3NTAA

Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
565
structure length
565
Chain Sequence
b'MKKILIIGGVAGGASAAARARRLSETAEIIMFERGEYVSFANCGLPYHISGEIAQRSALVLQTPESFKARFNVEVRVKHEVVAIDRAAKLVTVRRLLDGSEYQESYDTLLLSPGAAPIVPPIPGVDNPLTHSLRNIPDMDRILQTIQMNNVEHATVVGGGFIGLEMMESLHHLGIKTTLLELADQVMTPVDREMAGFAHQAIRDQGVDLRLGTALSEVSYQVQTHVASDAAGEDTAHQHIKGHLSLTLSNGELLETDLLIMAIGVRPETQLARDAGLAIGELGGIKVNAMMQTSDPAIYAVGDAVEEQDFVTGQACLVPLAGPANRQGRMAADNMFGREERYQGTQGTAICKVFDLAVGATGKNEKQLKQAGIAFEKVYVHTASHASYYPGAEVVSFKLLFDPVKGTIFGAQAVGKDGIDKRIDVMAVAQRAGMTVEQLQHLELSYAPPYGSAKDVINQAAFVASNIIKGDATPIHFDQIDNLSEDQLLLDVRNPGELQNGGLEGAVNIPVDELRDRMHELPKDKEIIIFCQVGLRGNVAYRQLVNNGYRARNLIGGYRTYKFAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FAD-dependent pyridine nucleotide-disulphide oxidoreductase
publication title Characterization of an NADH-Dependent Persulfide Reductase from Shewanella loihica PV-4: Implications for the Mechanism of Sulfur Respiration via FAD-Dependent Enzymes .
pubmed doi rcsb
source organism Shewanella loihica
molecule tags Oxidoreductase
total genus 162
structure length 565
sequence length 565
chains with identical sequence B
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2010-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3ntaA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ntaA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ntaA01
5IPYA 3P3AA 2YG3A 5KXJA 3DGZA 1DOEA 2WP6A 4EMJA 3P4SA 2R4JA 5FS8A 2IFDA 1H81A 1QO8A 2C72A 2Y6QA 3NIXA 4I59A 3LZXA 1CF3A 2YLTA 2YQUA 1BKWA 2RABA 3F8RA 3UOVA 5FS7A 1PJ5A 1D4EA 1DODA 2VOUA 2HHGA 2XLPA 3H4KA 4GUVA 4K2XA 2OUCA 1GRBA 2EQ8A 1ZX9A 3B3RA 1F6MA 2QAEA 4C74A 1CWRA 5LV9A 4WCTA 2BS4A 2YLRA 4CCQA 4YSZA 3R9UA 1IJHA 1JEHA 5HYMA 4A5LA 2AAQA 4U2TA 1OJAA 1GRAA 3V3NA 3AWIA 1EL8A 4JNAA 2RGJA 3QSEA 1W4XA 4B66A 5JCLA 3GWFA 2XLRA 3II4A 1GRTA 3TG3A 2IIDA 4K5SA 1F8RA 4OPDA 2C75A 1FEBA 3KKJA 2Q0LA 3NKSA 3IHMA 4Z24A 4IVMB 3SGLA 3GYIA 1URHA 1M6IA 5IQ1A 3UKAA 4F67A 2EQ7A 2YLZA 4NEWA 3DK4A 1N1PA 5IQ4A 1JRXA 1NHQA 1GOSA 4YWOA 3T37A 1NHRA 2V5ZA 1F8SA 1GREA 4Y4NA 1RHSA 1IUXA 1H4MX 1E39A 1L9CA 3KVEA 3DK8A 3C96A 1H86A 1PBEA 3P4PA 4BJYA 2FSXA 3QVRA 1NHPA 1FECA 1S3EA 2YG7A 3UCLA 4D04A 2EQ6A 1GRGA 4H4XA 2CVJA 1GTEA 3D1PA 1F3PA 1YQ4A 2UZZA 3UKPA 4A7AA 4C77A 3EF6A 3RNMA 3AAXA 3CGCA 5J60A 1PXBA 1B8SA 2GMJA 4J31A 5EB4A 3WE0A 3H8LA 1AOGA 2BS3A 2XCGA 2XLTA 2Z5YA 2E4GA 1PBCA 2BK4A 3AD8B 3PS9A 1NG4A 4YTPA 2TPRA 3NG7X 2BABA 2GR0A 3NRNA 4USRA 3NK0X 1FCDA 4J33A 4Z44A 5TR3A 5LAOA 1NENA 1BWCA 3IWHA 2X99A 3SM8A 4HB9A 5HBQA 1P2EA 3NGCX 4FK1A 3FPZA 3NHVA 1NG3A 5DBJA 3F8PA 3F8DA 3VRBA 1GPEA 2YVFA 2GF3A 2A89A 4TM3A 2VVLA 3CGEA 3ZDNA 1GEUA 2J6PA 3KD9A 4B68A 1ZMDA 1H84A 2RGOA 4Y4LA 3PO7A 1CC2A 1YQZA 3D8XA 2GWFA 3NK2X 1VDCA 4H4VA 4MJWA 3QSSA 1MOKA 1NHSA 2XLSA 1PHHA 4RG4A 4C3YA 4U8PA 1Q1WA 3L1RA 3NLCA 2YAUA 1K0IA 2ZZBA 5HXIA 1CL0A 2EQ9A 4RG3A 4OCGA 2YLSA 4UP3A 3G5RA 5BVAA 4CY6A 2VQ7A 1H7WA 3KA7A 3O3WA 4K22A 4H50A 2X8CA 1GXFA 4OPTA 2JB2A 1XHCA 2B9WA 2WQYA 3VRAA 2WOIA 4JY2A 4JQ9A 4C3XA 4H4UA 1CJCA 2WEUA 2DCQA 2C3CA 4Z25A 1B4VA 3EPTA 3S5WA 3SFEA 1OJTA 2HQMA 5GSNA 3CN8A 2WOWA 4YSXA 2H89A 1IUVA 2WDRA 3REDA 1O5WA 2DKIA 2GAHB 2ZZ0A 4O5UA 4Z2RA 3AE4A 1RSGA 2WOVA 1HYUA 1KDGA 2Y6RA 1QB0A 2X8GA 4EQRA 4YXDA 2IVDA 4TLZA 1JRYA 4U8IA 3LOVA 3ZYXA 3DJJA 3AYLA 4OPIA 2AQJA 5KOWA 2VSWA 1CJ3A 3UTEA 1C25A 2WDVA 2CFYA 1EL7A 4JN9A 3UTGA 1E6EA 4A65A 3NTAA 2ORAA 2YVJA 2GB0A 3NYFA 2WPFA 4BK1A 3FBSA 4YTNA 2R46A 4WH9A 3AE7A 3AEEA 2XYOA 3GMCA 3RP6A 3UKFA 1H6VA 1ZDLA 1JOAA 1REOA 4H2QA 2UZQA 4ZCDA 2XLUA 2J3NA 1CWSA 1E1MA 2WP5A 3KU9A 2GR2A 1B37A 3GSIA 2A2KA 5FS9A 2OLNA 4CNJA 1GESA 3K7MX 4TM4A 1F8WA 1ZP0A 2Q6UA 3IPPA 3K7TA 4H4RA 3GD4A 4LU6A 4YTMA 3GRTA 1DOCA 1PS9A 2YLWA 3GDNA 5JCMA 5J7XA 4H7UA 5U63A 1LV0A 2JTRA 2WHDA 2XVEA 3UTNX 1YT8A 1OJCA 1TDFA 1MO9A 2VVLG 2C64A 3AE5A 4X9NA 3UKLA 3NYEA 1N4WA 5C3JA 3ILMA 5HPAA 2V3BA 1N4UA 4PAAA 4I58A 3OP3A 2B9XA 3FS5A 2FJDA 3ALLA 4J56A 4K5RA 2WDQA 2I0ZA 3GDPA 4EQXA 1QLBA 2ACZA 2XFNA 4UDPA 1D7YA 4EM3A 1O94A 2C3DA 2XFOA 3RP8A 3FNJA 3MZZA 1RYIA 1ELIA 3DJEA 1ZMCA 1BOIA 2KL3A 1GSNA 2B9YA 1H82A 2YG5A 3GWDA 3P9UA 3ADAB 1S2YA 2V6OA 3H8IA 4GRTA 5GRTA 3O0HA 1L0VA 1X31B 4KPRA 1K0LA 2OALA 3VQRA 2XVJA 4H4YA 3CTYA 2E5VA 3AD9B 1FL2A 3KPFA 5EBKA 4BURA 2JK6A 4B65A 2JKCA 1BOHA 3NT6A 1UARA 1TDNA 1WHBA 2GEWA 2R0CA 3SFDA 3URHA 3AEBA 1S3BA 2VZ2A 4U8NA 1PXAA 4X4JA 4JGTA 1PBBA 3AEFA 3R2UA 2BC0A 5CKUA 3B6DA 1RP0A 2GRTA 2RGHA 3AYJA 4H4QA 1GMXA 3ATQA 1GRFA 2PHHA 3IPOA 2MRMA 2WLXA 3CIRA 1BGNA 1IUTA 2XFQA 2GR3A 3OZ2A 4XWRA 5HY5A 2MOIA 3CGBA 1GRHA 4OPCA 1D4CA 1JNZA 1GV4A 2WS3A 2APGA 2C73A 4AT2A 1GN0A 5C2TA 2WU2A 4YKGA 2NVKX 2EG4B 3BI4A 1JRZA 3UTHA 2BYBA 3DJDA 1NPXA 2R45A 1SEZA 1BGJA 2VVMA 3LB8A 2XDOA 3AE6A 4UDRA 2WLRA 2OLOA 3ATRA 2K0ZA 2JTSA 3C4AA 5ER0A 4AOXA 1IUSA 2O9ZA 1KSUA 2YM1A 3VR8A 1RHDA 1BZLA 2WESA 3HIXA 3LJPA 5HBPA 4U8LA 4EIPA 3AE1A 4J57A 1TYPA 1UKVG 4A9WA 1T3KA 4B69A 3FLHA 1GNDA 3Q9TA 3NK1X 1LQUA 4PABA 3LADA 3I2VA 4U8OA 3K30A 3ITJA 2WP9A 4A79A 1TQ1A 3TP9A 1PXCA 1VQWA 3ALMA 3CPIG 4BK2A 4KX6A 1GETA 1VG9A 2JBVA 2XVHA 3GRSA 2GQFA 4RSLA 4TM0A 4CBQA 2BACA 4JNQA 1DOBA 1XDIA 3AE8A 5JCNA 3AE3A 2R4EA 2V60A 1Z6LA 2QCUA 3CNJA 2CULA 3GYJA 2WETA 5L46A 2C67A 4J34A 2CDUA 1CHUA 4BV6A 4IV9A 1KSSA 3BHFA 1PBFA 3QSMA 2YR6A 1N4VA 3HZLA 5JCIA 4NEVA 4OPGA 4YT0A 3DH9A 5HBOA 3OLHA 4B64A 1XPQA 3RP7A 4EQSA 1PJ6A 4GCMA 2B76A 4IA6A 4U8MA 3COXA 2ARDA 1LPFA 3S61A 4FX9A 2BCPA 4REKA 4U8KA 1JU2A 2WU5A 3UP5A 1M64A 3ABVA 5M0ZA 2GVCA 4CNKA 1Y56B 5JCKA 5KWFA 3EAOA 2JB1A 1BF3A 1ORBA 2A8XA 3AD7B 2A87A 1TYTA 3CNSA 1CJ2A 1DJNA 2C65A 3FMWA 5U1OA 1S2QA 3M12A 2FJEA 3AECA 2YG4A 4LIIA 3EANA 4CCRA 2YVGA 4C5OA 4DSHA 3UOYA 3OC4A 5HHFA 5KOXA 1GERA 2BK3A 5FMHA 1D5TA 5BULA 3TG1B 2BA9A 4Z2UA 3BI2A 1TDKA 1ZOVA 5HBLA 3CPHG 3DGHA 3LZWA 2IVEA 4H4ZA 4ICYA 4A99A 4Z26A 1VG0A 2WPEA 4GF7A 2B7RA 3P4RA 3QVPA 4J2WA 1E1KA 4M52A 3K9RA 2QA1A 3G5QA 1WV9A 1GALA 3V76A 1D7LA 1FEAA 2EG3A 4AP3A 5KRQA 1YS0A 2FBWA 4OVIA 3GK5A 1CJ4A 4A6NB 3V3OA 4WH7A 4B1BA 1CC6A 3JSKA 4TM1A 5BUKA 2VRMA 3DK9A 2GH5A 3NTDA 1H83A 2R0PA 1YMLA 3CNTA 5FS6A 1YMKA 3I3UA 4E0VA 2EG4A 2XFUA 2YR5A 3I3LA 3ISHA 3M0OA 1ZY8A 2Q0KA 1E1NA 3P1WA 4Y4MA 1KF6A 2XVIA 3G5JA 1YY5A 3G5SA 1DP2A 4OPUA 2B7SA 1OKGA 4XXGA 3UKHA 2BXRA 4EIQA 2QA2A 3NH3X 1Y0PA 1V59A 2PYXA 1L9EA 2WPCA 3RHAA 3AYIA 2X3NA 4H4SA 4B63A 4U8JA 1D4DA 1NAAA 3P4QA 4EMWA 4JY3A 3CNDA 1L9DA 1VRQB 4ECHA 5M10A 1YMDA 1B5QA 3CNPA 1H7XA 2ZBWA 1E0CA 1COYA 2XVFA 