3NTAA

Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
565
structure length
565
Chain Sequence
MKKILIIGGVAGGASAAARARRLSETAEIIMFERGEYVSFANCGLPYHISGEIAQRSALVLQTPESFKARFNVEVRVKHEVVAIDRAAKLVTVRRLLDGSEYQESYDTLLLSPGAAPIVPPIPGVDNPLTHSLRNIPDMDRILQTIQMNNVEHATVVGGGFIGLEMMESLHHLGIKTTLLELADQVMTPVDREMAGFAHQAIRDQGVDLRLGTALSEVSYQVQTHVASDAAGEDTAHQHIKGHLSLTLSNGELLETDLLIMAIGVRPETQLARDAGLAIGELGGIKVNAMMQTSDPAIYAVGDAVEEQDFVTGQACLVPLAGPANRQGRMAADNMFGREERYQGTQGTAICKVFDLAVGATGKNEKQLKQAGIAFEKVYVHTASHASYYPGAEVVSFKLLFDPVKGTIFGAQAVGKDGIDKRIDVMAVAQRAGMTVEQLQHLELSYAPPYGSAKDVINQAAFVASNIIKGDATPIHFDQIDNLSEDQLLLDVRNPGELQNGGLEGAVNIPVDELRDRMHELPKDKEIIIFCQVGLRGNVAYRQLVNNGYRARNLIGGYRTYKFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords FAD-dependent pyridine nucleotide-disulphide oxidoreductase
publication title Characterization of an NADH-Dependent Persulfide Reductase from Shewanella loihica PV-4: Implications for the Mechanism of Sulfur Respiration via FAD-Dependent Enzymes .
pubmed doi rcsb
source organism Shewanella loihica
total genus 162
structure length 565
sequence length 565
chains with identical sequence B
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2010-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3ntaA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ntaA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ntaA01
3UKFA 1GT8A 1JU2A 3UTHA 3FBSA 2IFVA 2BC1A 3FLHA 3UTEA 3G5QA 3AB1A 4AP3A 3NK1X 4EQXA 3NH3X 3OC4A 3G5JA 3DJJA 1HZMA 2JTRA 1ELIA 4UDQA 3V3OA 2UZZA 3ADAB 1URHA 1ORBA 4UDRA 4Z44A 4A65A 2YR6A 2WS3A 3AECA 4PAAA 2GV8A 2JBVA 4H2NA 4WCTA 2APGA 2R45A 3G5RA 5M0ZA 5BRTA 5L46A 3E1TA 5HBOA 1W4XA 3BNMA 1CHUA 1LJ1A 2XFNA 2YVGA 5GSNA 1KF6A 1S3BA 3C4NA 5EOWA 3BI2A 2DKHA 2C73A 5U1OA 2JKCA 3AE5A 4C3XA 4CRTA 2MRMA 1T3KA 1BKWA 4APNA 3NN0X 3UP5A 1QXNA 3KLJA 1XDIA 2GMJA 3I6DA 3IF9A 2OALA 3REDA 3AE3A 1L0VA 3QSSA 