KF6A 3NN6X 4J36A 3LOVA 4WH7A 2YLTA 2EQ7A 4GDPA 1O94A 4OPUA 1E1KA 3DGZA 1DJQA 4AP3A 5C3JA 3AE2A 4WX1A 1YMDA 2FJBA 2WU5A 3HIXA 4JNAA 4RG3A 1YMLA 2VOUA 3NYFA 3UTEA 3LADA 4EQXA 3FPZA 2VVLA 2BA9A 3KD9A 3URHA 5HYMA 5KOWA 3ITJA 4ICYA 3GD3A 3KU9A 4J31A 1LTXR 1FOHA 2C64A 3M13A 3UTGA 3AEGA 1RSGA 1PXBA 4J56A 4USRA 1OKGA 2Q7VA 2YLRA 3DK8A 2MOLA 4OVIA 4H4ZA 4DGKA 2B9YA 2WOVA 3UKHA 1E7PA 3K30A 5HBPA 4J2WA 4K5SA 4DNAA 5HBLA 1N4WA 2Z5XA 2ZZBA 2ACZA 5CKUA 3UCLA 2GEWA 4ADWA 2R9ZA 1CWSA 2DCQA 3GK5A 5LAMA 1Q1RA 4NTCA 4II3A 1TDFA 3AYLA 3DA1A 3Q9TA 4C3YA 2A8XA 3E1TA 4H4TA 1BOIA 3ZDNA 2C3CA 2MOIA 1TYPA 1LVLA 4BURA 4CCRA 4YKGA 2GQFA 3T2YA 3DJDA 1O5WA 3VR8A 1JRZA 2GAHB 2VZ2A 3T2ZA 4H4VA 2BK3A 2HQMA 2E4GA 4U8PA 4A79A 3UTHA 2X50A 2PHHA 4OPTA 3P1WA 4GCMA 2YWLA 1MXTA 1PHHA 1NHSA 4YSYA 4FDCB 1ZK7A 2AAQA 2A87A 2I0ZA 4ZCCA 3SM8A 3NHOX 4IA6A 1EL5A 3EPTA 1P2HA 1TDNA 3GSIA 3AD9B 1PJ7A 5CQFA 4REKA 2X8HA 2XLTA 5HPAA 1K0LA 2YG3A 2JAEA 1K0JA 3IPPA 3FMWA 2Z5YA 2MRMA 4YTNA 3IWHA 4EM4A 2YLZA 5U1OA 1ZX9A 5BRTA 3ZYXA 1JEHA 2C4CA 2J6PA 2K0ZA 1KFYA 4H2QA 1GRTA 2GF3A 1DOBA 1E6EA 2XFOA 4U8LA 5JCIA 5DBJA 3M12A 3GD4A 4U8IA 2HHGA 2BABA 5IPYA 4D03A 4AP1A 2NPXA 4ZN0A 2GVCA 1M64A 2GR2A 3AXBA 1Z6LA 2R4JA 5EB4A 1NPXA 3FLHA 3NH3X 2GR1A 5KVIA 2V60A 2ORAA 2WBAA 3CMMA 1JRYA 1QB0A 3H8LA 3QVRA 4UP3A 1JRXA 2YLSA 1H83A 1ORBA 4F67A 3G5JA 1OJDA 2YR4A 4G6HA 4APNA 2VQBA 3VRAA 4H4WA 4H4RA 1WV9A 1BGNA 2IFDA 1PJ6A 3ATQA 2CULA 3KVEA 2XLPA 3HZLA 3KPFA 3TP9A 4A6NA 2XFUA 1XDIA 2BRAA 4H4PA 4AT2A 1NG3A 1PJ5A 3EF6A 1GREA 1ZOYA 4TM4A 5C2TA 3P3AA 1D7LA 4I59A 1BKWA 1BWCA 2C65A 3CNJA 3DGHA 1YY5A 1UARA 3AD7B 3GYJA 5KNLA 1ZMDA 2YR5A 5HY5A 1GTEA 3SFDA 4USQA 1DXLA 3GRTA 1CWTA 1EL8A 3CGDA 3JSKA 2O9ZA 2YM1A 3NYEA 1OJTA 4AT0A 1LJ1A 1F6MA 1ELIA 3LB8A 2XLSA 3AE9A 1OJCA 3Q6JA 4MJWA 4H7UA 4EMIA 2NVKX 1CJ2A 1ZP0A 1TDKA 3AYIA 2BCGG 1H4MX 2R4EA 4BJYA 4B63A 2YG7A 1H4KX 3GMCA 4B66A 4FK1C 2OLNA 3H8IA 1EBDA 3V76A 1JU2A 3UP5A 3C4AA 5J60A 4H2RA 4GUVA 4WCTA 2C73A 3DJGX 4Z25A 2ZZ0A 3AEBA 1D5TA 4GR1A 3CPJG 2FJDA 4B69A 2JKCA 3OC4A 3BI4A 3P9UA 2YVJA 1LV0A 2XFQA 2FJAA 3CGCA 3PO7A 1T3KA 4GAPA 5FS9A 3V3NA 3AAYA 3IPOA 2JTRA 3FNJA 4EMJA 4CCQA 1F8WA 2IIDA 1XANA 1GN0A 2QAEA 4GDEA 4C5OA 3GWFA 3HYWA 2TPRA 3NKSA 4YSZA 2C75A 3T14A 3UKPA 5M10A 1PBBA 1QJDA 4K5RA 3P4PA 3IHMA 1CF3A 4Y4NA 2WDRA 4JY3A 3CN8A 5ER0A 1YKJA 2AQJA 1BGJA 4NTEA 1ZOVA 2YAUA 1IUSA 2XYOA 3BHFA 3R9UA 2OUCA 5BUKA 4DSGA 4CNJA 3L8KA 1D7YA 4H4QA 1HZMA 4N9XA 3C96A 5EB5A 1WHBA 3DMEA 1YQ3A 5KMSA 3KPKA 4U8NA 1Y0PA 2FBWA 4U8OA 3FG2P 1KDGA 1FECA 2Q0KA 1H84A 5HXIA 3UOVA 3NK0X 4CNKA 2C3DA 1OJ9A 1PS9A 3AYJA 2XDOA 1GESA 4Z26A 1GRAA 3CNSA 1M6IA 2BXRA 1FCDA 1RHSA 2Y6RA 2ARDA 4X9NA 2X99A 5FS8A 2OALA 1F8RA 3QVPA 1S2QA 3FBSA 1VG0A 4LA1A 3UTFA 4H2PA 2R45A 3QSSA 4B67A 2H88A 3F8DA 1YS0A 1GSNA 4XWRA 3VRDB 4H2NA 5L46A 3AE8A 1N4VA 3ATRA 3UKKA 4GRTA 2X3NA 3BNMA 1GOSA 1GXFA 4U8MA 4XWZA 1B5QA 1JOAA 2C72A 1L0VA 2PYXA 2JTSA 3SZ0A 2EG3A 4A6NB 4B65A 1N1PA 4YWOA 2XVHA 2WEUA 3FOJA 4XXGA 3NK2X 1NEKA 4BK2A 3AEDA 4EIQA 3OP3A 2FSXA 4H50A 3CGEA 1BZLA 1OJAA 3H4KA 3NN0X 4HA6A 4H4XA 4TM0A 2B9XA 2XVIA 4EIPA 4GAVA 1PBDA 1E1NA 1LPFA 1TQ1A 2BS2A 2WQYA 3VRBA 2TMDA 2YVFA 4OPGA 3SFEA 4NEWA 3TG3A 1YM9A 4J34A 3LZXA 2GRTA 2JB2A 5FS7A 2QCUA 2XVFA 3I3LA 1VG9A 3NK1X 4A5LA 3CPHG 4TM3A 1B4VA 1YT8A 3SXIA 1ONFA 4EQRA 2XLRA 1H6VA 2YVGA 2IFVA 2W0HA 2OA1A 2Q6UA 4G6GA 3ILMA 3NG7X 3SZWA 3II4A 4Z24A 1CHUA 1KSUA 1NENA 4O5UA 3NTDA 2CFYA 3K7MX 4LU6A 3SZCA 2RGOA 4YKFA 4ZCDA 1GNDA 2WETA 1CBOA 1LQTA 2XVJA 5JCLA 3KA7A 3K9RA 3AEAA 3L1RA 5KWFA 2GWFA 3CPIG 2B7SA 3NHVA 1B8SA 4YTMA 4A9WA 2BS4A 2F5ZA 4OPLA 1O95A 1SEZA 3RNMA 2GMHA 4YXDA 3AE1A 4FK1A 3SYIA 4X4JA 3O0HA 5U63A 1PBCA 1ZY8A 3R2UA 2EQ9A 5LV9A 1NHQA 3AE3A 2WOWA 4U2LA 4TM1A 3NIXA 2WLXA 2XFNA 4UDRA 3SQPA 3K7TA 1L9EA 4GF7A 1PXCA 3V3OA 1GRGA 3AB1A 2JB1A 1CL0A 3VR9A 3QFBA 2WP9A 1KSSA 5KRQA 3C4NA 1H7XA 1KNRA 3AWIA 3G5SA 3I6DA 4BV6A 4CY8A 1E0CA 3D8XA 1H7WA 2WPCA 5EBKA 5EOWA 3TG1B 3EAOA 2V3BA 1GALA 1ZDLA 3NNEA 4NZHA 4A65A 3SY4A 1URHA 1NHPA 3ICSA 2BK4A 1ZKQA 5M0ZA 2WU2A 2BCPA 1MOKA 4X9MA 3DJEA 2B76A 4CRTA 5IQ4A 1GV4A 1CC4A 2YG5A 2XVEA 4IA5A 3LZWA 4IVMB 1REOA 4Z2TA 3IC9A 5KMQA 2WDQA 5JCMA 3ALMA 4FX9A 2YG4A 3I2VA 2GH5A 3NGCX 1Q9IA 5BULA 5KVHA 4Z2RA 3ICTA 1PBEA 3HZUA 1CJ4A 2VVMA 3ALLA 3GMBA 1LQUA 3RP8A 2JB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4U