4YSHA 5LAMA 1K0JA 2XFPA 2YLXA 1OJDA 3ICRA 3FOJA 3NHOX 2V3AA 4GR1A 5KVIA 1DXLA 1DNCA 2JAEA 1OJ9A 2OA1A 3M13A 1LJ1A 3NN6X 4U2SA 4XWZA 4EM4A 3BI5A 4UDQA 3VRDB 3BHKA 4YKFA 1LTXR 1IUUA 2C66A 3QFAA 3HWIA 3ICTA 1KNRA 4ZN0A 4GDPA 4AT0A 4EMIA 1E7PA 4USQA 3VR9A 1GT8A 1ZOYA 2BCGG 2GQWA 2YR4A 3UP4A 1NEKA 3QJ4A 3DA1A 2X50A 3AB1A 1XANA 4Z43A 3SQPA 4BK3A 1K4QA 1IUWA 2DKHA 2R9ZA 3BNMA 2WBAA 3CPJG 4IVOB 1CWTA 4TLXA 4D03A 2YWLA 2IFVA 1PN0A 1TRBA 1PBDA 1Y56A 2FJAA 4YSYA 2R0GA 2YG6A 3IWAA 1TDOA 5EB5A 5EOWA 4P9SA 3UOZA 4BJZA 1LVLA 1QXNA 2Z5XA 2W0HA 1EL9A 3DMEA 3Q6JA 5KVHA 4ADWA 5CQFA 1KNPA 4H4PA 3AEDA 4AP1A 4DGKA 1VEEA 1O95A 1YKJA 3HZUA 3IC9A 3GMBA 2BK5A 3PVCA 4WX1A 3L8KA 4NTDA 4DSGA 5BRTA 4O5QA 2C7GA 1TDEA 4H2RA 2GMHA 1E1LA 4X9MA 3AXBA 4N9XA 1PDHA 2AR8A 1FOHA 2GV8A 4K7ZA 2MOLA 1CBOA 3IHGA 2YM2A 3AEAA 3K7QX 4CY8A 3AE9A 4APNA 2VRLA 4Z2TA 2JTQA 2C70A 4AOSA 4NZHA 2E1MA 2NPXA 3AAYA 2ZZCA 3CGDA 4H4WA 2H88A 3BNUA 4NTCA 1PJ7A 1Q9IA 1EBDA 3D1CA 1Q1RA 4U2LA 2F5ZA 1ZK7A 2BXSA 4A6NA 4ZCCA 2BS2A 3NN0X 4IA5A 2GR1A 5U25A 4HA6A 1MXTA 3AEGA 4OPLA 1YQ3A 4J36A 1P2HA 3NYCA 2Q7VA 3GD3A 1KFYA 3C4NA 4NTEA 2V61A 3FG2P 4B67A 3F4AA 1JNRA 3IF9A 3UTFA 2GAGB 2OAMA 2VQBA 2C76A 4GDEA 2FJBA 3UKKA 1H4KX 1GTHA 1ONFA 3NNEA 1HZMA 1ZKQA 2TMDA 3KLJA 4CRTA 3DJGX 1QJDA 3AE2A 1LQTA 1CC4A 4H4TA 4JDRA 3LXDA 3QFBA 2BC1A 4DNAA 4FDCB 3ICSA 4EQWA 3ALJA 3UOXA 4K8DA 2X8HA 1DJQA 3FIMB 3I6DA 4H2PA 4FK1C 3E1TA 3UKQA 2JB3A 4LA1A 1EL5A 1NDAA 1YM9A 4H2NA
chains in the Genus database with same CATH superfamily
5IPYA 3P3AA 2YG3A 3CMMA 5KXJA 3DGZA 1DOEA 2WP6A 4EMJA 3P4SA 3HYVA 2R4JA 5FS8A 2IFDA 1H81A 1QO8A 2C72A 2Y6QA 3NIXA 4I59A 3LZXA 1CF3A 2YLTA 2YQUA 1BKWA 2RABA 3F8RA 3UOVA 5FS7A 1PJ5A 1D4EA 1DODA 2VOUA 2HHGA 2XLPA 3H4KA 4GUVA 4K2XA 2OUCA 1GRBA 2EQ8A 1ZX9A 3B3RA 1F6MA 2QAEA 4C74A 1CWRA 5LV9A 4WCTA 2BS4A 2YLRA 4CCQA 4YSZA 3R9UA 1IJHA 1JEHA 5HYMA 4A5LA 2AAQA 4U2TA 1OJAA 1GRAA 3V3NA 3AWIA 1EL8A 4JNAA 2RGJA 3QSEA 1W4XA 4B66A 3SYIA 5JCLA 3GWFA 2XLRA 3KPKA 3II4A 1GRTA 3TG3A 2IIDA 4K5SA 1F8RA 4OPDA 2C75A 1FEBA 3KKJA 2Q0LA 3NKSA 3IHMA 4Z24A 4IVMB 3SGLA 3GYIA 1URHA 1M6IA 3SY4A 5IQ1A 3UKAA 4F67A 2EQ7A 2YLZA 4NEWA 3DK4A 1N1PA 4G6HA 5IQ4A 1JRXA 1NHQA 1GOSA 4YWOA 3T37A 1NHRA 2V5ZA 1F8SA 1GREA 4Y4NA 1RHSA 1IUXA 1H4MX 1E39A 1L9CA 3KVEA 3DK8A 3C96A 1H86A 1PBEA 3P4PA 4BJYA 2FSXA 3QVRA 1NHPA 1FECA 1S3EA 2YG7A 3SZFA 3UCLA 4D04A 2EQ6A 1GRGA 4H4XA 2CVJA 1GTEA 3D1PA 1F3PA 1YQ4A 2UZZA 3UKPA 4A7AA 4C77A 3EF6A 3RNMA 3AAXA 3CGCA 5J60A 1PXBA 1B8SA 2GMJA 5KMPA 4J31A 5EB4A 3WE0A 3H8LA 3SZ0A 1AOGA 2BS3A 2XCGA 2XLTA 2Z5YA 2E4GA 1PBCA 2BK4A 3AD8B 3PS9A 1NG4A 4YTPA 2TPRA 3NG7X 2BABA 2GR0A 3NRNA 4USRA 3NK0X 1FCDA 4J33A 4Z44A 5TR3A 5LAOA 1NENA 1BWCA 3IWHA 2X99A 3SM8A 3T2ZA 4HB9A 5HBQA 1P2EA 3NGCX 4FK1A 3FPZA 3NHVA 1NG3A 5DBJA 3F8PA 3F8DA 3VRBA 1GPEA 2YVFA 2GF3A 2A89A 4TM3A 2VVLA 3CGEA 3ZDNA 1GEUA 2J6PA 3KD9A 4B68A 1ZMDA 1H84A 2RGOA 4Y4LA 3PO7A 1CC2A 1YQZA 3D8XA 2GWFA 3NK2X 1VDCA 4H4VA 4MJWA 3QSSA 1MOKA 1NHSA 2XLSA 1PHHA 4RG4A 4C3YA 4U8PA 1Q1WA 3L1RA 3NLCA 2YAUA 1K0IA 2ZZBA 5HXIA 4NNJA 1CL0A 2EQ9A 4RG3A 4OCGA 2YLSA 4UP3A 3G5RA 5BVAA 4CY6A 2VQ7A 1H7WA 3KA7A 3O3WA 4K22A 5KMRA 4H50A 2X8CA 1GXFA 4OPTA 2JB2A 1XHCA 2B9WA 2WQYA 3VRAA 2WOIA 4JY2A 4JQ9A 4C3XA 4H4UA 1CJCA 2WEUA 2DCQA 2C3CA 4Z25A 1B4VA 3EPTA 3S5WA 3SFEA 1OJTA 2HQMA 5GSNA 3SZCA 3CN8A 2WOWA 3HYXA 2H89A 4YSXA 1IUVA 2WDRA 3REDA 1O5WA 2DKIA 2GAHB 2ZZ0A 4O5UA 4Z2RA 3AE4A 1RSGA 2WOVA 1HYUA 1KDGA 2Y6RA 1QB0A 2X8GA 4EQRA 4YXDA 2IVDA 4TLZA 1JRYA 4U8IA 3LOVA 3ZYXA 3DJJA 3AYLA 4OPIA 2AQJA 5KOWA 2VSWA 1CJ3A 3UTEA 1C25A 2WDVA 2CFYA 1EL7A 4JN9A 3UTGA 1E6EA 4A65A 3NTAA 2ORAA 2YVJA 2GB0A 3NYFA 2WPFA 3T0KA 3FBSA 4BK1A 4YTNA 2R46A 4WH9A 3AE7A 2C4CA 2XYOA 3AEEA 3GMCA 3RP6A 1H6VA 1ZDLA 3UKFA 1JOAA 1REOA 4H2QA 2UZQA 4ZCDA 2XLUA 2J3NA 1CWSA 1E1MA 2WP5A 3KU9A 2GR2A 1B37A 3GSIA 2A2KA 5FS9A 2OLNA 4CNJA 1GESA 3K7MX 4TM4A 1F8WA 1ZP0A 2Q6UA 3IPPA 3K7TA 4H4RA 3GD4A 4LU6A 4YTMA 3GRTA 1DOCA 1PS9A 2YLWA 4NWZA 5KNLA 3GDNA 5JCMA 5J7XA 4H7UA 5U63A 1LV0A 2JTRA 2WHDA 2XVEA 3UTNX 1YT8A 1OJCA 1TDFA 1MO9A 2VVLG 2C64A 3AE5A 4X9NA 3UKLA 3NYEA 1N4WA 5C3JA 3ILMA 5HPAA 2V3BA 1N4UA 4PAAA 4I58A 3OP3A 2B9XA 3FS5A 2FJDA 3ALLA 4J56A 4K5RA 2WDQA 3T2YA 2I0ZA 3GDPA 4EQXA 1QLBA 2ACZA 2XFNA 4UDPA 1D7YA 4G9KA 4EM3A 1O94A 2C3DA 2XFOA 3RP8A 3FNJA 3MZZA 1RYIA 1ELIA 3DJEA 1ZMCA 1BOIA 2KL3A 1GSNA 2B9YA 1H82A 2YG5A 3GWDA 3P9UA 3ADAB 1S2YA 2V6OA 3H8IA 4GRTA 5GRTA 3O0HA 1L0VA 1X31B 4KPRA 1K0LA 2OALA 3VQRA 2XVJA 4H4YA 3CTYA 2E5VA 3AD9B 1FL2A 3KPFA 5EBKA 4BURA 2JK6A 4B65A 2JKCA 1BOHA 3NT6A 1UARA 1TDNA 1WHBA 2GEWA 2R0CA 3SFDA 3URHA 3AEBA 1S3BA 2VZ2A 4U8NA 1PXAA 4X4JA 4JGTA 1PBBA 3AEFA 3R2UA 2BC0A 5CKUA 3B6DA 1RP0A 2GRTA 2RGHA 3AYJA 4H4QA 1GMXA 3ATQA 1GRFA 2PHHA 3IPOA 2MRMA 2WLXA 3CIRA 1BGNA 1IUTA 2BRYA 2GR3A 2XFQA 3OZ2A 4XWRA 5HY5A 2MOIA 3CGBA 1GRHA 4OPCA 1D4CA 1JNZA 1GV4A 2WS3A 2APGA 2C73A 4AT2A 1GN0A 5C2TA 2WU2A 4YKGA 2NVKX 2EG4B 3BI4A 1JRZA 3UTHA 2BYBA 3DJDA 3T2KA 1NPXA 2R45A 4G73A 1SEZA 1BGJA 2VVMA 3LB8A 2XDOA 3AE6A 4UDRA 2WLRA 2OLOA 3ATRA 2K0ZA 2JTSA 3C4AA 5ER0A 4AOXA 1IUSA 2O9ZA 1KSUA 2YM1A 3VR8A 1RHDA 1BZLA 2WESA 3HIXA 3LJPA 5HBPA 4U8LA 4EIPA 3AE1A 4J57A 1TYPA 1UKVG 4A9WA 1T3KA 4II2A 3FLHA 1GNDA 3Q9TA 4B69A 3T14A 3NK1X 1LQUA 4PABA 3LADA 5KMSA 3I2VA 4U8OA 3K30A 3ITJA 2WP9A 4A79A 1TQ1A 3TP9A 1PXCA 1VQWA 3ALMA 3CPIG 4BK2A 4KX6A 1GETA 1VG9A 2JBVA 2XVHA 3GRSA 2GQFA 4RSLA 4TM0A 4CBQA 2BACA 4JNQA 1DOBA 1XDIA 3AE8A 5JCNA 3AE3A 2R4EA 2V60A 1Z6LA 2QCUA 3CNJA 2CULA 3GYJA 2WETA 2BRAA 5L46A 2C67A 4J34A 2CDUA 1CHUA 4BV6A 4IV9A 1KSSA 3BHFA 4II3A 1PBFA 3QSMA 2YR6A 1N4VA 3HZLA 5JCIA 4NEVA 4OPGA 4YT0A 3DH9A 5HBOA 3OLHA 3SZWA 1XPQA 3RP7A 4B64A 4EQSA 1PJ6A 4GCMA 2B76A 4IA6A 4U8MA 3COXA 2ARDA 3HYWA 1LPFA 3S61A 4FX9A 2BCPA 4REKA 4U8KA 1JU2A 2WU5A 3UP5A 1M64A 3ABVA 5M0ZA 2GVCA 3SXIA 4CNKA 1Y56B 5JCKA 5KWFA 3EAOA 2JB1A 1BF3A 1ORBA 2A8XA 3AD7B 2A87A 1TYTA 3CNSA 3T31A 1CJ2A 1DJNA 2C65A 3FMWA 5U1OA 1S2QA 4GAVA 3M12A 2FJEA 3AECA 2YG4A 4LIIA 3EANA 4CCRA 2YVGA 4C5OA 4DSHA 3UOYA 3OC4A 5HHFA 3SX6A 1GERA 5KOXA 2BK3A 5FMHA 1D5TA 5BULA 3TG1B 2BA9A 4Z2UA 3BI2A 1TDKA 1ZOVA 5HBLA 3CPHG 3DGHA 3LZWA 2IVEA 4H4ZA 4ICYA 4A99A 4Z26A 1VG0A 2WPEA 4GF7A 2B7RA 3P4RA 3QVPA 4J2WA 1E1KA 4M52A 3K9RA 2QA1A 3G5QA 1WV9A 1GALA 3V76A 1D7LA 1FEAA 2EG3A 4AP3A 5KRQA 1YS0A 2FBWA 4OVIA 3GK5A 1CJ4A 4A6NB 3V3OA 4WH7A 4B1BA 1CC6A 3JSKA 4TM1A 5BUKA 2VRMA 3DK9A 2GH5A 3NTDA 1H83A 2R0PA 1YMLA 3CNTA 5FS6A 1YMKA 3I3UA 4E0VA 2EG4A 2XFUA 2YR5A 3I3LA 3ISHA 3M0OA 1ZY8A 