3GMCA 2VRMA 1RSGA 2JAEA 4LU6A 4EIPA 2QCUA 4I58A 4U8OA 2XLTA 3P3AA 3SQPA 2XYOA 4BJZA 1S2QA 1KNRA 1NHQA 4U8LA 3S61A 1H7XA 1E1LA 2IVEA 2V3AA 1N4VA 3AEDA 3AYLA 2BCPA 4GDEA 1DJNA 5C2TA 4H4ZA 4J36A 2XLRA 2YVJA 1SEZA 3C96A 2C64A 1NHPA 4HA6A 5JCKA 2EG4B 5HPAA 1CC6A 2HQMA 3NTAA 2Z5XA 1GOSA 3DGHA 3KVEA 3NK0X 1GMXA 3ALJA 4NZHA 3CPIG 4U8KA 3NRNA 3GWFA 4K5RA 3JSKA 1OKGA 4NTCA 2V6OA 3UKPA 1GN0A 2YG3A 3PO7A 4C5OA 2OAMA 1O94A 3M12A 1PHHA 1F3PA 2YG5A 2H88A 2X99A 4U2SA 1H84A 2YG4A 1GRTA 3FMWA 1ZKQA 1V59A 2K0ZA 2Y6RA 1EL9A 3I3LA 3UTGA 1M6IA 1QB0A 2X8GA 3IC9A 1OJDA 4DSGA 2GQWA 2WOWA 3F4AA 4OPIA 1BOIA 1CWTA 1YQ3A 3GD3A 2WP5A 4NTEA 3DJEA 4FK1A 2BABA 3CNDA 2H89A 2BK3A 4A99A 3NIXA 1CJ3A 1YS0A 3DGZA 1VDCA 4K8DA 3M0OA 4Z25A 3UKKA 4KPRA 1GREA 2JTSA 3QJ4A 2C3CA 2BS4A 5KOWA 2MOLA 2HHGA 3T37A 1VEEA 4WX1A 4AOXA 4JY2A 2ACZA 1M64A 1K4QA 2EQ6A 4K7ZA 4FX9A 1GESA 2YG7A 4TM3A 3IPPA 2XCGA 3R9UA 4IA5A 3UKLA 1S3EA 4U8PA 3PVCA 1CJCA 1B5QA 1H82A 1H6VA 3UOXA 3CPJG 3VQRA 1F8RA 3P9UA 1Q1RA 2FBWA 2NPXA 1CF3A 1E1KA 1TDNA 3DK4A 2GR2A 3AEGA 4PABA 1QJDA 3ICTA 1IJHA 2XLPA 4XWRA 3CNSA 2GMHA 2XDOA 3NG7X 1FOHA 3BHFA 1TDEA 4MJWA 1N4WA 1GXFA 3LOVA 2C72A 4XWZA 2B76A 2KL3A 3URHA 4H4QA 2WPEA 2ZZ0A 2F5ZA 3C4AA 2X3NA 1XHCA 1VG0A 3OZ2A 4CNKA 2FJBA 3QFBA 4OPDA 1D7LA 5C3JA 1LTXR 1PXAA 1TYPA 1P2HA 1DOEA 2BXRA 2CVJA 2QA2A 3BNUA 1GNDA 3AE4A 3AEFA 2R4EA 1PDHA 4NTDA 4Y4NA 1H83A 1TRBA 3K30A 1DNCA 3NHVA 2WDQA 1REOA 3QVRA 4H4YA 2BA9A 4OCGA 3CNTA 3NKSA 4WH7A 1DODA 1QO8A 2YM1A 3KA7A 1ZY8A 4OPUA 2BS3A 5FS9A 2XVFA 1NPXA 2VSWA 3FIMB 5J7XA 1MO9A 4B67A 2ZBWA 1FCDA 4O5UA 5HBPA 2EQ7A 3H8IA 2GWFA 2YR5A 4OPLA 1OJAA 1X31B 2VOUA 1JRYA 1KDGA 1DXLA 3FNJA 3ALMA 1OJCA 3LB8A 4H50A 1D7YA 2GR1A 4NEWA 4Z24A 2X8HA 5TR3A 3GYIA 1NENA 4B66A 3LJPA 1DOCA 1N4UA 4JN9A 3VRAA 2VQBA 2VVMA 4YT0A 2XVHA 1MOKA 4IV9A 4K2XA 2C3DA 3AE2A 2XFOA 2B7SA 2C75A 3FPZA 4J33A 1CWSA 1YMLA 3ATRA 4EMWA 2PHHA 1KSSA 1L9CA 2C70A 4C77A 