A;  4K22 A;  2FJE A;  4JN9 A;  4C74 A;  1H82 A;  2OAM A;  3HWI A;  1VDC A;  2JK6 A;  3OLH A;  5HBQ A;  3BHK A;  3F8P A;  3M0O A;  2R0G A;  1PN0 A;  2RGJ A;  2V6O A;  1IJH A;  3ADA B;  3I3U A;  2X8C A;  4H4Y A;  2RGH A;  2WHD A;  2ZZC A;  4PAB A;  3QSE A;  2VSW A;  1DOD A;  3UOX A;  2DKI A;  3AEC A;  2GQW A;  3CND A;  3AE5 A;  1S3B A;  3UTN X;  2R46 A;  3RP7 A;  1VEE A;  4AOX A;  2J3N A;  3MZZ A;  4B1B A;  3FIM B;  3G5Q A;  5GSN A;  2YQU A;  2H89 A;  1GRH A;  1CC6 A;  2YR6 A;  4JDR A;  1W4X A;  3CNP A;  2V3A A;  4JY2 A;  3ALJ A;  3VQR A;  1CC2 A;  1PDH A;  3CGB A;  1X31 B;  1P2E A;  1NG4 A;  1HYU A;  1ZMC A;  4NTD A;  1S3E A;  4AOS A;  2R0P A;  2C7G A;  2IVE A;  4U2S A;  3UOY A;  4YT0 A;  1COY A;  2VRM A;  3BNU A;  1RYI A;  2XFP A;  3DK9 A;  4J57 A;  3UP4 A;  2YLW A;  3T37 A;  1NAA A;  4H4U A;  1E1L A;  2GB0 A;  5BVA A;  2QA1 A;  1IUV A;  1CWR A;  1DOC A;  1JNR A;  1F3P A;  2GR3 A;  2ZBW A;  2EG4 A;  3AEF A;  1FL2 A;  4JNQ A;  3AAX A;  3EAN A;  2BYB A;  2KL3 A;  3D1P A;  2WS3 A;  3LJP A;  4LII A;  4EMW A;  3O3W A;  3D1C A;  1S2Y A;  2WES A;  3NTA A;  1GER A;  1L9D A;  2AR8 A;  4IVO B;  1Y56 A;  5FMH A;  1IUW A;  1TDE A;  2X8G A;  4YSX A;  2A89 A;  4K2X A;  4KX6 A;  3GWD A;  1GEU A;  1GPE A;  4CY6 A;  3P4Q A;  4OPD A;  1DP2 A;  3SGL A;  4DSH A;  2WLR A;  3GYI A;  2C76 A;  3DH9 A;  1KNP A;  1RP0 A;  1V59 A;  2BK5 A;  4K7Z A;  2B7R A;  3CTY A;  3S5W A;  1NHR A;  3COX A;  2WOI A;  2WPF A;  4OPC A;  4P9S A;  3P4R A;  4TLZ A;  1TDO A;  2VVL G;  4H4S A;  3RP6 A;  4RSL A;  4ECH A;  2JBV A;  1YMK A;  2UZZ A;  3NLC A;  1QXN A;  3QJ4 A;  3K7Q X;  1TRB A;  4IV9 A;  5KOX A;  4A99 A;  1AOG A;  4E0V A;  3RHA A;  2UZQ A;  4UDQ A;  2E5V A;  1UKV G;  1CJ3 A;  2EQ8 A;  4B68 A;  3UKA A;  3ISH A;  4Y4M A;  2GMJ A;  2XCG A;  3GRS A;  3NT6 A;  2YM2 A;  3BI2 A;  4JQ9 A;  4O5Q A;  1E39 A;  1GT8 A;  1PXA A;  2JTQ A;  4I58 A;  3GDN A;  4A7A A;  3PVC A;  4WH9 A;  3IHG A;  3AE4 A;  1D4E A;  3WE0 A;  1GRF A;  4Z2U A;  1FEA A;  3CNT A;  3P4S A;  1VQW A;  4U2T A;  4CBQ A;  5HHF A;  4EM3 A;  4YSH A;  5U25 A;  4M52 A;  2BAC A;  4NEV A;  1GRB A;  4D04 A;  1L9C A;  4Z44 A;  4B64 A;  3S61 A;  5KXJ A;  1DJN A;  1H81 A;  2QA2 A;  4RG4 A;  3UKL A;  4OPI A;  1DOE A;  3KLJ A;  2BXS A;  2GV8 A;  2VQ7 A;  2WP5 A;  2RAB A;  3OZ2 A;  4C77 A;  4HB9 A;  1IUT A;  4J33 A;  2APG A;  3UKQ A;  1BOH A;  1K4Q A;  2V5Z A;  1D4C A;  3NYC A;  5FS6 A;  1B37 A;  1QLB A;  3UKF A;  5JCK A;  3IWA A;  1C25 A;  3NRN A;  2WDV A;  4U8J A;  5TR3 A;  1F8S A;  3CIR A;  2IVD A;  3AD8 B;  2BC1 A;  4Z43 A;  2YLX A;  3GDP A;  1D4D A;  1FEB A;  1YQZ A;  1RHD A;  1CJC A;  4BK3 A;  1GTH A;  1XHC A;  3F4A A;  4JGT A;  1IUU A;  1H86 A;  2VRL A;  2WPE A;  3DK4 A;  2YG6 A;  3IF9 A;  4TLX A;  2A2K A;  4KPR A;  3UOZ A;  3ICR A;  2V61 A;  1XPQ A;  2CVJ A;  1GET A;  2GAG B;  4U8K A;  2DKH A;  5LAO A;  1JNZ A;  1YQ4 A;  2OLO A;  3F8R A;  1EL9 A;  1QO8 A;  3KKJ A;  1DNC A;  5IQ1 A;  4C3X A;  2C70 A;  3FS5 A;  4Y4L A;  2XLU A;  2EQ6 A;  2Q0L A;  3B6D A;  3PS9 A;  1EL7 A;  3B3R A;  2BS3 A;  2B9W A;  3ABV A;  3AEE A;  3DJJ A;  3AE6 A;  4K8D A;  1Q1W A;  3BI5 A;  2Y6Q A;  1PBF A;  3QSM A;  2C67 A;  1K0I A;  1E1M A;  2EG4 B;  4OCG A;  2C66 A;  2WP6 A;  3AE7 A;  5GRT A;  4UDP A;  4YTP A;  5J7X A;  5HBO A;  3G5R A;  4PAA A;  2R0C A;  3LXD A;  2E1M A;  1Y56 B;  4BK1 A;  1GMX A;  1BF3 A;  2BC0 A;  4EQW A;  2CDU A;  4EQS A;  4BJZ A;  1IUX A;  1MO9 A;  1TYT A;  2GR0 A;  5JCN A;  3RED A;  1VRQ B;  1NDA A;  3QFA A;  1KF6 A;  3NN6 X;  4J36 A;  3LOV A;  4WH7 A;  2YLT A;  2EQ7 A;  4GDP A;  1O94 A;  4OPU A;  1E1K A;  3DGZ A;  1DJQ A;  4AP3 A;  5C3J A;  3AE2 A;  4WX1 A;  1YMD A;  2FJB A;  2WU5 A;  3HIX A;  4JNA A;  4RG3 A;  1YML A;  2VOU A;  3NYF A;  3UTE A;  3LAD A;  4EQX A;  3FPZ A;  2VVL A;  2BA9 A;  3KD9 A;  3URH A;  5HYM A;  5KOW A;  3ITJ A;  4ICY A;  3GD3 A;  3KU9 A;  4J31 A;  1LTX R;  1FOH A;  2C64 A;  3M13 A;  3UTG A;  3AEG A;  1RSG A;  1PXB A;  4J56 A;  4USR A;  1OKG A;  2Q7V A;  2YLR A;  3DK8 A;  2MOL A;  4OVI A;  4H4Z A;  4DGK A;  2B9Y A;  2WOV A;  3UKH A;  1E7P A;  3K30 A;  5HBP A;  4J2W A;  4K5S A;  4DNA A;  5HBL A;  1N4W A;  2Z5X A;  2ZZB A;  2ACZ A;  5CKU A;  3UCL A;  2GEW A;  4ADW A;  2R9Z A;  1CWS A;  2DCQ A;  3GK5 