2Q0KA 1E1NA 3P1WA 4Y4MA 1KF6A 2XVIA 3G5JA 1YY5A 3G5SA 1DP2A 4OPUA 2B7SA 1OKGA 4XXGA 3UKHA 2BXRA 4EIQA 2QA2A 3NH3X 1Y0PA 1V59A 2PYXA 1L9EA 2WPCA 3RHAA 3AYIA 2X3NA 4H4SA 4B63A 4U8JA 1D4DA 1NAAA 3P4QA 4EMWA 4JY3A 3CNDA 1L9DA 1VRQB 4ECHA 5M10A 1YMDA 5KMQA 1B5QA 3CNPA 1H7XA 2ZBWA 1E0CA 1COYA 2XVFA 4YSHA 5LAMA 4GAPA 1K0JA 2XFPA 2YLXA 1OJDA 3ICRA 3FOJA 3NHOX 2V3AA 4GR1A 5KVIA 1DXLA 1DNCA 2JAEA 1OJ9A 2OA1A 3M13A 1LJ1A 3NN6X 4U2SA 4XWZA 4EM4A 3BI5A 4UDQA 3VRDB 3BHKA 4YKFA 1LTXR 1IUUA 2C66A 3QFAA 3HWIA 3ICTA 1KNRA 4ZN0A 4GDPA 4G74A 4AT0A 4EMIA 1E7PA 4USQA 3VR9A 1GT8A 1ZOYA 2BCGG 2GQWA 2YR4A 3UP4A 1NEKA 3QJ4A 3DA1A 2X50A 3AB1A 1XANA 4Z43A 3SQPA 4BK3A 1K4QA 1IUWA 2DKHA 2R9ZA 3BNMA 2WBAA 3CPJG 4IVOB 1CWTA 4TLXA 4D03A 2YWLA 2IFVA 1PN0A 1TRBA 1PBDA 1Y56A 2FJAA 4YSYA 2R0GA 2YG6A 3IWAA 1TDOA 5EB5A 5EOWA 4P9SA 3UOZA 4BJZA 1LVLA 1QXNA 2Z5XA 2W0HA 1EL9A 3DMEA 3Q6JA 5KVHA 4ADWA 5CQFA 1KNPA 4H4PA 3AEDA 4AP1A 4DGKA 1VEEA 1O95A 1YKJA 3HZUA 3IC9A 3GMBA 4G6GA 2BK5A 3PVCA 4WX1A 3L8KA 4NTDA 4DSGA 5BRTA 4O5QA 2C7GA 1TDEA 4H2RA 2GMHA 1E1LA 4X9MA 3AXBA 4N9XA 1PDHA 2AR8A 1FOHA 2GV8A 4K7ZA 2MOLA 1CBOA 3IHGA 2YM2A 3AEAA 3K7QX 4CY8A 3AE9A 4APNA 2VRLA 4Z2TA 2JTQA 2C70A 4AOSA 4NZHA 2Q82A 2E1MA 3AAYA 2NPXA 2ZZCA 3CGDA 4H4WA 2H88A 3BNUA 4NTCA 1PJ7A 1Q9IA 1EBDA 3D1CA 1Q1RA 4U2LA 2F5ZA 1ZK7A 2BXSA 4A6NA 4ZCCA 2BS2A 3NN0X 4IA5A 2GR1A 5U25A 4HA6A 1MXTA 3AEGA 4OPLA 1YQ3A 4J36A 1P2HA 3NYCA 2Q7VA 3GD3A 1KFYA 3C4NA 4NTEA 2V61A 3FG2P 4B67A 3F4AA 1JNRA 3IF9A 3UTFA 2GAGB 2OAMA 2VQBA 2C76A 4GDEA 2FJBA 3UKKA 1H4KX 1GTHA 1ONFA 3NNEA 1HZMA 1ZKQA 2TMDA 3KLJA 4CRTA 3DJGX 1QJDA 3AE2A 1LQTA 1CC4A 4H4TA 4JDRA 3LXDA 3QFBA 2BC1A 4DNAA 4FDCB 3ICSA 4EQWA 3ALJA 3UOXA 4K8DA 2X8HA 1DJQA 3FIMB 3I6DA 4H2PA 4FK1C 3E1TA 3GYXA 3UKQA 2JB3A 4LA1A 1EL5A 1NDAA 1YM9A 4H2NA
chains in the Genus database with same CATH topology
5IPYA 3P3AA 2YG3A 3CMMA 5KXJA 3DGZA 1DOEA 2WP6A 4EMJA 3P4SA 3HYVA 2R4JA 5FS8A 2IFDA 1H81A 1QO8A 2C72A 2Y6QA 3NIXA 4I59A 3LZXA 1CF3A 2YLTA 2YQUA 1BKWA 2RABA 3F8RA 3UOVA 5FS7A 1PJ5A 1D4EA 1DODA 2VOUA 2HHGA 2XLPA 3H4KA 4GUVA 4K2XA 2OUCA 1GRBA 2EQ8A 1ZX9A 3B3RA 1F6MA 2QAEA 4C74A 1CWRA 5LV9A 4WCTA 2BS4A 2YLRA 4CCQA 4YSZA 3R9UA 1IJHA 1JEHA 5HYMA 4A5LA 2AAQA 4U2TA 1OJAA 1GRAA 3V3NA 3AWIA 1EL8A 4JNAA 2RGJA 3QSEA 1W4XA 4B66A 3SYIA 5JCLA 3GWFA 2XLRA 3KPKA 3II4A 1GRTA 3TG3A 2IIDA 4K5SA 1F8RA 4OPDA 2C75A 1FEBA 3KKJA 2Q0LA 3NKSA 3IHMA 4Z24A 4IVMB 3SGLA 3GYIA 1URHA 1M6IA 3SY4A 5IQ1A 3UKAA 4F67A 2EQ7A 2YLZA 4NEWA 3DK4A 1N1PA 4G6HA 5IQ4A 1JRXA 1NHQA 1GOSA 4YWOA 3T37A 1NHRA 2V5ZA 1F8SA 1GREA 4Y4NA 1RHSA 1IUXA 1H4MX 1E39A 1L9CA 3KVEA 3DK8A 3C96A 1H86A 1PBEA 3P4PA 4BJYA 2FSXA 3QVRA 1NHPA 1FECA 1S3EA 2YG7A 3SZFA 3UCLA 4D04A 2EQ6A 1GRGA 4H4XA 2CVJA 1GTEA 3D1PA 1F3PA 1YQ4A 2UZZA 3UKPA 4A7AA 4C77A 3EF6A 3RNMA 3AAXA 3CGCA 5J60A 1PXBA 1B8SA 2GMJA 5KMPA 4J31A 5EB4A 3WE0A 3H8LA 3SZ0A 1AOGA 2BS3A 2XCGA 2XLTA 2Z5YA 2E4GA 1PBCA 2BK4A 3AD8B 3PS9A 1NG4A 4YTPA 2TPRA 3NG7X 2BABA 2GR0A 3NRNA 4USRA 3NK0X 1FCDA 4J33A 4Z44A 5TR3A 5LAOA 1NENA 1BWCA 3IWHA 2X99A 3SM8A 3T2ZA 4HB9A 5HBQA 1P2EA 3NGCX 4FK1A 3FPZA 3NHVA 1NG3A 5DBJA 3F8PA 3F8DA 3VRBA 1GPEA 2YVFA 2GF3A 2A89A 4TM3A 2VVLA 3CGEA 3ZDNA 1GEUA 2J6PA 3KD9A 4B68A 1ZMDA 1H84A 2RGOA 4Y4LA 3PO7A 1CC2A 1YQZA 3D8XA 2GWFA 3NK2X 1VDCA 4H4VA 4MJWA 3QSSA 1MOKA 1NHSA 2XLSA 1PHHA 4RG4A 4C3YA 4U8PA 1Q1WA 3L1RA 3NLCA 2YAUA 1K0IA 2ZZBA 5HXIA 4NNJA 1CL0A 2EQ9A 4RG3A 4OCGA 2YLSA 4UP3A 3G5RA 5BVAA 4CY6A 2VQ7A 1H7WA 3KA7A 3O3WA 4K22A 5KMRA 4H50A 2X8CA 1GXFA 4OPTA 2JB2A 1XHCA 2B9WA 2WQYA 3VRAA 2WOIA 4JY2A 4JQ9A 4C3XA 4H4UA 1CJCA 2WEUA 2DCQA 2C3CA 4Z25A 1B4VA 3EPTA 3S5WA 3SFEA 1OJTA 2HQMA 5GSNA 3SZCA 3CN8A 2WOWA 3HYXA 2H89A 4YSXA 1IUVA 2WDRA 3REDA 1O5WA 2DKIA 2GAHB 2ZZ0A 4O5UA 4Z2RA 3AE4A 1RSGA 2WOVA 1HYUA 1KDGA 2Y6RA 1QB0A 2X8GA 4EQRA 4YXDA 2IVDA 4TLZA 1JRYA 4U8IA 3LOVA 3ZYXA 3DJJA 3AYLA 4OPIA 2AQJA 5KOWA 2VSWA 1CJ3A 3UTEA 1C25A 2WDVA 2CFYA 1EL7A 4JN9A 3UTGA 1E6EA 4A65A 3NTAA 2ORAA 2YVJA 2GB0A 3NYFA 2WPFA 3T0KA 3FBSA 4BK1A 4YTNA 2R46A 4WH9A 3AE7A 2C4CA 2XYOA 3AEEA 3GMCA 3RP6A 1H6VA 1ZDLA 3UKFA 1JOAA 1REOA 4H2QA 2UZQA 4ZCDA 2XLUA 2J3NA 1CWSA 1E1MA 2WP5A 3KU9A 2GR2A 1B37A 3GSIA 2A2KA 5FS9A 2OLNA 4CNJA 1GESA 3K7MX 4TM4A 1F8WA 1ZP0A 2Q6UA 3IPPA 3K7TA 4H4RA 3GD4A 4LU6A 4YTMA 3GRTA 1DOCA 1PS9A 2YLWA 4NWZA 5KNLA 3GDNA 5JCMA 5J7XA 4H7UA 5U63A 1LV0A 2JTRA 2WHDA 2XVEA 3UTNX 1YT8A 1OJCA 1TDFA 1MO9A 2VVLG 2C64A 3AE5A 4X9NA 3UKLA 3NYEA 1N4WA 5C3JA 3ILMA 5HPAA 2V3BA 1N4UA 4PAAA 4I58A 3OP3A 2B9XA 3FS5A 2FJDA 3ALLA 4J56A 4K5RA 2WDQA 3T2YA 2I0ZA 3GDPA 4EQXA 1QLBA 2ACZA 2XFNA 4UDPA 1D7YA 4G9KA 4EM3A 1O94A 2C3DA 2XFOA 3RP8A 3FNJA 3MZZA 1RYIA 1ELIA 3DJEA 1ZMCA 1BOIA 2KL3A 1GSNA 2B9YA 1H82A 2YG5A 3GWDA 3P9UA 3ADAB 1S2YA 2V6OA 3H8IA 4GRTA 5GRTA 3O0HA 1L0VA 1X31B 4KPRA 1K0LA 2OALA 3VQRA 2XVJA 4H4YA 3CTYA 2E5VA 3AD9B 1FL2A 3KPFA 5EBKA 4BURA 2JK6A 4B65A 2JKCA 1BOHA 3NT6A 1UARA 1TDNA 1WHBA 2GEWA 2R0CA 3SFDA 3URHA 3AEBA 1S3BA 2VZ2A 4U8NA 1PXAA 4X4JA 4JGTA 1PBBA 3AEFA 3R2UA 2BC0A 5CKUA 3B6DA 1RP0A 2GRTA 2RGHA 3AYJA 4H4QA 1GMXA 3ATQA 1GRFA 2PHHA 3IPOA 2MRMA 2WLXA 3CIRA 1BGNA 1IUTA 2BRYA 2GR3A 2XFQA 3OZ2A 4XWRA 5HY5A 2MOIA 3CGBA 1GRHA 4OPCA 1D4CA 1JNZA 1GV4A 2WS3A 2APGA 2C73A 4AT2A 1GN0A 5C2TA 2WU2A 4YKGA 2NVKX 2EG4B 3BI4A 1JRZA 3UTHA 2BYBA 3DJDA 3T2KA 1NPXA 2R45A 4G73A 1SEZA 1BGJA 2VVMA 3LB8A 2XDOA 3AE6A 4UDRA 2WLRA 2OLOA 3ATRA 2K0ZA 2JTSA 3C4AA 5ER0A 4AOXA 1IUSA 2O9ZA 1KSUA 2YM1A 3VR8A 1RHDA 1BZLA 2WESA 3HIXA 3LJPA 5HBPA 4U8LA 4EIPA 3AE1A 4J57A 1TYPA 1UKVG 4A9WA 1T3KA 4II2A 3FLHA 1GNDA 3Q9TA 4B69A 3T14A 3NK1X 1LQUA 4PABA 3LADA 5KMSA 3I2VA 4U8OA 3K30A 3ITJA 2WP9A 4A79A 1TQ1A 3TP9A 1PXCA 1VQWA 3ALMA 3CPIG 4BK2A 4KX6A 1GETA 1VG9A 2JBVA 2XVHA 3GRSA 2GQFA 4RSLA 4TM0A 4CBQA 2BACA 4JNQA 1DOBA 1XDIA 3AE8A 5JCNA 3AE3A 2R4EA 2V60A 1Z6LA 2QCUA 3CNJA 2CULA 3GYJA 2WETA 2BRAA 5L46A 2C67A 4J34A 2CDUA 1CHUA 4BV6A 4IV9A 1KSSA 3BHFA 4II3A 1PBFA 3QSMA 2YR6A 1N4VA 3HZLA 5JCIA 4NEVA 4OPGA 4YT0A 3DH9A 5HBOA 3OLHA 3SZWA 1XPQA 3RP7A 4B64A 4EQSA 1PJ6A 4GCMA 2B76A 4IA6A 4U8MA 3COXA 2ARDA 3HYWA 1LPFA 3S61A 4FX9A 2BCPA 4REKA 4U8KA 1JU2A 2WU5A 3UP5A 1M64A 3ABVA 5M0ZA 2GVCA 3SXIA 4CNKA 1Y56B 5JCKA 5KWFA 3EAOA 2JB1A 1BF3A 1ORBA 2A8XA 3AD7B 2A87A 1TYTA 3CNSA 3T31A 1CJ2A 1DJNA 2C65A 3FMWA 5U1OA 1S2QA 4GAVA 3M12A 2FJEA 3AECA 2YG4A 4LIIA 3EANA 4CCRA 2YVGA 4C5OA 4DSHA 3UOYA 3OC4A 5HHFA 3SX6A 1GERA 5KOXA 2BK3A 5FMHA 1D5TA 5BULA 3TG1B 2BA9A 4Z2UA 3BI2A 1TDKA 1ZOVA 5HBLA 3CPHG 3DGHA 3LZWA 2IVEA 4H4ZA 4ICYA 