2YLRA 3IHGA 4TM1A 2WBAA 1KFYA 4B63A 1DOBA 4FK1C 1K0IA 4HB9A 2A2KA 4DNAA 4YTPA 4BJYA 4EM4A 2XVIA 4IA6A 3IHMA 5KXJA 4KX6A 1DP2A 2V5ZA 2A87A 1NEKA 1NAAA 2GAGB 3D8XA 1Y0PA 4ADWA 4JY3A 4B1BA 4Z2TA 4U2TA 1CL0A 3V3NA 3L8KA 3NYEA 4BV6A 2YLSA 2YQUA 3P4PA 4AP1A 2GH5A 2FSXA 2GF3A 1TQ1A 1F6MA 3UKQA 2WLRA 1YY5A 1JEHA 3KKJA 4JQ9A 3AAXA 1P2EA 2BK5A 5JCIA 1VRQB 4CCRA 5JCMA 3ABVA 3CPHG 2TMDA 3GRTA 3V76A 4EQRA 1ZP0A 3NK2X 4YKFA 1D4DA 1JNRA 2VRLA 3II4A 4YSXA 5U25A 4K5SA 2GAHB 1EL7A 1D4CA 1IUXA 2AAQA 2WDVA 2VVLG 3Q9TA 4IVMB 4TLXA 4DSHA 4U8IA 3GK5A 4BK2A 1LQUA 3CGCA 4YSHA 2B9WA 1JRXA 2OA1A 2GVCA 2V3BA 2RGOA 2WP6A 4JNAA 4Z26A 4N9XA 1WHBA 2OLOA 1MXTA 2I0ZA 2XVEA 3IPOA 3P4RA 2ARDA 2WQYA 4H2QA 1EBDA 1KSUA 2C65A 2WPCA 3M13A 4CY6A 4BK1A 2B7RA 3ICRA 2QAEA 4D03A 1JNZA 3F8PA 5IQ4A 2C76A 3VRDB 3CNPA 4B68A 1F8SA 4ECHA 1CBOA 2RABA 4P9SA 1B8SA 4C3YA 3ICSA 2B9XA 2BC0A 3AAYA 1F8WA 1FECA 3I2VA 3AEBA 3NT6A 4RG3A 1D5TA 1O5WA 2R4JA 3EF6A 4YTMA 2BK4A 3HIXA 2YLTA 2C66A 1GRHA 3HWIA 3LADA 4ZCDA 2Y6QA 4A6NB 5JCNA 1PJ7A 2EG3A 2WESA 3GSIA 1XPQA 3RNMA 3EPTA 3VR8A 2EG4A 1GALA 1GTHA 2R46A 3AD9B 3AE8A 3P4SA 4H4UA 3OP3A 2ZZBA 3NHOX 5HYMA 3AYJA 3L1RA 1H86A 2TPRA 4EIQA 1FEBA 3AE7A 4YSZA 2XVJA 1E7PA 3AE6A 2C67A 2FJEA 3NYCA 1Z6LA 4EQWA 5LAOA 3PS9A 1IUVA 1NHSA 1ZK7A 4LA1A 3BI5A 2BYBA 1CC4A 1GRFA 4GR1A 4B69A 4B64A 3CN8A 3TG1B 4C74A 4CNJA 3OLHA 1JOAA 1ONFA 3S5WA 1RYIA 3H8LA 1PN0A 2A8XA 3IWAA 5JCLA 4GDPA 1YQZA 4REKA 3UOVA 2C7GA 3CGBA 2GEWA 3GD4A 2W0HA 3AXBA 1IUSA 3CNJA 3NNEA 3B6DA 5KRQA 4ZN0A 4J56A 3SGLA 2WU5A 1ZX9A 2OLNA 3R2UA 1PXCA 3O3WA 4F67A 2XLSA 4YKGA 1YT8A 1DJQA 1ZDLA 2WDRA 3GDNA 2X50A 5KOXA 2Q6UA 2O9ZA 3UTFA 4H7UA 3LXDA 1GV4A 3GMBA 4H4WA 4ICYA 4NEVA 4E0VA 1L9EA 1TDKA 2R0GA 3GDPA 3AEEA 3SM8A 3CIRA 2WPFA 1H7WA 4J57A 1B4VA 2VQ7A 1PBFA 1PXBA 2RGJA 3AD8B 1VQWA 5HXIA 3UP4A 2GR0A 1GERA 3RP6A 2Q0KA 4GCMA 1LQTA 3AWIA 3UOYA 4EM3A 5HY5A 4ZCCA 1FEAA 1CJ4A 2JB1A 5BULA 