A;  5LAM A;  1Q1R A;  4NTC A;  1TDF A;  3AYL A;  3DA1 A;  3Q9T A;  4C3Y A;  2A8X A;  3E1T A;  4H4T A;  1BOI A;  3ZDN A;  2C3C A;  2MOI A;  1TYP A;  1LVL A;  4BUR A;  4CCR A;  4YKG A;  2GQF A;  3DJD A;  1O5W A;  3VR8 A;  1JRZ A;  2GAH B;  2VZ2 A;  4H4V A;  2BK3 A;  2HQM A;  2E4G A;  4U8P A;  4A79 A;  3UTH A;  2X50 A;  2PHH A;  4OPT A;  3P1W A;  4GCM A;  2YWL A;  1MXT A;  1PHH A;  1NHS A;  4YSY A;  4FDC B;  1ZK7 A;  2AAQ A;  2A87 A;  2I0Z A;  4ZCC A;  3SM8 A;  3NHO X;  4IA6 A;  1EL5 A;  3EPT A;  1P2H A;  1TDN A;  3GSI A;  3AD9 B;  1PJ7 A;  5CQF A;  4REK A;  2X8H A;  2XLT A;  5HPA A;  1K0L A;  2YG3 A;  2JAE A;  1K0J A;  3IPP A;  3FMW A;  2Z5Y A;  2MRM A;  4YTN A;  3IWH A;  4EM4 A;  2YLZ A;  5U1O A;  1ZX9 A;  5BRT A;  3ZYX A;  1JEH A;  2J6P A;  2K0Z A;  1KFY A;  4H2Q A;  1GRT A;  2GF3 A;  1DOB A;  1E6E A;  2XFO A;  4U8L A;  5JCI A;  5DBJ A;  3M12 A;  3GD4 A;  4U8I A;  2HHG A;  2BAB A;  5IPY A;  4D03 A;  4AP1 A;  2NPX A;  4ZN0 A;  2GVC A;  1M64 A;  2GR2 A;  3AXB A;  1Z6L A;  2R4J A;  5EB4 A;  1NPX A;  3FLH A;  3NH3 X;  2GR1 A;  5KVI A;  2V60 A;  2ORA A;  2WBA A;  1JRY A;  1QB0 A;  3H8L A;  3QVR A;  4UP3 A;  1JRX A;  2YLS A;  1H83 A;  1ORB A;  4F67 A;  3G5J A;  1OJD A;  2YR4 A;  4APN A;  2VQB A;  3VRA A;  4H4W A;  4H4R A;  1WV9 A;  1BGN A;  2IFD A;  1PJ6 A;  3ATQ A;  2CUL A;  3KVE A;  2XLP A;  3HZL A;  3KPF A;  3TP9 A;  4A6N A;  2XFU A;  1XDI A;  4AT2 A;  4H4P A;  1NG3 A;  1PJ5 A;  3EF6 A;  1GRE A;  1ZOY A;  4TM4 A;  5C2T A;  3P3A A;  1D7L A;  4I59 A;  1BKW A;  1BWC A;  2C65 A;  3CNJ A;  3DGH A;  1YY5 A;  1UAR A;  3AD7 B;  3GYJ A;  1ZMD A;  2YR5 A;  5HY5 A;  1GTE A;  3SFD A;  4USQ A;  1DXL A;  3GRT A;  1CWT A;  1EL8 A;  3CGD A;  3JSK A;  2O9Z A;  2YM1 A;  3NYE A;  1OJT A;  4AT0 A;  1LJ1 A;  1F6M A;  1ELI A;  3LB8 A;  2XLS A;  3AE9 A;  1OJC A;  3Q6J A;  4MJW A;  4H7U A;  4EMI A;  2NVK X;  1CJ2 A;  1ZP0 A;  1TDK A;  3AYI A;  2BCG G;  1H4M X;  2R4E A;  4BJY A;  4B63 A;  2YG7 A;  1H4K X;  3GMC A;  4B66 A;  4FK1 C;  2OLN A;  3H8I A;  1EBD A;  3V76 A;  1JU2 A;  3UP5 A;  3C4A A;  5J60 A;  4H2R A;  4GUV A;  4WCT A;  2C73 A;  3DJG X;  4Z25 A;  2ZZ0 A;  3AEB A;  1D5T A;  4GR1 A;  3CPJ G;  2FJD A;  4B69 A;  2JKC A;  3OC4 A;  3BI4 A;  3P9U A;  2YVJ A;  1LV0 A;  2XFQ A;  2FJA A;  3CGC A;  3PO7 A;  1T3K A;  5FS9 A;  3V3N A;  3AAY A;  3IPO A;  2JTR A;  3FNJ A;  4EMJ A;  4CCQ A;  1F8W A;  2IID A;  1XAN A;  1GN0 A;  2QAE A;  4GDE A;  4C5O A;  3GWF A;  2TPR A;  3NKS A;  4YSZ A;  2C75 A;  3UKP A;  5M10 A;  1PBB A;  1QJD A;  4K5R A;  3P4P A;  3IHM A;  1CF3 A;  4Y4N A;  2WDR A;  4JY3 A;  3CN8 A;  5ER0 A;  1YKJ A;  2AQJ A;  1BGJ A;  4NTE A;  1ZOV A;  2YAU A;  1IUS A;  2XYO A;  3BHF A;  3R9U A;  2OUC A;  5BUK A;  4DSG A;  4CNJ A;  3L8K A;  1D7Y A;  4H4Q A;  1HZM A;  4N9X A;  3C96 A;  5EB5 A;  1WHB A;  3DME A;  1YQ3 A;  4U8N A;  1Y0P A;  2FBW A;  4U8O A;  3FG2 P;  1KDG A;  1FEC A;  2Q0K A;  1H84 A;  5HXI A;  3UOV A;  3NK0 X;  4CNK A;  2C3D A;  1OJ9 A;  1PS9 A;  3AYJ A;  2XDO A;  1GES A;  4Z26 A;  1GRA A;  3CNS A;  1M6I A;  2BXR A;  1FCD A;  1RHS A;  2Y6R A;  2ARD A;  4X9N A;  2X99 A;  5FS8 A;  2OAL A;  1F8R A;  3QVP A;  1S2Q A;  3FBS A;  1VG0 A;  4LA1 A;  3UTF A;  4H2P A;  2R45 A;  3QSS A;  4B67 A;  2H88 A;  3F8D A;  1YS0 A;  1GSN A;  4XWR A;  3VRD B;  4H2N A;  5L46 A;  3AE8 A;  1N4V A;  3ATR A;  3UKK A;  4GRT A;  2X3N A;  3BNM A;  1GOS A;  1GXF A;  4U8M A;  4XWZ A;  1B5Q A;  1JOA A;  2C72 A;  1L0V A;  2PYX A;  2JTS A;  2EG3 A;  4A6N B;  4B65 A;  1N1P A;  4YWO A;  2XVH A;  2WEU A;  3FOJ A;  4XXG A;  3NK2 X;  1NEK A;  4BK2 A;  3AED A;  4EIQ A;  3OP3 A;  2FSX A;  4H50 A;  3CGE A;  1BZL A;  1OJA A;  3H4K A;  3NN0 X;  4HA6 A;  4H4X A;  4TM0 A;  2B9X A;  2XVI A;  4EIP A;  1PBD A;  1E1N A;  1LPF A;  1TQ1 A;  2BS2 A;  2WQY A;  3VRB A;  2TMD A;  2YVF A;  4OPG A;  3SFE A;  4NEW A;  3TG3 A;  1YM9 A;  4J34 A;  3LZX A;  2GRT A;  2JB2 A;  5FS7 A;  2QCU A;  2XVF A;  3I3L A;  1VG9 A;  3NK1 X;  4A5L A;  3CPH G;  4TM3 A;  1B4V A;  1YT8 A;  4EQR A;  1ONF A;  2XLR A;  1H6V A;  2YVG A;  2IFV A;  2W0H A;  2OA1 A;  2Q6U A;  3ILM A;  3NG7 X;  3II4 A;  4Z24 A;  1CHU A;  1KSU A;  1NEN A;  4O5U A;  3NTD A;  2CFY A;  3K7M X;  4LU6 A;  2RGO A;  4YKF A;  4ZCD A;  1GND A;  2WET A;  1CBO A;  1LQT A;  2XVJ A;  5JCL