4A99A 4Z26A 1VG0A 2WPEA 4GF7A 2B7RA 3P4RA 3QVPA 4J2WA 1E1KA 4M52A 3K9RA 2QA1A 3G5QA 1WV9A 1GALA 3V76A 1D7LA 1FEAA 2EG3A 4AP3A 5KRQA 1YS0A 2FBWA 4OVIA 3GK5A 1CJ4A 4A6NB 3V3OA 4WH7A 4B1BA 1CC6A 3JSKA 4TM1A 5BUKA 2VRMA 3DK9A 2GH5A 3NTDA 1H83A 2R0PA 1YMLA 3CNTA 5FS6A 1YMKA 3I3UA 4E0VA 2EG4A 2XFUA 2YR5A 3I3LA 3ISHA 3M0OA 1ZY8A 2Q0KA 1E1NA 3P1WA 4Y4MA 1KF6A 2XVIA 3G5JA 1YY5A 3G5SA 1DP2A 4OPUA 2B7SA 1OKGA 4XXGA 3UKHA 2BXRA 4EIQA 2QA2A 3NH3X 1Y0PA 1V59A 2PYXA 1L9EA 2WPCA 3RHAA 3AYIA 2X3NA 4H4SA 4B63A 4U8JA 1D4DA 1NAAA 3P4QA 4EMWA 4JY3A 3CNDA 1L9DA 1VRQB 4ECHA 5M10A 1YMDA 5KMQA 1B5QA 3CNPA 1H7XA 2ZBWA 1E0CA 1COYA 2XVFA 4YSHA 5LAMA 4GAPA 1K0JA 2XFPA 2YLXA 1OJDA 3ICRA 3FOJA 3NHOX 2V3AA 4GR1A 5KVIA 1DXLA 1DNCA 2JAEA 1OJ9A 2OA1A 3M13A 1LJ1A 3NN6X 4U2SA 4XWZA 4EM4A 3BI5A 4UDQA 3VRDB 3BHKA 4YKFA 1LTXR 1IUUA 2C66A 3QFAA 3HWIA 3ICTA 1KNRA 4ZN0A 4GDPA 4G74A 4AT0A 4EMIA 1E7PA 4USQA 3VR9A 1GT8A 1ZOYA 2BCGG 2GQWA 2YR4A 3UP4A 1NEKA 3QJ4A 3DA1A 2X50A 3AB1A 1XANA 4Z43A 3SQPA 4BK3A 1K4QA 1IUWA 2DKHA 2R9ZA 3BNMA 2WBAA 3CPJG 4IVOB 1CWTA 4TLXA 4D03A 2YWLA 2IFVA 1PN0A 1TRBA 1PBDA 1Y56A 2FJAA 4YSYA 2R0GA 2YG6A 3IWAA 1TDOA 5EB5A 5EOWA 4P9SA 3UOZA 4BJZA 1LVLA 1QXNA 2Z5XA 2W0HA 1EL9A 3DMEA 3Q6JA 5KVHA 4ADWA 5CQFA 1KNPA 4H4PA 3AEDA 4AP1A 4DGKA 1VEEA 1O95A 1YKJA 3HZUA 3IC9A 3GMBA 4G6GA 2BK5A 3PVCA 4WX1A 3L8KA 4NTDA 4DSGA 5BRTA 4O5QA 2C7GA 1TDEA 4H2RA 2GMHA 1E1LA 4X9MA 3AXBA 4N9XA 1PDHA 2AR8A 1FOHA 2GV8A 4K7ZA 2MOLA 1CBOA 3IHGA 2YM2A 3AEAA 3K7QX 4CY8A 3AE9A 4APNA 2VRLA 4Z2TA 2JTQA 2C70A 4AOSA 4NZHA 2E1MA 2NPXA 3AAYA 2ZZCA 3CGDA 4H4WA 2H88A 3BNUA 4NTCA 1PJ7A 1Q9IA 1EBDA 3D1CA 1Q1RA 4U2LA 2F5ZA 1ZK7A 2BXSA 4A6NA 4ZCCA 2BS2A 3NN0X 4IA5A 2GR1A 5U25A 4HA6A 1MXTA 3AEGA 4OPLA 1YQ3A 4J36A 1P2HA 3NYCA 2Q7VA 3GD3A 1KFYA 3C4NA 4NTEA 2V61A 3FG2P 4B67A 3F4AA 1JNRA 3IF9A 3UTFA 2GAGB 2OAMA 2VQBA 2C76A 4GDEA 2FJBA 3UKKA 1H4KX 1GTHA 1ONFA 3NNEA 1HZMA 1ZKQA 2TMDA 3KLJA 4CRTA 3DJGX 1QJDA 3AE2A 1LQTA 1CC4A 4H4TA 4JDRA 3LXDA 3QFBA 2BC1A 4DNAA 4FDCB 3ICSA 4EQWA 3ALJA 3UOXA 4K8DA 2X8HA 1DJQA 3FIMB 3I6DA 4H2PA 4FK1C 3E1TA 3GYXA 3UKQA 2JB3A 4LA1A 1EL5A 1NDAA 1YM9A 4H2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IPY A;  3P3A A;  2YG3 A;  5KXJ A;  3DGZ A;  1DOE A;  2WP6 A;  4EMJ A;  3P4S A;  2R4J A;  5FS8 A;  2IFD A;  1H81 A;  1QO8 A;  2C72 A;  2Y6Q A;  3NIX A;  4I59 A;  3LZX A;  1CF3 A;  2YLT A;  2YQU A;  1BKW A;  2RAB A;  3F8R A;  3UOV A;  5FS7 A;  1PJ5 A;  1D4E A;  1DOD A;  2VOU A;  2HHG A;  2XLP A;  3H4K A;  4GUV A;  4K2X A;  2OUC A;  1GRB A;  2EQ8 A;  1ZX9 A;  3B3R A;  1F6M A;  2QAE A;  4C74 A;  1CWR A;  5LV9 A;  4WCT A;  2BS4 A;  2YLR A;  4CCQ A;  4YSZ A;  3R9U A;  1IJH A;  1JEH A;  5HYM A;  4A5L A;  2AAQ A;  4U2T A;  1OJA A;  1GRA A;  3V3N A;  3AWI A;  1EL8 A;  4JNA A;  2RGJ A;  3QSE A;  1W4X A;  4B66 A;  5JCL A;  3GWF A;  2XLR A;  3II4 A;  1GRT A;  3TG3 A;  2IID A;  4K5S A;  1F8R A;  4OPD A;  2C75 A;  1FEB A;  3KKJ A;  2Q0L A;  3NKS A;  3IHM A;  4Z24 A;  4IVM B;  3SGL A;  3GYI A;  1URH A;  1M6I A;  5IQ1 A;  3UKA A;  4F67 A;  2EQ7 A;  2YLZ A;  4NEW A;  3DK4 A;  1N1P A;  5IQ4 A;  1JRX A;  1NHQ A;  1GOS A;  4YWO A;  3T37 A;  1NHR A;  2V5Z A;  1F8S A;  1GRE A;  4Y4N A;  1RHS A;  1IUX A;  1H4M X;  1E39 A;  1L9C A;  3KVE A;  3DK8 A;  3C96 A;  1H86 A;  1PBE A;  3P4P A;  4BJY A;  2FSX A;  3QVR A;  1NHP A;  1FEC A;  1S3E A;  2YG7 A;  3UCL A;  4D04 A;  2EQ6 A;  1GRG A;  4H4X A;  2CVJ A;  1GTE A;  3D1P A;  1F3P A;  1YQ4 A;  2UZZ A;  3UKP A;  4A7A A;  4C77 A;  3EF6 A;  3RNM A;  3AAX A;  3CGC A;  5J60 A;  1PXB A;  1B8S A;  2GMJ A;  4J31 A;  5EB4 A;  3WE0 A;  3H8L A;  1AOG A;  2BS3 A;  2XCG A;  2XLT A;  2Z5Y A;  2E4G A;  1PBC A;  2BK4 A;  3AD8 B;  3PS9 A;  1NG4 A;  4YTP A;  2TPR A;  3NG7 X;  2BAB A;  2GR0 A;  3NRN A;  4USR A;  3NK0 X;  1FCD A;  4J33 A;  4Z44 A;  5TR3 A;  5LAO A;  1NEN A;  1BWC A;  3IWH A;  2X99 A;  3SM8 A;  4HB9 A;  5HBQ A;  1P2E A;  3NGC X;  4FK1 A;  3FPZ A;  3NHV A;  1NG3 A;  5DBJ A;  3F8P A;  3F8D A;  3VRB A;  1GPE A;  2YVF A;  2GF3 A;  2A89 A;  4TM3 A;  2VVL A;  3CGE A;  3ZDN A;  1GEU A;  2J6P A;  3KD9 A;  4B68 A;  1ZMD A;  1H84 A;  2RGO A;  4Y4L A;  3PO7 A;  1CC2 A;  1YQZ A;  3D8X A;  2GWF A;  3NK2 X;  1VDC A;  4H4V A;  4MJW A;  3QSS A;  1MOK A;  1NHS A;  2XLS A;  1PHH A;  4RG4 A;  4C3Y A;  4U8P A;  1Q1W A;  3L1R A;  3NLC A;  2YAU A;  1K0I A;  2ZZB A;  5HXI A;  1CL0 A;  2EQ9 A;  4RG3 A;  4OCG A;  2YLS A;  4UP3 A;  3G5R A;  5BVA A;  4CY6 A;  2VQ7 A;  1H7W A;  3KA7 A;  3O3W A;  4K22 A;  4H50 A;  2X8C A;  1GXF A;  4OPT A;  2JB2 A;  1XHC A;  2B9W A;  2WQY A;  3VRA A;  2WOI A;  4JY2 A;  4JQ9 A;  4C3X A;  4H4U A;  1CJC A;  2WEU A;  2DCQ A;  2C3C A;  4Z25 A;  1B4V A;  3EPT A;  3S5W A;  3SFE A;  1OJT A;  2HQM A;  5GSN A;  3CN8 A;  2WOW A;  4YSX A;  2H89 A;  1IUV A;  2WDR A;  3RED A;  1O5W A;  2DKI A;  2GAH B;  2ZZ0 A;  4O5U A;  4Z2R A;  3AE4 A;  1RSG A;  2WOV A;  1HYU A;  1KDG A;  2Y6R A;  1QB0 A;  2X8G A;  4EQR A;  4YXD A;  2IVD A;  4TLZ A;  1JRY A;  4U8I A;  3LOV A;  3ZYX A;  3DJJ A;  3AYL A;  4OPI A;  2AQJ A;  5KOW A;  2VSW A;  1CJ3 A;  3UTE A;  1C25 A;  2WDV A;  2CFY A;  1EL7 A;  4JN9 A;  3UTG A;  1E6E A;  4A65 A;  3NTA A;  2ORA A;  2YVJ A;  2GB0 A;  3NYF A;  2WPF A;  4BK1 A;  3FBS A;  4YTN A;  2R46 A;  4WH9 A;  3AE7 A;  3AEE A;  2XYO A;  3GMC A;  3RP6 A;  3UKF A;  1H6V A;  1ZDL A;  1JOA A;  1REO A;  4H2Q A;  2UZQ A;  4ZCD A;  2XLU A;  2J3N A;  1CWS A;  1E1M A;  2WP5 A;  3KU9 A;  2GR2 A;  1B37 A;  3GSI A;  2A2K A;  5FS9 A;  2OLN A;  4CNJ A;  1GES A;  3K7M X;  4TM4 A;  1F8W A;  1ZP0 A;  2Q6U A;  3IPP A;  3K7T A;  4H4R A;  3GD4 A;  4LU6 A;  4YTM A;  3GRT A;  1DOC A;  1PS9 A;  2YLW A;  3GDN A;  5JCM A;  5J7X A;  4H7U A;  5U63 A;  1LV0 A;  2JTR A;  2WHD A;  2XVE A;  3UTN X;  1YT8 A;  1OJC A;  1TDF A;  1MO9 A;  2VVL G;  2C64 A;  3AE5 A;  4X9N A;  3UKL A;  3NYE A;  1N4W A;  5C3J A;  3ILM A;  5HPA A;  2V3B A;  1N4U A;  4PAA A;  4I58 A;  3OP3 A;  2B9X A;  3FS5 A;  2FJD A;  3ALL A;  4J56 A;  4K5R A;  2WDQ A;  2I0Z A;  3GDP A;  4EQX A;  1QLB A;  2ACZ A;  2XFN A;  4UDP A;  1D7Y A;  4EM3 A;  1O94 A;  2C3D A;  2XFO A;  3RP8 A;  3FNJ A;  3MZZ A;  1RYI A;  1ELI A;  3DJE A;  1ZMC A;  1BOI A;  2KL3 A;  1GSN A;  2B9Y A;  1H82 A;  2YG5 A;  3GWD A;  3P9U A;  3ADA B;  1S2Y A;  2V6O A;  3H8I A;  4GRT A;  5GRT A;  3O0H A;  1L0V A;  1X31 B;  4KPR A;  1K0L A;  2OAL A;  3VQR A;  2XVJ A;  4H4Y A;  3CTY A;  2E5V A;  3AD9 B;  1FL2 A;  3KPF A;  5EBK A;  4BUR A;  2JK6 A;  4B65 A;  2JKC A;  1BOH A;  3NT6 A;  1UAR A;  1TDN A;  1WHB A;  2GEW A;  2R0C A;  3SFD A;  3URH A;  3AEB A;  1S3B A;  2VZ2 A;  4U8N A;  1PXA A;  4X4J A;  4JGT A;  1PBB A;  3AEF A;  3R2U A;  2BC0 A;  5CKU A;  3B6D A;  1RP0 A;  2GRT A;  2RGH A;  3AYJ A;  4H4Q A;  1GMX A;  3ATQ A;  1GRF A;  2PHH A;  3IPO A;  2MRM A;  2WLX A;  3CIR A;  1BGN A;  1IUT A;  2XFQ A;  2GR3 A;  3OZ2 A;  4XWR A;  5HY5 A;  2MOI A;  3CGB A;  1GRH A;  4OPC A;  1D4C A;  1JNZ A;  1GV4 A;  2WS3 A;  2APG A;  2C73 A;  4AT2 A;  1GN0 A;  5C2T A;  2WU2 A;  4YKG A;  2NVK X;  2EG4 B;  3BI4 A;  1JRZ A;  3UTH A;  2BYB A;  3DJD A;  1NPX A;  2R45 A;  1SEZ A;  1BGJ A;  2VVM A;  3LB8 A;  2XDO A;  3AE6 A;  4UDR A;  2WLR A;  2OLO A;  3ATR A;  2K0Z A;  2JTS A;  3C4A A;  5ER0 A;  4AOX A;  1IUS A;  2O9Z A;  1KSU A;  2YM1 A;  3VR8 A;  1RHD A;  1BZL A;  2WES A;  3HIX A;  3LJP A;  5HBP A;  4U8L A;  4EIP A;  3AE1 A;  4J57 A;  1TYP A;  1UKV G;  4A9W A;  1T3K A;  4B69 A;  3FLH A;  1GND A;  3Q9T A;  3NK1 X;  1LQU A;  4PAB A;  3LAD A;  3I2V A;  4U8O A;  3K30 A;  3ITJ A;  2WP9 A;  4A79 A;  1TQ1 A;  3TP9 A;  1PXC A;  1VQW A;  3ALM A;  3CPI G;  4BK2 A;  4KX6 A;  1GET A;  1VG9 A;  2JBV A;  2XVH A;  3GRS A;  2GQF A;  4RSL A;  4TM0 A;  4CBQ A;  2BAC A;  4JNQ A;  1DOB A;  1XDI A;  3AE8 A;  5JCN A;  3AE3 A;  2R4E A;  2V60 A;  1Z6L A;  2QCU A;  3CNJ A;  2CUL A;  3GYJ A;  2WET A;  5L46 A;  2C67 A;  4J34 A;  2CDU A;  1CHU A;  4BV6 A;  4IV9 A;  1KSS A;  3BHF A;  1PBF A;  3QSM A;  2YR6 A;  1N4V A;  3HZL A;  5JCI A;  4NEV A;  4OPG A;  4YT0 A;  3DH9 A;  5HBO A;  3OLH A;  4B64 A;  1XPQ A;  3RP7 A;  4EQS A;  1PJ6 A;  4GCM A;  2B76 A;  4IA6 A;  4U8M A;  3COX A;  2ARD A;  1LPF A;  3S61 A;  4FX9 A;  2BCP A;  4REK A;  4U8K A;  1JU2 A;  2WU5 A;  3UP5 A;  1M64 A;  3ABV A;  5M0Z A;  2GVC A;  4CNK A;  1Y56 B;  5JCK A;  5KWF A;  3EAO A;  2JB1 A;  1BF3 A;  1ORB A;  2A8X A;  3AD7 B;  2A87 A;  1TYT A;  3CNS A;  1CJ2 A;  1DJN A;  2C65 A;  3FMW A;  5U1O A;  1S2Q A;  3M12 A;  2FJE A;  3AEC A;  2YG4 A;  4LII A;  3EAN A;  4CCR A;  2YVG A;  4C5O A;  4DSH A;  3UOY A;  3OC4 A;  5HHF A;  5KOX A;  1GER A;  2BK3 A;  5FMH A;  1D5T A;  5BUL A;  3TG1 B;  2BA9 A;  4Z2U A;  3BI2 A;  1TDK A;  1ZOV A;  5HBL A;  3CPH G;  3DGH A;  3LZW A;  2IVE A;  4H4Z A;  4ICY A;  4A99 A;  4Z26 A;  1VG0 A;  2WPE A;  4GF7 A;  2B7R A;  3P4R A;  3QVP A;  4J2W A;  1E1K A;  4M52 A;  3K9R A;  2QA1 A;  3G5Q A;  1WV9 A;  1GAL A;  3V76 A;  1D7L A;  1FEA A;  2EG3 A;  4AP3 A;  5KRQ A;  1YS0 A;  2FBW A;  4OVI A;  3GK5 A;  1CJ4 A;  4A6N B;  3V3O A;  4WH7 A;  4B1B A;  1CC6 A;  3JSK A;  4TM1 A;  5BUK A;  2VRM A;  3DK9 A;  2GH5 A;  3NTD A;  1H83 A;  2R0P A;  1YML A;  3CNT A;  5FS6 A;  1YMK A;  3I3U A;  4E0V A;  2EG4 A;  2XFU A;  2YR5 A;  3I3L A;  3ISH A;  3M0O A;  1ZY8 A;  2Q0K A;  1E1N A;  3P1W A;  4Y4M A;  1KF6 A;  2XVI A;  3G5J A;  1YY5 A;  3G5S A;  1DP2 A;  4OPU A;  2B7S A;  1OKG A;  4XXG A;  3UKH A;  2BXR A;  4EIQ A;  2QA2 A;  3NH3 X;  1Y0P A;  1V59 A;  2PYX A;  1L9E A;  2WPC A;  3RHA A;  3AYI A;  2X3N A;  4H4S A;  4B63 A;  4U8J A;  1D4D A;  1NAA A;  3P4Q A;  4EMW A;  4JY3 A;  3CND A;  1L9D A;  1VRQ B;  4ECH A;  5M10 A;  1YMD A;  1B5Q A;  3CNP A;  1H7X A;  2ZBW A;  1E0C A;  1COY A;  2XVF A;  4YSH A;  5LAM A;  1K0J A;  2XFP A;  2YLX A;  1OJD A;  3ICR A;  3FOJ A;  3NHO X;  2V3A A;  4GR1 A;  5KVI A;  1DXL A;  1DNC A;  2JAE A;  1OJ9 A;  2OA1 A;  3M13 A;  1LJ1 A;  3NN6 X;  4U2S A;  4XWZ A;  4EM4 A;  3BI5 A;  4UDQ A;  3VRD B;  3BHK A;  4YKF A;  1LTX R;  1IUU A;  2C66 A;  3QFA A;  3HWI A;  3ICT A;  1KNR A;  4ZN0 A;  4GDP A;  4AT0 A;  4EMI A;  1E7P A;  4USQ A;  3VR9 A;  1GT8 A;  1ZOY A;  2BCG G;  2GQW A;  2YR4 A;  3UP4 A;  1NEK A;  3QJ4 A;  3DA1 A;  2X50 A;  3AB1 A;  1XAN A;  4Z43 A;  3SQP A;  4BK3 A;  1K4Q A;  1IUW A;  2DKH A;  2R9Z A;  3BNM A;  2WBA A;  3CPJ G;  4IVO B;  1CWT A;  4TLX A;  4D03 A;  2YWL A;  2IFV A;  1PN0 A;  1TRB A;  1PBD A;  1Y56 A;  2FJA A;  4YSY A;  2R0G A;  2YG6 A;  3IWA A;  1TDO A;  5EB5 A;  5EOW A;  4P9S A;  3UOZ A;  4BJZ A;  1LVL A;  1QXN A;  2Z5X A;  2W0H A;  1EL9 A;  3DME A;  3Q6J A;  5KVH A;  4ADW A;  5CQF A;  1KNP A;  4H4P A;  3AED A;  4AP1 A;  4DGK A;  1VEE A;  1O95 A;  1YKJ A;  3HZU A;  3IC9 A;  3GMB A;  2BK5 A;  3PVC A;  4WX1 A;  3L8K A;  4NTD A;  4DSG A;  5BRT A;  4O5Q A;  2C7G A;  1TDE A;  4H2R A;  2GMH A;  1E1L A;  4X9M A;  3AXB A;  4N9X A;  1PDH A;  2AR8 A;  1FOH A;  2GV8 A;  4K7Z A;  2MOL A;  1CBO A;  3IHG A;  2YM2 A;  3AEA A;  3K7Q X;  4CY8 A;  3AE9 A;  4APN A;  2VRL A;  4Z2T A;  2JTQ A;  2C70 A;  4AOS A;  4NZH A;  2E1M A;  2NPX A;  3AAY A;  2ZZC A;  3CGD A;  4H4W A;  2H88 A;  3BNU A;  4NTC A;  1PJ7 A;  1Q9I A;  1EBD A;  3D1C A;  1Q1R A;  4U2L A;  2F5Z A;  1ZK7 A;  2BXS A;  4A6N A;  4ZCC A;  2BS2 A;  3NN0 X;  4IA5 A;  2GR1 A;  5U25 A;  4HA6 A;  1MXT A;  3AEG A;  4OPL A;  1YQ3 A;  4J36 A;  1P2H A;  3NYC A;  2Q7V A;  3GD3 A;  1KFY A;  3C4N A;  4NTE A;  2V61 A;  3FG2 P;  4B67 A;  3F4A A;  1JNR A;  3IF9 A;  3UTF A;  2GAG B;  2OAM A;  2VQB A;  2C76 A;  4GDE A;  2FJB A;  3UKK A;  1H4K X;  1GTH A;  1ONF A;  3NNE A;  1HZM A;  1ZKQ A;  2TMD A;  3KLJ A;  4CRT A;  3DJG X;  1QJD A;  3AE2 A;  1LQT A;  1CC4 A;  4H4T A;  4JDR A;  3LXD A;  3QFB A;  2BC1 A;  4DNA A;  4FDC B;  3ICS A;  4EQW A;  3ALJ A;  3UOX A;  4K8D A;  2X8H A;  1DJQ A;  3FIM B;  3I6D A;  4H2P A;  4FK1 C;  3E1T A;  3UKQ A;  2JB3 A;  4LA1 A;  1EL5 A;  1NDA A;  1YM9 A;  4H2N A; 
#chains in the Genus database with same CATH topology