A;  3KA7 A;  3K9R A;  3AEA A;  3L1R A;  5KWF A;  2GWF A;  3CPI G;  2B7S A;  3NHV A;  1B8S A;  4YTM A;  4A9W A;  2BS4 A;  2F5Z A;  4OPL A;  1O95 A;  1SEZ A;  3RNM A;  2GMH A;  4YXD A;  3AE1 A;  4FK1 A;  4X4J A;  3O0H A;  5U63 A;  1PBC A;  1ZY8 A;  3R2U A;  2EQ9 A;  5LV9 A;  1NHQ A;  3AE3 A;  2WOW A;  4U2L A;  4TM1 A;  3NIX A;  2WLX A;  2XFN A;  4UDR A;  3SQP A;  3K7T A;  1L9E A;  4GF7 A;  1PXC A;  3V3O A;  1GRG A;  3AB1 A;  2JB1 A;  1CL0 A;  3VR9 A;  3QFB A;  2WP9 A;  1KSS A;  5KRQ A;  3C4N A;  1H7X A;  1KNR A;  3AWI A;  3G5S A;  3I6D A;  4BV6 A;  4CY8 A;  1E0C A;  3D8X A;  1H7W A;  2WPC A;  5EBK A;  5EOW A;  3TG1 B;  3EAO A;  2V3B A;  1GAL A;  1ZDL A;  3NNE A;  4NZH A;  4A65 A;  1URH A;  1NHP A;  3ICS A;  2BK4 A;  1ZKQ A;  5M0Z A;  2WU2 A;  2BCP A;  1MOK A;  4X9M A;  3DJE A;  2B76 A;  4CRT A;  5IQ4 A;  1GV4 A;  1CC4 A;  2YG5 A;  2XVE A;  4IA5 A;  3LZW A;  4IVM B;  1REO A;  4Z2T A;  3IC9 A;  2WDQ A;  5JCM A;  3ALM A;  4FX9 A;  2YG4 A;  3I2V A;  2GH5 A;  3NGC X;  1Q9I A;  5BUL A;  5KVH A;  4Z2R A;  3ICT A;  1PBE A;  3HZU A;  1CJ4 A;  2VVM A;  3ALL A;  3GMB A;  1LQU A;  3RP8 A;  2JB3 A; 
#chains in the Genus database with same CATH topology
 1N4U A;  4K22 A;  3HYX A;  2FJE A;  4JN9 A;  4C74 A;  1H82 A;  2OAM A;  3HWI A;  1VDC A;  2JK6 A;  3OLH A;  5HBQ A;  3BHK A;  3F8P A;  3M0O A;  2R0G A;  1PN0 A;  2RGJ A;  2V6O A;  1IJH A;  3ADA B;  3I3U A;  2X8C A;  4H4Y A;  2RGH A;  2WHD A;  2ZZC A;  4PAB A;  3QSE A;  2VSW A;  3GYX A;  1DOD A;  3UOX A;  2DKI A;  3AEC A;  2GQW A;  3CND A;  3AE5 A;  1S3B A;  3UTN X;  2R46 A;  3RP7 A;  1VEE A;  4AOX A;  2J3N A;  3MZZ A;  4B1B A;  3FIM B;  3G5Q A;  5GSN A;  2YQU A;  2H89 A;  1GRH A;  1CC6 A;  2YR6 A;  4JDR A;  1W4X A;  3CNP A;  2V3A A;  4JY2 A;  3ALJ A;  3VQR A;  1CC2 A;  1PDH A;  3CGB A;  1X31 B;  1P2E A;  4G73 A;  1NG4 A;  1HYU A;  1ZMC A;  4NTD A;  1S3E A;  4AOS A;  2R0P A;  2C7G A;  2IVE A;  4U2S A;  3UOY A;  4YT0 A;  1COY A;  2VRM A;  3BNU A;  1RYI A;  2XFP A;  3DK9 A;  4J57 A;  3UP4 A;  2BRY A;  2YLW A;  3T37 A;  1NAA A;  4H4U A;  1E1L A;  2GB0 A;  5BVA A;  2QA1 A;  1IUV A;  1CWR A;  1DOC A;  1JNR A;  1F3P A;  2GR3 A;  2ZBW A;  2EG4 A;  3AEF A;  1FL2 A;  4JNQ A;  3AAX A;  3EAN A;  2BYB A;  2KL3 A;  3D1P A;  2WS3 A;  3LJP A;  4LII A;  4EMW A;  3O3W A;  3D1C A;  1S2Y A;  2WES A;  3NTA A;  1GER A;  1L9D A;  2AR8 A;  4IVO B;  1Y56 A;  4NNJ A;  5FMH A;  1IUW A;  1TDE A;  2X8G A;  4YSX A;  2A89 A;  4K2X A;  4KX6 A;  3GWD A;  1GEU A;  1GPE A;  4CY6 A;  3P4Q A;  4OPD A;  1DP2 A;  3HYV A;  3SGL A;  4DSH A;  2WLR A;  3GYI A;  2C76 A;  3DH9 A;  1KNP A;  1RP0 A;  1V59 A;  2BK5 A;  4K7Z A;  2B7R A;  3CTY A;  3S5W A;  1NHR A;  3COX A;  2WOI A;  2WPF A;  4OPC A;  4P9S A;  3P4R A;  4TLZ A;  1TDO A;  2VVL G;  4H4S A;  3RP6 A;  4RSL A;  4ECH A;  2JBV A;  1YMK A;  2UZZ A;  3NLC A;  1QXN A;  3QJ4 A;  3K7Q X;  1TRB A;  4IV9 A;  5KOX A;  4A99 A;  1AOG A;  4E0V A;  3RHA A;  2UZQ A;  4UDQ A;  2E5V A;  1UKV G;  1CJ3 A;  2EQ8 A;  4B68 A;  3UKA A;  3ISH A;  4Y4M A;  2GMJ A;  2XCG A;  3GRS A;  3NT6 A;  2YM2 A;  3BI2 A;  4JQ9 A;  4O5Q A;  1E39 A;  1GT8 A;  4II2 A;  1PXA A;  2JTQ A;  4I58 A;  3SX6 A;  3GDN A;  4A7A A;  3PVC A;  5KMP A;  4WH9 A;  3IHG A;  3AE4 A;  1D4E A;  3WE0 A;  1GRF A;  4Z2U A;  1FEA A;  3CNT A;  3P4S A;  1VQW A;  4U2T A;  4CBQ A;  5HHF A;  4EM3 A;  4YSH A;  5U25 A;  4NWZ A;  4M52 A;  2BAC A;  4NEV A;  1GRB A;  4D04 A;  3T31 A;  1L9C A;  4Z44 A;  4B64 A;  3S61 A;  5KXJ A;  1DJN A;  1H81 A;  2QA2 A;  4RG4 A;  3UKL A;  4OPI A;  1DOE A;  3KLJ A;  2BXS A;  2GV8 A;  2VQ7 A;  2WP5 A;  2RAB A;  3OZ2 A;  4C77 A;  4HB9 A;  1IUT A;  4J33 A;  2APG A;  3UKQ A;  1BOH A;  1K4Q A;  2V5Z A;  1D4C A;  3NYC A;  5FS6 A;  1B37 A;  1QLB A;  3UKF A;  5JCK A;  3IWA A;  1C25 A;  3NRN A;  2WDV A;  4U8J A;  5TR3 A;  1F8S A;  3CIR A;  2IVD A;  3AD8 B;  3T2K A;  2BC1 A;  4Z43 A;  2YLX A;  3GDP A;  1D4D A;  1FEB A;  1YQZ A;  1RHD A;  1CJC A;  4BK3 A;  1GTH A;  1XHC A;  3F4A A;  4JGT A;  1IUU A;  1H86 A;  2VRL A;  2WPE A;  3DK4 A;  2YG6 A;  3IF9 A;  4TLX A;  2A2K A;  4KPR A;  3UOZ A;  3ICR A;  2V61 A;  1XPQ A;  2CVJ A;  1GET A;  2GAG B;  4U8K A;  2DKH A;  5LAO A;  1JNZ A;  1YQ4 A;  2OLO A;  3F8R A;  1EL9 A;  4G9K A;  1QO8 A;  3KKJ A;  1DNC A;  5IQ1 A;  4C3X