 5IPY A;  3P3A A;  2YG3 A;  3CMM A;  5KXJ A;  3DGZ A;  1DOE A;  2WP6 A;  4EMJ A;  3P4S A;  3HYV A;  2R4J A;  5FS8 A;  2IFD A;  1H81 A;  1QO8 A;  2C72 A;  2Y6Q A;  3NIX A;  4I59 A;  3LZX A;  1CF3 A;  2YLT A;  2YQU A;  1BKW A;  2RAB A;  3F8R A;  3UOV A;  5FS7 A;  1PJ5 A;  1D4E A;  1DOD A;  2VOU A;  2HHG A;  2XLP A;  3H4K A;  4GUV A;  4K2X A;  2OUC A;  1GRB A;  2EQ8 A;  1ZX9 A;  3B3R A;  1F6M A;  2QAE A;  4C74 A;  1CWR A;  5LV9 A;  4WCT A;  2BS4 A;  2YLR A;  4CCQ A;  4YSZ A;  3R9U A;  1IJH A;  1JEH A;  5HYM A;  4A5L A;  2AAQ A;  4U2T A;  1OJA A;  1GRA A;  3V3N A;  3AWI A;  1EL8 A;  4JNA A;  2RGJ A;  3QSE A;  1W4X A;  4B66 A;  3SYI A;  5JCL A;  3GWF A;  2XLR A;  3KPK A;  3II4 A;  1GRT A;  3TG3 A;  2IID A;  4K5S A;  1F8R A;  4OPD A;  2C75 A;  1FEB A;  3KKJ A;  2Q0L A;  3NKS A;  3IHM A;  4Z24 A;  4IVM B;  3SGL A;  3GYI A;  1URH A;  1M6I A;  3SY4 A;  5IQ1 A;  3UKA A;  4F67 A;  2EQ7 A;  2YLZ A;  4NEW A;  3DK4 A;  1N1P A;  4G6H A;  5IQ4 A;  1JRX A;  1NHQ A;  1GOS A;  4YWO A;  3T37 A;  1NHR A;  2V5Z A;  1F8S A;  1GRE A;  4Y4N A;  1RHS A;  1IUX A;  1H4M X;  1E39 A;  1L9C A;  3KVE A;  3DK8 A;  3C96 A;  1H86 A;  1PBE A;  3P4P A;  4BJY A;  2FSX A;  3QVR A;  1NHP A;  1FEC A;  1S3E A;  2YG7 A;  3SZF A;  3UCL A;  4D04 A;  2EQ6 A;  1GRG A;  4H4X A;  2CVJ A;  1GTE A;  3D1P A;  1F3P A;  1YQ4 A;  2UZZ A;  3UKP A;  4A7A A;  4C77 A;  3EF6 A;  3RNM A;  3AAX A;  3CGC A;  5J60 A;  1PXB A;  1B8S A;  2GMJ A;  5KMP A;  4J31 A;  5EB4 A;  3WE0 A;  3H8L A;  3SZ0 A;  1AOG A;  2BS3 A;  2XCG A;  2XLT A;  2Z5Y A;  2E4G A;  1PBC A;  2BK4 A;  3AD8 B;  3PS9 A;  1NG4 A;  4YTP A;  2TPR A;  3NG7 X;  2BAB A;  2GR0 A;  3NRN A;  4USR A;  3NK0 X;  1FCD A;  4J33 A;  4Z44 A;  5TR3 A;  5LAO A;  1NEN A;  1BWC A;  3IWH A;  2X99 A;  3SM8 A;  3T2Z A;  4HB9 A;  5HBQ A;  1P2E A;  3NGC X;  4FK1 A;  3FPZ A;  3NHV A;  1NG3 A;  5DBJ A;  3F8P A;  3F8D A;  3VRB A;  1GPE A;  2YVF A;  2GF3 A;  2A89 A;  4TM3 A;  2VVL A;  3CGE A;  3ZDN A;  1GEU A;  2J6P A;  3KD9 A;  4B68 A;  1ZMD A;  1H84 A;  2RGO A;  4Y4L A;  3PO7 A;  1CC2 A;  1YQZ A;  3D8X A;  2GWF A;  3NK2 X;  1VDC A;  4H4V A;  4MJW A;  3QSS A;  1MOK A;  1NHS A;  2XLS A;  1PHH A;  4RG4 A;  4C3Y A;  4U8P A;  1Q1W A;  3L1R A;  3NLC A;  2YAU A;  1K0I A;  2ZZB A;  5HXI A;  4NNJ A;  1CL0 A;  2EQ9 A;  4RG3 A;  4OCG A;  2YLS A;  4UP3 A;  3G5R A;  5BVA A;  4CY6 A;  2VQ7 A;  1H7W A;  3KA7 A;  3O3W A;  4K22 A;  5KMR A;  4H50 A;  2X8C A;  1GXF A;  4OPT A;  2JB2 A;  1XHC A;  2B9W A;  2WQY A;  3VRA A;  2WOI A;  4JY2 A;  4JQ9 A;  4C3X A;  4H4U A;  1CJC A;  2WEU A;  2DCQ A;  2C3C A;  4Z25 A;  1B4V A;  3EPT A;  3S5W A;  3SFE A;  1OJT A;  2HQM A;  5GSN A;  3SZC A;  3CN8 A;  2WOW A;  3HYX A;  2H89 A;  4YSX A;  1IUV A;  2WDR A;  3RED A;  1O5W A;  2DKI A;  2GAH B;  2ZZ0 A;  4O5U A;  4Z2R A;  3AE4 A;  1RSG A;  2WOV A;  1HYU A;  1KDG A;  2Y6R A;  1QB0 A;  2X8G A;  4EQR A;  4YXD A;  2IVD A;  4TLZ A;  1JRY A;  4U8I A;  3LOV A;  3ZYX A;  3DJJ A;  3AYL A;  4OPI A;  2AQJ A;  5KOW A;  2VSW A;  1CJ3 A;  3UTE A;  1C25 A;  2WDV A;  2CFY A;  1EL7 A;  4JN9 A;  3UTG A;  1E6E A;  4A65 A;  3NTA A;  2ORA A;  2YVJ A;  2GB0 A;  3NYF A;  2WPF A;  3T0K A;  3FBS A;  4BK1 A;  4YTN A;  2R46 A;  4WH9 A;  3AE7 A;  2C4C A;  2XYO A;  3AEE A;  3GMC A;  3RP6 A;  1H6V A;  1ZDL A;  3UKF A;  1JOA A;  1REO A;  4H2Q A;  2UZQ A;  4ZCD A;  2XLU A;  2J3N A;  1CWS A;  1E1M A;  2WP5 A;  3KU9 A;  2GR2 A;  1B37 A;  3GSI A;  2A2K A;  5FS9 A;  2OLN A;  4CNJ A;  1GES A;  3K7M X;  4TM4 A;  1F8W A;  1ZP0 A;  2Q6U A;  3IPP A;  3K7T A;  4H4R A;  3GD4 A;  4LU6 A;  4YTM A;  3GRT A;  1DOC A;  1PS9 A;  2YLW A;  4NWZ A;  5KNL A;  3GDN A;  5JCM A;  5J7X A;  4H7U A;  5U63 A;  1LV0 A;  2JTR A;  2WHD A;  2XVE A;  3UTN X;  1YT8 A;  1OJC A;  1TDF A;  1MO9 A;  2VVL G;  2C64 A;  3AE5 A;  4X9N A;  3UKL A;  3NYE A;  1N4W A;  5C3J A;  3ILM A;  5HPA A;  2V3B A;  1N4U A;  4PAA A;  4I58 A;  3OP3 A;  2B9X A;  3FS5 A;  2FJD A;  3ALL A;  4J56 A;  4K5R A;  2WDQ A;  3T2Y A;  2I0Z A;  3GDP A;  4EQX A;  1QLB A;  2ACZ A;  2XFN A;  4UDP A;  1D7Y A;  4G9K A;  4EM3 A;  1O94 A;  2C3D A;  2XFO A;  3RP8 A;  3FNJ A;  3MZZ A;  1RYI A;  1ELI A;  3DJE A;  1ZMC A;  1BOI A;  2KL3 A;  1GSN A;  2B9Y A;  1H82 A;  2YG5 A;  3GWD A;  3P9U A;  3ADA B;  1S2Y A;  2V6O A;  3H8I A;  4GRT A;  5GRT A;  3O0H A;  1L0V A;  1X31 B;  4KPR A;  1K0L A;  2OAL A;  3VQR A;  2XVJ A;  4H4Y A;  3CTY A;  2E5V A;  3AD9 B;  1FL2 A;  3KPF A;  5EBK A;  4BUR A;  2JK6 A;  4B65 A;  2JKC A;  1BOH A;  3NT6 A;  1UAR A;  1TDN A;  1WHB A;  2GEW A;  2R0C A;  3SFD A;  3URH A;  3AEB A;  1S3B A;  2VZ2 A;  4U8N A;  1PXA A;  4X4J A;  4JGT A;  1PBB A;  3AEF A;  3R2U A;  2BC0 A;  5CKU A;  3B6D A;  1RP0 A;  2GRT A;  2RGH A;  3AYJ A;  4H4Q A;  1GMX A;  3ATQ A;  1GRF A;  2PHH A;  3IPO A;  2MRM A;  2WLX A;  3CIR A;  1BGN A;  1IUT A;  2BRY A;  2GR3 A;  2XFQ A;  3OZ2 A;  4XWR A;  5HY5 A;  2MOI A;  3CGB A;  1GRH A;  4OPC A;  1D4C A;  1JNZ A;  1GV4 A;  2WS3 A;  2APG A;  2C73 A;  4AT2 A;  1GN0 A;  5C2T A;  2WU2 A;  4YKG A;  2NVK X;  2EG4 B;  3BI4 A;  1JRZ A;  3UTH A;  2BYB A;  3DJD A;  3T2K A;  1NPX A;  2R45 A;  4G73 A;  1SEZ A;  1BGJ A;  2VVM A;  3LB8 A;  2XDO A;  3AE6 A;  4UDR A;  2WLR A;  2OLO A;  3ATR A;  2K0Z A;  2JTS A;  3C4A A;  5ER0 A;  4AOX A;  1IUS A;  2O9Z A;  1KSU A;  2YM1 A;  3VR8 A;  1RHD A;  1BZL A;  2WES A;  3HIX A;  3LJP A;  5HBP A;  4U8L A;  4EIP A;  3AE1 A;  4J57 A;  1TYP A;  1UKV G;  4A9W A;  1T3K A;  4II2 A;  3FLH A;  1GND A;  3Q9T A;  4B69 A;  3T14 A;  3NK1 X;  1LQU A;  4PAB A;  3LAD A;  5KMS A;  3I2V A;  4U8O A;  3K30 A;  3ITJ A;  2WP9 A;  4A79 A;  1TQ1 A;  3TP9 A;  1PXC A;  1VQW A;  3ALM A;  3CPI G;  4BK2 A;  4KX6 A;  1GET A;  1VG9 A;  2JBV A;  2XVH A;  3GRS A;  2GQF A;  4RSL A;  4TM0 A;  4CBQ A;  2BAC A;  4JNQ A;  1DOB A;  1XDI A;  3AE8 A;  5JCN A;  3AE3 A;  2R4E A;  2V60 A;  1Z6L A;  2QCU A;  3CNJ A;  2CUL A;  3GYJ A;  2WET A;  2BRA A;  5L46 A;  2C67 A;  4J34 A;  2CDU A;  1CHU A;  4BV6 A;  4IV9 A;  1KSS A;  3BHF A;  4II3 A;  1PBF A;  3QSM A;  2YR6 A;  1N4V A;  3HZL A;  5JCI A;  4NEV A;  4OPG A;  4YT0 A;  3DH9 A;  5HBO A;  3OLH A;  3SZW A;  1XPQ A;  3RP7 A;  4B64 A;  4EQS A;  1PJ6 A;  4GCM A;  2B76 A;  4IA6 A;  4U8M A;  3COX A;  2ARD A;  3HYW A;  1LPF A;  3S61 A;  4FX9 A;  2BCP A;  4REK A;  4U8K A;  1JU2 A;  2WU5 A;  3UP5 A;  1M64 A;  3ABV A;  5M0Z A;  2GVC A;  3SXI A;  4CNK A;  1Y56 B;  5JCK A;  5KWF A;  3EAO A;  2JB1 A;  1BF3 A;  1ORB A;  2A8X A;  3AD7 B;  2A87 A;  1TYT A;  3CNS A;  3T31 A;  1CJ2 A;  1DJN A;  2C65 A;  3FMW A;  5U1O A;  1S2Q A;  4GAV A;  3M12 A;  2FJE A;  3AEC A;  2YG4 A;  4LII A;  3EAN A;  4CCR A;  2YVG A;  4C5O A;  4DSH A;  3UOY A;  3OC4 A;  5HHF A;  3SX6 A;  1GER A;  5KOX A;  2BK3 A;  5FMH A;  1D5T A;  5BUL A;  3TG1 B;  2BA9 A;  4Z2U A;  3BI2 A;  1TDK A;  1ZOV A;  5HBL A;  3CPH G;  3DGH A;  3LZW A;  2IVE A;  4H4Z A;  4ICY A;  4A99 A;  4Z26 A;  1VG0 A;  2WPE A;  4GF7 A;  2B7R A;  3P4R A;  3QVP A;  4J2W A;  1E1K A;  4M52 A;  3K9R A;  2QA1 A;  3G5Q A;  1WV9 A;  1GAL A;  3V76 A;  1D7L A;  1FEA A;  2EG3 A;  4AP3 A;  5KRQ A;  1YS0 A;  2FBW A;  4OVI A;  3GK5 A;  1CJ4 A;  4A6N B;  3V3O A;  4WH7 A;  4B1B A;  1CC6 A;  3JSK A;  4TM1 A;  5BUK A;  2VRM A;  3DK9 A;  2GH5 A;  3NTD A;  1H83 A;  2R0P A;  1YML A;  3CNT A;  5FS6 A;  1YMK A;  3I3U A;  4E0V A;  2EG4 A;  2XFU A;  2YR5 A;  3I3L A;  3ISH A;  3M0O A;  1ZY8 A;  2Q0K A;  1E1N A;  3P1W A;  4Y4M A;  1KF6 A;  2XVI A;  3G5J A;  1YY5 A;  3G5S A;  1DP2 A;  4OPU A;  2B7S A;  1OKG A;  4XXG A;  3UKH A;  2BXR A;  4EIQ A;  2QA2 A;  3NH3 X;  1Y0P A;  1V59 A;  2PYX A;  1L9E A;  2WPC A;  3RHA A;  3AYI A;  2X3N A;  4H4S A;  4B63 A;  4U8J A;  1D4D A;  1NAA A;  3P4Q A;  4EMW A;  4JY3 A;  3CND A;  1L9D A;  1VRQ B;  4ECH A;  5M10 A;  1YMD A;  5KMQ A;  1B5Q A;  3CNP A;  1H7X A;  2ZBW A;  1E0C A;  1COY A;  2XVF A;  4YSH A;  5LAM A;  4GAP A;  1K0J A;  2XFP A;  2YLX A;  1OJD A;  3ICR A;  3FOJ A;  3NHO X;  2V3A A;  4GR1 A;  5KVI A;  1DXL A;  1DNC A;  2JAE A;  1OJ9 A;  2OA1 A;  3M13 A;  1LJ1 A;  3NN6 X;  4U2S A;  4XWZ A;  4EM4 A;  3BI5 A;  4UDQ A;  3VRD B;  3BHK A;  4YKF A;  1LTX R;  1IUU A;  2C66 A;  3QFA A;  3HWI A;  3ICT A;  1KNR A;  4ZN0 A;  4GDP A;  4G74 A;  4AT0 A;  4EMI A;  1E7P A;  4USQ A;  3VR9 A;  1GT8 A;  1ZOY A;  2BCG G;  2GQW A;  2YR4 A;  3UP4 A;  1NEK A;  3QJ4 A;  3DA1 A;  2X50 A;  3AB1 A;  1XAN A;  4Z43 A;  3SQP A;  4BK3 A;  1K4Q A;  1IUW A;  2DKH A;  2R9Z A;  3BNM A;  2WBA A;  3CPJ G;  4IVO B;  1CWT A;  4TLX A;  4D03 A;  2YWL A;  2IFV A;  1PN0 A;  1TRB A;  1PBD A;  1Y56 A;  2FJA A;  4YSY A;  2R0G A;  2YG6 A;  3IWA A;  1TDO A;  5EB5 A;  5EOW A;  4P9S A;  3UOZ A;  4BJZ A;  1LVL A;  1QXN A;  2Z5X A;  2W0H A;  1EL9 A;  3DME A;  3Q6J A;  5KVH A;  4ADW A;  5CQF A;  1KNP A;  4H4P A;  3AED A;  4AP1 A;  4DGK A;  1VEE A;  1O95 A;  1YKJ A;  3HZU A;  3IC9 A;  3GMB A;  4G6G A;  2BK5 A;  3PVC A;  4WX1 A;  3L8K A;  4NTD A;  4DSG A;  5BRT A;  4O5Q A;  2C7G A;  1TDE A;  4H2R A;  2GMH A;  1E1L A;  4X9M A;  3AXB A;  4N9X A;  1PDH A;  2AR8 A;  1FOH A;  2GV8 A;  4K7Z A;  2MOL A;  1CBO A;  3IHG A;  2YM2 A;  3AEA A;  3K7Q X;  4CY8 A;  3AE9 A;  4APN A;  2VRL A;  4Z2T A;  2JTQ A;  2C70 A;  4AOS A;  4NZH A;  2Q82 A;  2E1M A;  3AAY A;  2NPX A;  2ZZC A;  3CGD A;  4H4W A;  2H88 A;  3BNU A;  4NTC A;  1PJ7 A;  1Q9I A;  1EBD A;  3D1C A;  1Q1R A;  4U2L A;  2F5Z A;  1ZK7 A;  2BXS A;  4A6N A;  4ZCC A;  2BS2 A;  3NN0 X;  4IA5 A;  2GR1 A;  5U25 A;  4HA6 A;  1MXT A;  3AEG A;  4OPL A;  1YQ3 A;  4J36 A;  1P2H A;  3NYC A;  2Q7V A;  3GD3 A;  1KFY A;  3C4N A;  4NTE A;  2V61 A;  3FG2 P;  4B67 A;  3F4A A;  1JNR A;  3IF9 A;  3UTF A;  2GAG B;  2OAM A;  2VQB A;  2C76 A;  4GDE A;  2FJB A;  3UKK A;  1H4K X;  1GTH A;  1ONF A;  3NNE A;  1HZM A;  1ZKQ A;  2TMD A;  3KLJ A;  4CRT A;  3DJG X;  1QJD A;  3AE2 A;  1LQT A;  1CC4 A;  4H4T A;  4JDR A;  3LXD A;  3QFB A;  2BC1 A;  4DNA A;  4FDC B;  3ICS A;  4EQW A;  3ALJ A;  3UOX A;  4K8D A;  2X8H A;  1DJQ A;  3FIM B;  3I6D A;  4H2P A;  4FK1 C;  3E1T A;  3GYX A;  3UKQ A;  2JB3 A;  4LA1 A;  1EL5 A;  1NDA A;  1YM9 A;  4H2N A; 
#chains in the Genus database with same CATH homology
 5IPY A;  3P3A A;  2YG3 A;  3CMM A;  5KXJ A;  3DGZ A;  1DOE A;  2WP6 A;  4EMJ A;  3P4S A;  3HYV A;  2R4J A;  5FS8 A;  2IFD A;  1H81 A;  1QO8 A;  2C72 A;  2Y6Q A;  3NIX A;  4I59 A;  3LZX A;  1CF3 A;  2YLT A;  2YQU A;  1BKW A;  2RAB A;  3F8R A;  3UOV A;  5FS7 A;  1PJ5 A;  1D4E A;  1DOD A;  2VOU A;  2HHG A;  2XLP A;  3H4K A;  4GUV A;  4K2X A;  2OUC A;  1GRB A;  2EQ8 A;  1ZX9 A;  3B3R A;  1F6M A;  2QAE A;  4C74 A;  1CWR A;  5LV9 A;  4WCT A;  2BS4 A;  2YLR A;  4CCQ A;  4YSZ A;  3R9U A;  1IJH A;  1JEH A;  5HYM A;  4A5L A;  2AAQ A;  4U2T A;  1OJA A;  1GRA A;  3V3N A;  3AWI A;  1EL8 A;  4JNA A;  2RGJ A;  3QSE A;  1W4X A;  4B66 A;  3SYI A;  5JCL A;  3GWF A;  2XLR A;  3KPK A;  3II4 A;  1GRT A;  3TG3 A;  2IID A;  4K5S A;  1F8R A;  4OPD A;  2C75 A;  1FEB A;  3KKJ A;  2Q0L A;  3NKS A;  3IHM A;  4Z24 A;  4IVM B;  3SGL A;  3GYI A;  1URH A;  1M6I A;  3SY4 A;  5IQ1 A;  3UKA A;  4F67 A;  2EQ7 A;  2YLZ A;  4NEW A;  3DK4 A;  1N1P A;  4G6H A;  5IQ4 A;  1JRX A;  1NHQ A;  1GOS A;  4YWO A;  3T37 A;  1NHR A;  2V5Z A;  1F8S A;  1GRE A;  4Y4N A;  1RHS A;  1IUX A;  1H4M X;  1E39 A;  1L9C A;  3KVE A;  3DK8 A;  3C96 A;  1H86 A;  1PBE A;  3P4P A;  4BJY A;  2FSX A;  3QVR A;  1NHP A;  1FEC A;  1S3E A;  2YG7 A;  3SZF A;  3UCL A;  4D04 A;  2EQ6 A;  1GRG A;  4H4X A;  2CVJ A;  1GTE A;  3D1P A;  1F3P A;  1YQ4 A;  2UZZ A;  3UKP A;  4A7A A;  4C77 A;  3EF6 A;  3RNM A;  3AAX A;  3CGC A;  5J60 A;  1PXB A;  1B8S A;  2GMJ A;  5KMP A;  4J31 A;  5EB4 A;  3WE0 A;  3H8L A;  3SZ0 A;  1AOG A;  2BS3 A;  2XCG A;  2XLT A;  2Z5Y A;  2E4G A;  1PBC A;  2BK4 A;  3AD8 B;  3PS9 A;  1NG4 A;  4YTP A;  2TPR A;  3NG7 X;  2BAB A;  2GR0 A;  3NRN A;  4USR A;  3NK0 X;  1FCD A;  4J33 A;  4Z44 A;  5TR3 A;  5LAO A;  1NEN A;  1BWC A;  3IWH A;  2X99 A;  3SM8 A;  3T2Z A;  4HB9 A;  5HBQ A;  1P2E A;  3NGC X;  4FK1 A;  3FPZ A;  3NHV A;  1NG3 A;  5DBJ A;  3F8P A;  3F8D A;  3VRB A;  1GPE A;  2YVF A;  2GF3 A;  2A89 A;  4TM3 A;  2VVL A;  3CGE A;  3ZDN A;  1GEU A;  2J6P A;  3KD9 A;  4B68 A;  1ZMD A;  1H84 A;  2RGO A;  4Y4L A;  3PO7 A;  1CC2 A;  1YQZ A;  3D8X A;  2GWF A;  3NK2 X;  1VDC A;  4H4V A;  4MJW A;  3QSS A;  1MOK A;  1NHS A;  2XLS A;  1PHH A;  4RG4 A;  4C3Y A;  4U8P A;  1Q1W A;  3L1R A;  3NLC A;  2YAU A;  1K0I A;  2ZZB A;  5HXI A;  4NNJ A;  1CL0 A;  2EQ9 A;  4RG3 A;  4OCG A;  2YLS A;  4UP3 A;  3G5R A;  5BVA A;  4CY6 A;  2VQ7 A;  1H7W A;  3KA7 A;  3O3W A;  4K22 A;  5KMR A;  4H50 A;  2X8C A;  1GXF A;  4OPT A;  2JB2 A;  1XHC A;  2B9W A;  2WQY A;  3VRA A;  2WOI A;  4JY2 A;  4JQ9 A;  4C3X A;  4H4U A;  1CJC A;  2WEU A;  2DCQ A;  2C3C A;  4Z25 A;  1B4V A;  3EPT A;  3S5W A;  3SFE A;  1OJT A;  2HQM A;  5GSN A;  3SZC A;  3CN8 A;  2WOW A;  3HYX A;  2H89 A;  4YSX A;  1IUV A;  2WDR A;  3RED A;  1O5W A;  2DKI A;  2GAH B;  2ZZ0 A;  4O5U A;  4Z2R A;  3AE4 A;  1RSG A;  2WOV A;  1HYU A;  1KDG A;  2Y6R A;  1QB0 A;  2X8G A;  4EQR A;  4YXD A;  2IVD A;  4TLZ A;  1JRY A;  4U8I A;  3LOV A;  3ZYX A;  3DJJ A;  3AYL A;  4OPI A;  2AQJ A;  5KOW A;  2VSW A;  1CJ3 A;  3UTE A;  1C25 A;  2WDV A;  2CFY A;  1EL7 A;  4JN9 A;  3UTG A;  1E6E A;  4A65 A;  3NTA A;  2ORA A;  2YVJ A;  2GB0 A;  3NYF A;  2WPF A;  3T0K A;  3FBS A;  4BK1 A;  4YTN A;  2R46 A;  4WH9 A;  3AE7 A;  2C4C A;  2XYO A;  3AEE A;  3GMC A;  3RP6 A;  1H6V A;  1ZDL A;  3UKF A;  1JOA A;  1REO A;  4H2Q A;  2UZQ A;  4ZCD A;  2XLU A;  2J3N A;  1CWS A;  1E1M A;  2WP5 A;  3KU9 A;  2GR2 A;  1B37 A;  3GSI A;  2A2K A;  5FS9 A;  2OLN A;  4CNJ A;  1GES A;  3K7M X;  4TM4 A;  1F8W A;  1ZP0 A;  2Q6U A;  3IPP A;  3K7T A;  4H4R A;  3GD4 A;  4LU6 A;  4YTM A;  3GRT A;  1DOC A;  1PS9 A;  2YLW A;  4NWZ A;  5KNL A;  3GDN A;  5JCM A;  5J7X A;  4H7U A;  