A;  2C70 A;  3FS5 A;  4Y4L A;  3T0K A;  2XLU A;  2EQ6 A;  2Q0L A;  3B6D A;  3PS9 A;  1EL7 A;  3B3R A;  2BS3 A;  2B9W A;  3ABV A;  3AEE A;  3DJJ A;  3AE6 A;  4K8D A;  1Q1W A;  3BI5 A;  2Y6Q A;  5KMR A;  1PBF A;  3QSM A;  2C67 A;  4G74 A;  1K0I A;  1E1M A;  2EG4 B;  4OCG A;  2C66 A;  2WP6 A;  3AE7 A;  5GRT A;  4UDP A;  4YTP A;  5J7X A;  5HBO A;  3G5R A;  4PAA A;  2R0C A;  3LXD A;  2E1M A;  1Y56 B;  4BK1 A;  1GMX A;  1BF3 A;  2BC0 A;  4EQW A;  2CDU A;  4EQS A;  4BJZ A;  1IUX A;  1MO9 A;  1TYT A;  2GR0 A;  5JCN A;  3SZF A;  3RED A;  1VRQ B;  1NDA A;  3QFA A;  1KF6 A;  3NN6 X;  4J36 A;  3LOV A;  4WH7 A;  2YLT A;  2EQ7 A;  4GDP A;  1O94 A;  4OPU A;  1E1K A;  3DGZ A;  1DJQ A;  4AP3 A;  5C3J A;  3AE2 A;  4WX1 A;  1YMD A;  2FJB A;  2WU5 A;  3HIX A;  4JNA A;  4RG3 A;  1YML A;  2VOU A;  3NYF A;  3UTE A;  3LAD A;  4EQX A;  3FPZ A;  2VVL A;  2BA9 A;  3KD9 A;  3URH A;  5HYM A;  5KOW A;  3ITJ A;  4ICY A;  3GD3 A;  3KU9 A;  4J31 A;  1LTX R;  1FOH A;  2C64 A;  3M13 A;  3UTG A;  3AEG A;  1RSG A;  1PXB A;  4J56 A;  4USR A;  1OKG A;  2Q7V A;  2YLR A;  3DK8 A;  2MOL A;  4OVI A;  4H4Z A;  4DGK A;  2B9Y A;  2WOV A;  3UKH A;  1E7P A;  3K30 A;  5HBP A;  4J2W A;  4K5S A;  4DNA A;  5HBL A;  1N4W A;  2Z5X A;  2ZZB A;  2ACZ A;  5CKU A;  3UCL A;  2GEW A;  4ADW A;  2R9Z A;  1CWS A;  2DCQ A;  3GK5 A;  5LAM A;  1Q1R A;  4NTC A;  4II3 A;  1TDF A;  3AYL A;  3DA1 A;  3Q9T A;  4C3Y A;  2A8X A;  3E1T A;  4H4T A;  1BOI A;  3ZDN A;  2C3C A;  2MOI A;  1TYP A;  1LVL A;  4BUR A;  4CCR A;  4YKG A;  2GQF A;  3T2Y A;  3DJD A;  1O5W A;  3VR8 A;  1JRZ A;  2GAH B;  2VZ2 A;  3T2Z A;  4H4V A;  2BK3 A;  2HQM A;  2E4G A;  4U8P A;  4A79 A;  3UTH A;  2X50 A;  2PHH A;  4OPT A;  3P1W A;  4GCM A;  2YWL A;  1MXT A;  1PHH A;  1NHS A;  4YSY A;  4FDC B;  1ZK7 A;  2AAQ A;  2A87 A;  2I0Z A;  4ZCC A;  3SM8 A;  3NHO X;  4IA6 A;  1EL5 A;  3EPT A;  1P2H A;  1TDN A;  3GSI A;  3AD9 B;  1PJ7 A;  5CQF A;  4REK A;  2X8H A;  2XLT A;  5HPA A;  1K0L A;  2YG3 A;  2JAE A;  1K0J A;  3IPP A;  3FMW A;  2Z5Y A;  2MRM A;  4YTN A;  3IWH A;  4EM4 A;  2YLZ A;  5U1O A;  1ZX9 A;  5BRT A;  3ZYX A;  1JEH A;  2C4C A;  2J6P A;  2K0Z A;  1KFY A;  4H2Q A;  1GRT A;  2GF3 A;  1DOB A;  1E6E A;  2XFO A;  4U8L A;  5JCI A;  5DBJ A;  3M12 A;  3GD4 A;  4U8I A;  2HHG A;  2BAB A;  5IPY A;  4D03 A;  4AP1 A;  2NPX A;  4ZN0 A;  2GVC A;  1M64 A;  2GR2 A;  3AXB A;  1Z6L A;  2R4J A;  5EB4 A;  1NPX A;  3FLH A;  3NH3 X;  2GR1 A;  5KVI A;  2V60 A;  2ORA A;  2WBA A;  3CMM A;  1JRY A;  1QB0 A;  3H8L A;  3QVR A;  4UP3 A;  1JRX A;  2Q82 A;  1H83 A;  1ORB A;  4F67 A;  3G5J A;  1OJD A;  2YLS A;  2YR4 A;  4G6H A;  4APN A;  2VQB A;  3VRA A;  4H4W A;  4H4R A;  1WV9 A;  1BGN A;  2IFD A;  1PJ6 A;  3ATQ A;  2CUL A;  3KVE A;  2XLP A;  3HZL A;  3KPF A;  3TP9 A;  4A6N A;  2XFU A;  1XDI A;  2BRA A;  4H4P A;  4AT2 A;  1NG3 A;  1PJ5 A;  3EF6 A;  1GRE A;  1ZOY A;  4TM4 A;  5C2T A;  3P3A A;  1D7L A;  4I59 A;  1BKW A;  1BWC A;  2C65 A;  3CNJ A;  3DGH A;  1YY5 A;  1UAR A;  3AD7 B;  3GYJ A;  5KNL A;  1ZMD A;  2YR5 A;  5HY5 A;  1GTE A;  3SFD A;  4USQ A;  1DXL A;  3GRT A;  1CWT A;  1EL8 A;  3CGD A;  3JSK A;  2O9Z A;  2YM1 A;  3NYE A;  1OJT A;  4AT0 A;  1LJ1 A;  1F6M A;  1ELI A;  3LB8 A;  2XLS A;  3AE9 A;  1OJC A;  3Q6J A;  4MJW A;  4H7U A;  4EMI A;  2NVK X;  1CJ2 A;  1ZP0 A;  1TDK A;  3AYI A;  2BCG G;  1H4M X;  2R4E A;  4BJY A;  4B63 A;  2YG7 A;  1H4K X;  3GMC A;  4B66 A;  4FK1 C;  2OLN A;  3H8I A;  1EBD A;  3V76 A;  1JU2 A;  3UP5 A;  3C4A A;  5J60 A;  4H2R A;  4GUV A;  4WCT A;  2C73 A;  3DJG X;  4Z25 A;  2ZZ0 A;  3AEB A;  1D5T A;  4GR1 A;  3CPJ G;  2FJD A;  4B69 A;  2JKC A;  3OC4 A;  3BI4 A;  3P9U A;  2YVJ A;  1LV0 A;  2XFQ A;  2FJA A;  3CGC A;  3PO7 A;  1T3K A;  4GAP A;  5FS9 A;  3V3N A;  3AAY A;  3IPO A;  2JTR A;  3FNJ A;  4EMJ A;  4CCQ A;  1F8W A;  2IID A;  1XAN A;  1GN0 A;  2QAE A;  4GDE A;  4C5O A;  3GWF A;  3HYW A;  2TPR A;  3NKS A;  4YSZ A;  2C75 A;  3T14 A;  3UKP A;  5M10 A;  1PBB A;  1QJD A;  4K5R A;  3P4P A;  3IHM A;  1CF3 A;  4Y4N A;  2WDR A;  4JY3 A;  3CN8 A;  5ER0 A;  1YKJ A;  2AQJ A;  1BGJ A;  4NTE A;  1ZOV A;  2YAU A;  1IUS A;  2XYO A;  3BHF A;  3R9U A;  2OUC A;  5BUK A;  4DSG A;  4CNJ A;  3L8K A;  1D7Y A;  4H4Q A;  1HZM A;  4N9X A;  3C96 A;  5EB5 A;  1WHB A;  3DME A;  1YQ3 A;  5KMS A;  3KPK A;  4U8N A;  1Y0P A;  2FBW A;  4U8O A;  3FG2 P;  1KDG A;  1FEC A;  2Q0K A;  1H84 A;  5HXI A;  3UOV A;  3NK0 X;  4CNK A;  2C3D A;  1OJ9 A;  1PS9 A;  3AYJ A;  2XDO A;  1GES A;  4Z26 A;  1GRA A;  3CNS A;  1M6I A;  2BXR A;  1FCD A;  1RHS A;  2Y6R A;  2ARD A;  4X9N A;  2X99 A;  5FS8 A;  2OAL A;  1F8R A;  3QVP A;  1S2Q A;  3FBS A;  1VG0 A;  4LA1 A;  3UTF A;  4H2P A;  2R45 A;  3QSS A;  4B67 A;  2H88 A;  3F8D A;  1YS0 A;  1GSN A;  4XWR A;  3VRD B;  4H2N A;  5L46 A;  3AE8 A;  1N4V A;  3ATR A;  3UKK A;  4GRT A;  2X3N A;  3BNM A;  1GOS A;  1GXF A;  4U8M A;  4XWZ A;  1B5Q A;  1JOA A;  2C72 A;  1L0V A;  2PYX A;  2JTS A;  3SZ0 A;  2EG3 A;  4A6N B;  4B65 A;  1N1P A;  4YWO A;  2XVH A;  2WEU A;  3FOJ A;  4XXG A;  3NK2 X;  1NEK A;  4BK2 A;  3AED A;  4EIQ A;  3OP3 A;  2FSX A;  4H50 A;  3CGE A;  1BZL A;  1OJA A;  3H4K A;  3NN0 X;  4HA6 A;  4H4X A;  4TM0 A;  2B9X A;  2XVI A;  4EIP A;  4GAV A;  1PBD A;  1E1N A;  1LPF A;  1TQ1 A;  2BS2 A;  2WQY A;  3VRB A;  2TMD A;  2YVF A;  4OPG A;  3SFE A;  4NEW A;  3TG3 A;  1YM9 A;  4J34 A;  3LZX A;  2GRT A;  2JB2 A;  5FS7 A;  2QCU A;  2XVF A;  3I3L A;  1VG9 A;  3NK1 X;  4A5L A;  3CPH G;  4TM3 A;  1B4V A;  1YT8 A;  3SXI A;  1ONF A;  4EQR A;  2XLR A;  1H6V A;  2YVG A;  2IFV A;  2W0H A;  2OA1 A;  2Q6U A;  4G6G A;  3ILM A;  3NG7 X;  3SZW A;  3II4 A;  4Z24 A;  1CHU A;  1KSU A;  1NEN A;  4O5U A;  3NTD A;  2CFY A;  3K7M X;  4LU6 A;  3SZC A;  2RGO A;  4YKF A;  4ZCD A;  1GND A;  2WET A;  1CBO A;  1LQT A;  2XVJ A;  5JCL A;  3KA7 A;  3K9R A;  3AEA A;  3L1R A;  5KWF A;  2GWF A;  3CPI G;  2B7S A;  3NHV A;  1B8S A;  4YTM A;  4A9W A;  2BS4 A;  2F5Z A;  4OPL A;  1O95 A;  1SEZ A;  3RNM A;  2GMH A;  4YXD A;  3AE1 A;  4FK1 A;  3SYI A;  4X4J A;  3O0H A;  5U63 A;  1PBC A;  1ZY8 A;  3R2U A;  2EQ9 A;  5LV9 A;  1NHQ A;  3AE3 A;  2WOW A;  4U2L A;  4TM1 A;  3NIX A;  2WLX A;  2XFN A;  4UDR A;  3SQP A;  3K7T A;  1L9E A;  4GF7 A;  1PXC A;  3V3O A;  1GRG A;  3AB1 A;  2JB1 A;  1CL0 A;  3VR9 A;  3QFB A;  2WP9 A;  1KSS A;  5KRQ A;  3C4N A;  1H7X A;  1KNR A;  3AWI A;  3G5S A;  3I6D A;  4BV6 A;  4CY8 A;  1E0C A;  3D8X A;  1H7W A;  2WPC A;  5EBK A;  5EOW A;  3TG1 B;  3EAO A;  2V3B A;  1GAL A;  1ZDL A;  3NNE A;  4NZH A;  4A65 A;  3SY4 A;  1URH A;  1NHP A;  3ICS A;  2BK4 A;  1ZKQ A;  5M0Z A;  2WU2 A;  2BCP A;  1MOK A;  4X9M A;  3DJE A;  2B76 A;  4CRT A;  5IQ4 A;  1GV4 A;  1CC4 A;  2YG5 A;  2XVE A;  4IA5 A;  3LZW A;  4IVM B;  1REO A;  4Z2T A;  3IC9 A;  5KMQ A;  2WDQ A;  5JCM A;  3ALM A;  4FX9 A;  2YG4 A;  3I2V A;  2GH5 A;  3NGC X;  1Q9I A;  5BUL A;  5KVH A;  4Z2R A;  3ICT A;  1PBE A;  3HZU A;  1CJ4 A;  2VVM A;  3ALL A;  3GMB A;  1LQU A;  3RP8 A;  2JB3 A; 
#chains in the Genus database with same CATH homology
 1N4U A;  4K22 A;  3HYX A;  2FJE A;  4JN9 A;  4C74 A;  1H82 A;  2OAM A;  3HWI A;  1VDC A;  2JK6 A;  3OLH A;  5HBQ A;  3BHK A;  3F8P A;  3M0O A;  2R0G A;  1PN0 A;  2RGJ A;  2V6O A;  1IJH A;  3ADA B;  3I3U A;  2X8C A;  4H4Y A;  2RGH A;  2WHD A;  2ZZC A;  4PAB A;  3QSE A;  2VSW A;  3GYX A;  1DOD A;  3UOX A;  2DKI A;  3AEC A;  2GQW A;  3CND A;  3AE5 A;  1S3B A;  3UTN X;  2R46 A;  3RP7 A;  1VEE A;  4AOX A;  2J3N A;  3MZZ A;  4B1B A;  3FIM B;  3G5Q A;  5GSN A;  2YQU A;  2H89 A;  1GRH A;  1CC6 A;  2YR6 A;  4JDR A;  1W4X A;  3CNP A;  2V3A A;  4JY2 A;  3ALJ A;  3VQR A;  1CC2 A;  1PDH A;  3CGB A;  1X31 B;  1P2E A;  4G73 A;  1NG4 A;  1HYU A;  1ZMC A;  4NTD A;  1S3E A;  4AOS A;  2R0P A;  2C7G A;  2IVE A;  4U2S A;  3UOY A;  4YT0 A;  1COY A;  2VRM A;  3BNU A;  1RYI A;  2XFP A;  3DK9 A;  4J57 A;  3UP4 A;  2BRY A;  2YLW A;  3T37 A;  1NAA A;  4H4U A;  1E1L A;  2GB0 A;  5BVA A;  2QA1 A;  1IUV A;  1CWR A;  1DOC A;  1JNR A;  1F3P A;  2GR3 A;  2ZBW A;  2EG4 A;  3AEF A;  1FL2 A;  4JNQ A;  3AAX A;  3EAN A;  2BYB A;  2KL3 A;  3D1P A;  2WS3 A;  3LJP A;  4LII A;  4EMW A;  3O3W A;  3D1C A;  1S2Y A;  2WES A;  3NTA A;  1GER A;  1L9D A;  2AR8 A;  4IVO B;  1Y56 A;  4NNJ A;  5FMH A;  1IUW A;  1TDE A;  2X8G A;  4YSX A;  2A89 A;  4K2X A;  4KX6 A;  3GWD A;  1GEU A;  1GPE A;  4CY6 A;  3P4Q A;  4OPD A;  1DP2 A;  3HYV A;  3SGL A;  4DSH A;  2WLR A;  3GYI A;  2C76 A;  3DH9 A;  1KNP A;  1RP0 A;  1V59 A;  2BK5 A;  4K7Z A;  2B7R A;  3CTY A;  3S5W A;  1NHR A;  3COX A;  2WOI A;  2WPF A;  4OPC A;  4P9S