5U63 A;  1LV0 A;  2JTR A;  2WHD A;  2XVE A;  3UTN X;  1YT8 A;  1OJC A;  1TDF A;  1MO9 A;  2VVL G;  2C64 A;  3AE5 A;  4X9N A;  3UKL A;  3NYE A;  1N4W A;  5C3J A;  3ILM A;  5HPA A;  2V3B A;  1N4U A;  4PAA A;  4I58 A;  3OP3 A;  2B9X A;  3FS5 A;  2FJD A;  3ALL A;  4J56 A;  4K5R A;  2WDQ A;  3T2Y A;  2I0Z A;  3GDP A;  4EQX A;  1QLB A;  2ACZ A;  2XFN A;  4UDP A;  1D7Y A;  4G9K A;  4EM3 A;  1O94 A;  2C3D A;  2XFO A;  3RP8 A;  3FNJ A;  3MZZ A;  1RYI A;  1ELI A;  3DJE A;  1ZMC A;  1BOI A;  2KL3 A;  1GSN A;  2B9Y A;  1H82 A;  2YG5 A;  3GWD A;  3P9U A;  3ADA B;  1S2Y A;  2V6O A;  3H8I A;  4GRT A;  5GRT A;  3O0H A;  1L0V A;  1X31 B;  4KPR A;  1K0L A;  2OAL A;  3VQR A;  2XVJ A;  4H4Y A;  3CTY A;  2E5V A;  3AD9 B;  1FL2 A;  3KPF A;  5EBK A;  4BUR A;  2JK6 A;  4B65 A;  2JKC A;  1BOH A;  3NT6 A;  1UAR A;  1TDN A;  1WHB A;  2GEW A;  2R0C A;  3SFD A;  3URH A;  3AEB A;  1S3B A;  2VZ2 A;  4U8N A;  1PXA A;  4X4J A;  4JGT A;  1PBB A;  3AEF A;  3R2U A;  2BC0 A;  5CKU A;  3B6D A;  1RP0 A;  2GRT A;  2RGH A;  3AYJ A;  4H4Q A;  1GMX A;  3ATQ A;  1GRF A;  2PHH A;  3IPO A;  2MRM A;  2WLX A;  3CIR A;  1BGN A;  1IUT A;  2BRY A;  2GR3 A;  2XFQ A;  3OZ2 A;  4XWR A;  5HY5 A;  2MOI A;  3CGB A;  1GRH A;  4OPC A;  1D4C A;  1JNZ A;  1GV4 A;  2WS3 A;  2APG A;  2C73 A;  4AT2 A;  1GN0 A;  5C2T A;  2WU2 A;  4YKG A;  2NVK X;  2EG4 B;  3BI4 A;  1JRZ A;  3UTH A;  2BYB A;  3DJD A;  3T2K A;  1NPX A;  2R45 A;  4G73 A;  1SEZ A;  1BGJ A;  2VVM A;  3LB8 A;  2XDO A;  3AE6 A;  4UDR A;  2WLR A;  2OLO A;  3ATR A;  2K0Z A;  2JTS A;  3C4A A;  5ER0 A;  4AOX A;  1IUS A;  2O9Z A;  1KSU A;  2YM1 A;  3VR8 A;  1RHD A;  1BZL A;  2WES A;  3HIX A;  3LJP A;  5HBP A;  4U8L A;  4EIP A;  3AE1 A;  4J57 A;  1TYP A;  1UKV G;  4A9W A;  1T3K A;  4II2 A;  3FLH A;  1GND A;  3Q9T A;  4B69 A;  3T14 A;  3NK1 X;  1LQU A;  4PAB A;  3LAD A;  5KMS A;  3I2V A;  4U8O A;  3K30 A;  3ITJ A;  2WP9 A;  4A79 A;  1TQ1 A;  3TP9 A;  1PXC A;  1VQW A;  3ALM A;  3CPI G;  4BK2 A;  4KX6 A;  1GET A;  1VG9 A;  2JBV A;  2XVH A;  3GRS A;  2GQF A;  4RSL A;  4TM0 A;  4CBQ A;  2BAC A;  4JNQ A;  1DOB A;  1XDI A;  3AE8 A;  5JCN A;  3AE3 A;  2R4E A;  2V60 A;  1Z6L A;  2QCU A;  3CNJ A;  2CUL A;  3GYJ A;  2WET A;  2BRA A;  5L46 A;  2C67 A;  4J34 A;  2CDU A;  1CHU A;  4BV6 A;  4IV9 A;  1KSS A;  3BHF A;  4II3 A;  1PBF A;  3QSM A;  2YR6 A;  1N4V A;  3HZL A;  5JCI A;  4NEV A;  4OPG A;  4YT0 A;  3DH9 A;  5HBO A;  3OLH A;  3SZW A;  1XPQ A;  3RP7 A;  4B64 A;  4EQS A;  1PJ6 A;  4GCM A;  2B76 A;  4IA6 A;  4U8M A;  3COX A;  2ARD A;  3HYW A;  1LPF A;  3S61 A;  4FX9 A;  2BCP A;  4REK A;  4U8K A;  1JU2 A;  2WU5 A;  3UP5 A;  1M64 A;  3ABV A;  5M0Z A;  2GVC A;  3SXI A;  4CNK A;  1Y56 B;  5JCK A;  5KWF A;  3EAO A;  2JB1 A;  1BF3 A;  1ORB A;  2A8X A;  3AD7 B;  2A87 A;  1TYT A;  3CNS A;  3T31 A;  1CJ2 A;  1DJN A;  2C65 A;  3FMW A;  5U1O A;  1S2Q A;  4GAV A;  3M12 A;  2FJE A;  3AEC A;  2YG4 A;  4LII A;  3EAN A;  4CCR A;  2YVG A;  4C5O A;  4DSH A;  3UOY A;  3OC4 A;  5HHF A;  3SX6 A;  1GER A;  5KOX A;  2BK3 A;  5FMH A;  1D5T A;  5BUL A;  3TG1 B;  2BA9 A;  4Z2U A;  3BI2 A;  1TDK A;  1ZOV A;  5HBL A;  3CPH G;  3DGH A;  3LZW A;  2IVE A;  4H4Z A;  4ICY A;  4A99 A;  4Z26 A;  1VG0 A;  2WPE A;  4GF7 A;  2B7R A;  3P4R A;  3QVP A;  4J2W A;  1E1K A;  4M52 A;  3K9R A;  2QA1 A;  3G5Q A;  1WV9 A;  1GAL A;  3V76 A;  1D7L A;  1FEA A;  2EG3 A;  4AP3 A;  5KRQ A;  1YS0 A;  2FBW A;  4OVI A;  3GK5 A;  1CJ4 A;  4A6N B;  3V3O A;  4WH7 A;  4B1B A;  1CC6 A;  3JSK A;  4TM1 A;  5BUK A;  2VRM A;  3DK9 A;  2GH5 A;  3NTD A;  1H83 A;  2R0P A;  1YML A;  3CNT A;  5FS6 A;  1YMK A;  3I3U A;  4E0V A;  2EG4 A;  2XFU A;  2YR5 A;  3I3L A;  3ISH A;  3M0O A;  1ZY8 A;  2Q0K A;  1E1N A;  3P1W A;  4Y4M A;  1KF6 A;  2XVI A;  3G5J A;  1YY5 A;  3G5S A;  1DP2 A;  4OPU A;  2B7S A;  1OKG A;  4XXG A;  3UKH A;  2BXR A;  4EIQ A;  2QA2 A;  3NH3 X;  1Y0P A;  1V59 A;  2PYX A;  1L9E A;  2WPC A;  3RHA A;  3AYI A;  2X3N A;  4H4S A;  4B63 A;  4U8J A;  1D4D A;  1NAA A;  3P4Q A;  4EMW A;  4JY3 A;  3CND A;  1L9D A;  1VRQ B;  4ECH A;  5M10 A;  1YMD A;  5KMQ A;  1B5Q A;  3CNP A;  1H7X A;  2ZBW A;  1E0C A;  1COY A;  2XVF A;  4YSH A;  5LAM A;  4GAP A;  1K0J A;  2XFP A;  2YLX A;  1OJD A;  3ICR A;  3FOJ A;  3NHO X;  2V3A A;  4GR1 A;  5KVI A;  1DXL A;  1DNC A;  2JAE A;  1OJ9 A;  2OA1 A;  3M13 A;  1LJ1 A;  3NN6 X;  4U2S A;  4XWZ A;  4EM4 A;  3BI5 A;  4UDQ A;  3VRD B;  3BHK A;  4YKF A;  1LTX R;  1IUU A;  2C66 A;  3QFA A;  3HWI A;  3ICT A;  1KNR A;  4ZN0 A;  4GDP A;  4G74 A;  4AT0 A;  4EMI A;  1E7P A;  4USQ A;  3VR9 A;  1GT8 A;  1ZOY A;  2BCG G;  2GQW A;  2YR4 A;  3UP4 A;  1NEK A;  3QJ4 A;  3DA1 A;  2X50 A;  3AB1 A;  1XAN A;  4Z43 A;  3SQP A;  4BK3 A;  1K4Q A;  1IUW A;  2DKH A;  2R9Z A;  3BNM A;  2WBA A;  3CPJ G;  4IVO B;  1CWT A;  4TLX A;  4D03 A;  2YWL A;  2IFV A;  1PN0 A;  1TRB A;  1PBD A;  1Y56 A;  2FJA A;  4YSY A;  2R0G A;  2YG6 A;  3IWA A;  1TDO A;  5EB5 A;  5EOW A;  4P9S A;  3UOZ A;  4BJZ A;  1LVL A;  1QXN A;  2Z5X A;  2W0H A;  1EL9 A;  3DME A;  3Q6J A;  5KVH A;  4ADW A;  5CQF A;  1KNP A;  4H4P A;  3AED A;  4AP1 A;  4DGK A;  1VEE A;  1O95 A;  1YKJ A;  3HZU A;  3IC9 A;  3GMB A;  4G6G A;  2BK5 A;  3PVC A;  4WX1 A;  3L8K A;  4NTD A;  4DSG A;  5BRT A;  4O5Q A;  2C7G A;  1TDE A;  4H2R A;  2GMH A;  1E1L A;  4X9M A;  3AXB A;  4N9X A;  1PDH A;  2AR8 A;  1FOH A;  2GV8 A;  4K7Z A;  2MOL A;  1CBO A;  3IHG A;  2YM2 A;  3AEA A;  3K7Q X;  4CY8 A;  3AE9 A;  4APN A;  2VRL A;  4Z2T A;  2JTQ A;  2C70 A;  4AOS A;  4NZH A;  2E1M A;  2NPX A;  3AAY A;  2ZZC A;  3CGD A;  4H4W A;  2H88 A;  3BNU A;  4NTC A;  1PJ7 A;  1Q9I A;  1EBD A;  3D1C A;  1Q1R A;  4U2L A;  2F5Z A;  1ZK7 A;  2BXS A;  4A6N A;  4ZCC A;  2BS2 A;  3NN0 X;  4IA5 A;  2GR1 A;  5U25 A;  4HA6 A;  1MXT A;  3AEG A;  4OPL A;  1YQ3 A;  4J36 A;  1P2H A;  3NYC A;  2Q7V A;  3GD3 A;  1KFY A;  3C4N A;  4NTE A;  2V61 A;  3FG2 P;  4B67 A;  3F4A A;  1JNR A;  3IF9 A;  3UTF A;  2GAG B;  2OAM A;  2VQB A;  2C76 A;  4GDE A;  2FJB A;  3UKK A;  1H4K X;  1GTH A;  1ONF A;  3NNE A;  1HZM A;  1ZKQ A;  2TMD A;  3KLJ A;  4CRT A;  3DJG X;  1QJD A;  3AE2 A;  1LQT A;  1CC4 A;  4H4T A;  4JDR A;  3LXD A;  3QFB A;  2BC1 A;  4DNA A;  4FDC B;  3ICS A;  4EQW A;  3ALJ A;  3UOX A;  4K8D A;  2X8H A;  1DJQ A;  3FIM B;  3I6D A;  4H2P A;  4FK1 C;  3E1T A;  3GYX A;  3UKQ A;  2JB3 A;  4LA1 A;  1EL5 A;  1NDA A;  1YM9 A;  4H2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...