A;  3P4R A;  4TLZ A;  1TDO A;  2VVL G;  4H4S A;  3RP6 A;  4RSL A;  4ECH A;  2JBV A;  1YMK A;  2UZZ A;  3NLC A;  1QXN A;  3QJ4 A;  3K7Q X;  1TRB A;  4IV9 A;  5KOX A;  4A99 A;  1AOG A;  4E0V A;  3RHA A;  2UZQ A;  4UDQ A;  2E5V A;  1UKV G;  1CJ3 A;  2EQ8 A;  4B68 A;  3UKA A;  3ISH A;  4Y4M A;  2GMJ A;  2XCG A;  3GRS A;  3NT6 A;  2YM2 A;  3BI2 A;  4JQ9 A;  4O5Q A;  1E39 A;  1GT8 A;  4II2 A;  1PXA A;  2JTQ A;  4I58 A;  3SX6 A;  3GDN A;  4A7A A;  3PVC A;  5KMP A;  4WH9 A;  3IHG A;  3AE4 A;  1D4E A;  3WE0 A;  1GRF A;  4Z2U A;  1FEA A;  3CNT A;  3P4S A;  1VQW A;  4U2T A;  4CBQ A;  5HHF A;  4EM3 A;  4YSH A;  5U25 A;  4NWZ A;  4M52 A;  2BAC A;  4NEV A;  1GRB A;  4D04 A;  3T31 A;  1L9C A;  4Z44 A;  4B64 A;  3S61 A;  5KXJ A;  1DJN A;  1H81 A;  2QA2 A;  4RG4 A;  3UKL A;  4OPI A;  1DOE A;  3KLJ A;  2BXS A;  2GV8 A;  2VQ7 A;  2WP5 A;  2RAB A;  3OZ2 A;  4C77 A;  4HB9 A;  1IUT A;  4J33 A;  2APG A;  3UKQ A;  1BOH A;  1K4Q A;  2V5Z A;  1D4C A;  3NYC A;  5FS6 A;  1B37 A;  1QLB A;  3UKF A;  5JCK A;  3IWA A;  1C25 A;  3NRN A;  2WDV A;  4U8J A;  5TR3 A;  1F8S A;  3CIR A;  2IVD A;  3AD8 B;  3T2K A;  2BC1 A;  4Z43 A;  2YLX A;  3GDP A;  1D4D A;  1FEB A;  1YQZ A;  1RHD A;  1CJC A;  4BK3 A;  1GTH A;  1XHC A;  3F4A A;  4JGT A;  1IUU A;  1H86 A;  2VRL A;  2WPE A;  3DK4 A;  2YG6 A;  3IF9 A;  4TLX A;  2A2K A;  4KPR A;  3UOZ A;  3ICR A;  2V61 A;  1XPQ A;  2CVJ A;  1GET A;  2GAG B;  4U8K A;  2DKH A;  5LAO A;  1JNZ A;  1YQ4 A;  2OLO A;  3F8R A;  1EL9 A;  4G9K A;  1QO8 A;  3KKJ A;  1DNC A;  5IQ1 A;  4C3X A;  2C70 A;  3FS5 A;  4Y4L A;  3T0K A;  2XLU A;  2EQ6 A;  2Q0L A;  3B6D A;  3PS9 A;  1EL7 A;  3B3R A;  2BS3 A;  2B9W A;  3ABV A;  3AEE A;  3DJJ A;  3AE6 A;  4K8D A;  1Q1W A;  3BI5 A;  2Y6Q A;  5KMR A;  1PBF A;  3QSM A;  2C67 A;  4G74 A;  1K0I A;  1E1M A;  2EG4 B;  4OCG A;  2C66 A;  2WP6 A;  3AE7 A;  5GRT A;  4UDP A;  4YTP A;  5J7X A;  5HBO A;  3G5R A;  4PAA A;  2R0C A;  3LXD A;  2E1M A;  1Y56 B;  4BK1 A;  1GMX A;  1BF3 A;  2BC0 A;  4EQW A;  2CDU A;  4EQS A;  4BJZ A;  1IUX A;  1MO9 A;  1TYT A;  2GR0 A;  5JCN A;  3SZF A;  3RED A;  1VRQ B;  1NDA A;  3QFA A;  1KF6 A;  3NN6 X;  4J36 A;  3LOV A;  4WH7 A;  2YLT A;  2EQ7 A;  4GDP A;  1O94 A;  4OPU A;  1E1K A;  3DGZ A;  1DJQ A;  4AP3 A;  5C3J A;  3AE2 A;  4WX1 A;  1YMD A;  2FJB A;  2WU5 A;  3HIX A;  4JNA A;  4RG3 A;  1YML A;  2VOU A;  3NYF A;  3UTE A;  3LAD A;  4EQX A;  3FPZ A;  2VVL A;  2BA9 A;  3KD9 A;  3URH A;  5HYM A;  5KOW A;  3ITJ A;  4ICY A;  3GD3 A;  3KU9 A;  4J31 A;  1LTX R;  1FOH A;  2C64 A;  3M13 A;  3UTG A;  3AEG A;  1RSG A;  1PXB A;  4J56 A;  4USR A;  1OKG A;  2Q7V A;  2YLR A;  3DK8 A;  2MOL A;  4OVI A;  4H4Z A;  4DGK A;  2B9Y A;  2WOV A;  3UKH A;  1E7P A;  3K30 A;  5HBP A;  4J2W A;  4K5S A;  4DNA A;  5HBL A;  1N4W A;  2Z5X A;  2ZZB A;  2ACZ A;  5CKU A;  3UCL A;  2GEW A;  4ADW A;  2R9Z A;  1CWS A;  2DCQ A;  3GK5 A;  5LAM A;  1Q1R A;  4NTC A;  4II3 A;  1TDF A;  3AYL A;  3DA1 A;  3Q9T A;  4C3Y A;  2A8X A;  3E1T A;  4H4T A;  1BOI A;  3ZDN A;  2C3C A;  2MOI A;  1TYP A;  1LVL A;  4BUR A;  4CCR A;  4YKG A;  2GQF A;  3T2Y A;  3DJD A;  1O5W A;  3VR8 A;  1JRZ A;  2GAH B;  2VZ2 A;  3T2Z A;  4H4V A;  2BK3 A;  2HQM A;  2E4G A;  4U8P A;  4A79 A;  3UTH A;  2X50 A;  2PHH A;  4OPT A;  3P1W A;  4GCM A;  2YWL A;  1MXT A;  1PHH A;  1NHS A;  4YSY A;  4FDC B;  1ZK7 A;  2AAQ A;  2A87 A;  2I0Z A;  4ZCC A;  3SM8 A;  3NHO X;  4IA6 A;  1EL5 A;  3EPT A;  1P2H A;  1TDN A;  3GSI A;  3AD9 B;  1PJ7 A;  5CQF A;  4REK A;  2X8H A;  2XLT A;  5HPA A;  1K0L A;  2YG3 A;  2JAE A;  1K0J A;  3IPP A;  3FMW A;  2Z5Y A;  2MRM A;  4YTN A;  3IWH A;  4EM4 A;  2YLZ A;  5U1O A;  1ZX9 A;  5BRT A;  3ZYX A;  1JEH A;  2C4C A;  2J6P A;  2K0Z A;  1KFY A;  4H2Q A;  1GRT A;  2GF3 A;  1DOB A;  1E6E A;  2XFO A;  4U8L A;  5JCI A;  5DBJ A;  3M12 A;  3GD4 A;  4U8I A;  2HHG A;  2BAB A;  5IPY A;  4D03 A;  4AP1 A;  2NPX A;  4ZN0 A;  2GVC A;  1M64 A;  2GR2 A;  3AXB A;  1Z6L A;  2R4J A;  5EB4 A;  1NPX A;  3FLH A;  3NH3 X;  2GR1 A;  5KVI A;  2V60 A;  2ORA A;  2WBA A;  3CMM A;  1JRY A;  1QB0 A;  3H8L A;  3QVR A;  4UP3 A;  1JRX A;  2YLS A;  1H83 A;  1ORB A;  4F67 A;  3G5J A;  1OJD A;  2YR4 A;  4G6H A;  4APN A;  2VQB A;  3VRA A;  4H4W A;  4H4R A;  1WV9 A;  1BGN A;  2IFD A;  1PJ6 A;  3ATQ A;  2CUL A;  3KVE A;  2XLP A;  3HZL A;  3KPF A;  3TP9 A;  4A6N A;  2XFU A;  1XDI A;  2BRA A;  4H4P A;  4AT2 A;  1NG3 A;  1PJ5 A;  3EF6 A;  1GRE A;  1ZOY A;  4TM4 A;  5C2T A;  3P3A A;  1D7L A;  4I59 A;  1BKW A;  1BWC A;  2C65 A;  3CNJ A;  3DGH A;  1YY5 A;  1UAR A;  3AD7 B;  3GYJ A;  5KNL A;  1ZMD A;  2YR5 A;  5HY5 A;  1GTE A;  3SFD A;  4USQ A;  1DXL A;  3GRT A;  1CWT A;  1EL8 A;  3CGD A;  3JSK A;  2O9Z A;  2YM1 A;  3NYE A;  1OJT A;  4AT0 A;  1LJ1 A;  1F6M A;  1ELI A;  3LB8 A;  2XLS A;  3AE9 A;  1OJC A;  3Q6J A;  4MJW A;  4H7U A;  4EMI A;  2NVK X;  1CJ2 A;  1ZP0 A;  1TDK A;  3AYI A;  2BCG G;  1H4M X;  2R4E A;  4BJY A;  4B63 A;  2YG7 A;  1H4K X;  3GMC A;  4B66 A;  4FK1 C;  2OLN A;  3H8I A;  1EBD A;  3V76 A;  1JU2 A;  3UP5 A;  3C4A A;  5J60 A;  4H2R A;  4GUV A;  4WCT A;  2C73 A;  3DJG X;  4Z25 A;  2ZZ0 A;  3AEB A;  1D5T A;  4GR1 A;  3CPJ G;  2FJD A;  4B69 A;  2JKC A;  3OC4 A;  3BI4 A;  3P9U A;  2YVJ A;  1LV0 A;  2XFQ A;  2FJA A;  3CGC A;  3PO7 A;  1T3K A;  4GAP A;  5FS9 A;  3V3N A;  3AAY A;  3IPO A;  2JTR A;  3FNJ A;  4EMJ A;  4CCQ A;  1F8W A;  2IID A;  1XAN A;  1GN0 A;  2QAE A;  4GDE A;  4C5O A;  3GWF A;  3HYW A;  2TPR A;  3NKS A;  4YSZ A;  2C75 A;  3T14 A;  3UKP A;  5M10 A;  1PBB A;  1QJD A;  4K5R A;  3P4P A;  3IHM A;  1CF3 A;  4Y4N A;  2WDR A;  4JY3 A;  3CN8 A;  5ER0 A;  1YKJ A;  2AQJ A;  1BGJ A;  4NTE A;  1ZOV A;  2YAU A;  1IUS A;  2XYO A;  3BHF A;  3R9U A;  2OUC A;  5BUK A;  4DSG A;  4CNJ A;  3L8K A;  1D7Y A;  4H4Q A;  1HZM A;  4N9X A;  3C96 A;  5EB5 A;  1WHB A;  3DME A;  1YQ3 A;  5KMS A;  3KPK A;  4U8N A;  1Y0P A;  2FBW A;  4U8O A;  3FG2 P;  1KDG A;  1FEC A;  2Q0K A;  1H84 A;  5HXI A;  3UOV A;  3NK0 X;  4CNK A;  2C3D A;  1OJ9 A;  1PS9 A;  3AYJ A;  2XDO A;  1GES A;  4Z26 A;  1GRA A;  3CNS A;  1M6I A;  2BXR A;  1FCD A;  1RHS A;  2Y6R A;  2ARD A;  4X9N A;  2X99 A;  5FS8 A;  2OAL A;  1F8R A;  3QVP A;  1S2Q A;  3FBS A;  1VG0 A;  4LA1 A;  3UTF A;  4H2P A;  2R45 A;  3QSS A;  4B67 A;  2H88 A;  3F8D A;  1YS0 A;  1GSN A;  4XWR A;  3VRD B;  4H2N A;  5L46 A;  3AE8 A;  1N4V A;  3ATR A;  3UKK A;  4GRT A;  2X3N A;  3BNM A;  1GOS A;  1GXF A;  4U8M A;  4XWZ A;  1B5Q A;  1JOA A;  2C72 A;  1L0V A;  2PYX A;  2JTS A;  3SZ0 A;  2EG3 A;  4A6N B;  4B65 A;  1N1P A;  4YWO A;  2XVH A;  2WEU A;  3FOJ A;  4XXG A;  3NK2 X;  1NEK A;  4BK2 A;  3AED A;  4EIQ A;  3OP3 A;  2FSX A;  4H50 A;  3CGE A;  1BZL A;  1OJA A;  3H4K A;  3NN0 X;  4HA6 A;  4H4X A;  4TM0 A;  2B9X A;  2XVI A;  4EIP A;  4GAV A;  1PBD A;  1E1N A;  1LPF A;  1TQ1 A;  2BS2 A;  2WQY A;  3VRB A;  2TMD A;  2YVF A;  4OPG A;  3SFE A;  4NEW A;  3TG3 A;  1YM9 A;  4J34 A;  3LZX A;  2GRT A;  2JB2 A;  5FS7 A;  2QCU A;  2XVF A;  3I3L A;  1VG9 A;  3NK1 X;  4A5L A;  3CPH G;  4TM3 A;  1B4V A;  1YT8 A;  3SXI A;  1ONF A;  4EQR A;  2XLR A;  1H6V A;  2YVG A;  2IFV A;  2W0H A;  2OA1 A;  2Q6U A;  4G6G A;  3ILM A;  3NG7 X;  3SZW A;  3II4 A;  4Z24 A;  1CHU A;  1KSU A;  1NEN A;  4O5U A;  3NTD A;  2CFY A;  3K7M X;  4LU6 A;  3SZC A;  2RGO A;  4YKF A;  4ZCD A;  1GND A;  2WET A;  1CBO A;  1LQT A;  2XVJ A;  5JCL A;  3KA7 A;  3K9R A;  3AEA A;  3L1R A;  5KWF A;  2GWF A;  3CPI G;  2B7S A;  3NHV A;  1B8S A;  4YTM A;  4A9W A;  2BS4 A;  2F5Z A;  4OPL A;  1O95 A;  1SEZ A;  3RNM A;  2GMH A;  4YXD A;  3AE1 A;  4FK1 A;  3SYI A;  4X4J A;  3O0H A;  5U63 A;  1PBC A;  1ZY8 A;  3R2U A;  2EQ9 A;  5LV9 A;  1NHQ A;  3AE3 A;  2WOW A;  4U2L A;  4TM1 A;  3NIX A;  2WLX A;  2XFN A;  4UDR A;  3SQP A;  3K7T A;  1L9E A;  4GF7 A;  1PXC A;  3V3O A;  1GRG A;  3AB1 A;  2JB1 A;  1CL0 A;  3VR9 A;  3QFB A;  2WP9 A;  1KSS A;  5KRQ A;  3C4N A;  1H7X A;  1KNR A;  3AWI A;  3G5S A;  3I6D A;  4BV6 A;  4CY8 A;  1E0C A;  3D8X A;  1H7W A;  2WPC A;  5EBK A;  5EOW A;  3TG1 B;  3EAO A;  2V3B A;  1GAL A;  1ZDL A;  3NNE A;  4NZH A;  4A65 A;  3SY4 A;  1URH A;  1NHP A;  3ICS A;  2BK4 A;  1ZKQ A;  5M0Z A;  2WU2 A;  2BCP A;  1MOK A;  4X9M A;  3DJE A;  2B76 A;  4CRT A;  5IQ4 A;  1GV4 A;  1CC4 A;  2YG5 A;  2XVE A;  4IA5 A;  3LZW A;  4IVM B;  1REO A;  4Z2T A;  3IC9 A;  5KMQ A;  2WDQ A;  5JCM A;  3ALM A;  4FX9 A;  2YG4 A;  3I2V A;  2GH5 A;  3NGC X;  1Q9I A;  5BUL A;  5KVH A;  4Z2R A;  3ICT A;  1PBE A;  3HZU A;  1CJ4 A;  2VVM A;  3ALL A;  3GMB A;  1LQU A;  3RP8 A;  2JB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...