1GTEA 1NHRA 1RP0A 3G5SA 5U63A 5BUKA 3GWDA 1KNPA 3HZUA 1E6EA 1PBCA 3QSMA 4GUVA 4K22A 1H4MX 1TDOA 1PJ5A 3FG2P 5EBKA 5ER0A 2JB2A 4J31A 2YG6A 3H4KA 4H2PA 2Z5YA 2WLXA 2XFUA 1CJ2A 2PYXA 1BZLA 4H4SA 4AOSA 2YVFA 3KD9A 1K0LA 3CGEA 2BCGG 3CGDA 4Y4MA 5J60A 5LAMA 1IUUA 1Y56A 3BI4A 1ZOYA 4U8NA 3UTNX 2YWLA 2YLWA 1PBEA 2AQJA 5HHFA 5FS7A 3UKAA 4A5LA 4Z43A 2JTQA 1B37A 1ZOVA 4X9NA 2GR3A 1YMDA 4TM0A 3ISHA 2YLZA 2EQ8A 1PBBA 4O5QA 1L9DA 4B65A 1CC2A 2JB3A 3COXA 4H4TA 4BK3A 3F8DA 1PBDA 3D1PA 2WOVA 1EL8A 2VVLA 3NYFA 3QFAA 4H4PA 3NN6X 3RHAA 4YTNA 4OPTA 1GETA 2QA1A 4H2RA 1PS9A 4I59A 2AR8A 3BHKA 2NVKX 2A89A 2FJDA 1EL5A 1YQ4A 2BS2A 5FMHA 1HYUA 3CTYA 5KVHA 1OJ9A 4JNQA 1JRZA 4Y4LA 3I3UA 1ZMCA 3KPFA 4A9WA 4TM4A 1YMKA 2OUCA 2R0CA 4U8JA 3K9RA 3TG3A 4J2WA 4TLZA 1XANA 3MZZA 4JDRA 3WE0A 3GYJA 4EQSA 5M10A 4JGTA 2WU2A 3VR9A 3DJDA 1E39A 2E1MA 2XLUA 3EAOA 3QVPA 4RG4A 4YXDA 2GQFA 3SFDA 4CY8A 3F8RA 1NDAA 4YWOA 3AYIA 2CFYA 3EANA 4RSLA 2WEUA 5HBQA 3AEAA 3NLCA 1YM9A 3VRBA 4AT2A 2YLXA 3B3RA 1GRAA 5BVAA 2IFDA 4CCQA 5EB4A 1GSNA 4OPGA 1E1NA 3RP8A 2YAUA 5FS8A 5IQ1A 3ZDNA 2DKIA 4DGKA 4IVOB 3UKHA 1C25A 4XXGA 1LV0A 4GF7A 2XFPA 4D04A 4UP3A 1RHSA 3D1CA 1D4EA 4J34A 3UCLA 1LPFA 5IPYA 3ATQA 3SFEA 4OPCA 1S2YA 2DCQA 1GRGA 5HBLA 1YKJA 3QSEA 5KWFA 2ORAA 1E1MA 3DJGX 5FS6A 3K7MX 3AE9A 3ITJA 2WETA 1VG9A 2JK6A 3O0HA 4CBQA 4BURA 2E4GA 2R9ZA 1H4KX 1IUTA 1COYA 2GB0A 3KU9A 2FJAA 1E0CA 5LV9A 2ZZCA 3P1WA 3P4QA 4H4VA 4UDPA 1AOGA 1UARA 3DK9A 4U8MA 2RGHA 1NG4A 3ALLA 2VZ2A 3UOZA 4A7AA 2CULA 2YM2A 4A79A 2XFQA 2WHDA 3DK8A 3K7TA 4X9MA 1Q9IA 4M52A 1BWCA 1RHDA 1LVLA 2Q0LA 1FL2A 2EQ9A 1GPEA 3LZXA 5CQFA 5EB5A 1IUWA 2UZQA 1BOHA 1K0JA 1N1PA 1NG3A 1TDFA 2V60A 2YR4A 2J6PA 2R0PA 4U2LA 2V61A 3FOJA 3NTDA 1QLBA 4OVIA 4USQA 5DBJA 5GRTA 4AT0A 2MOIA 1BGJA 2CDUA 3K7QX 4H4RA 3RP7A 1GEUA 1H81A 1OJTA 1Q1WA 2Q7VA 2B9YA 3AD7B 3DMEA 3Q6JA 4LIIA 5KVIA 3NGCX 4A6NA 3DH9A 1UKVG 2E5VA 3AE1A 1WV9A 2WOIA 1O95A 4X4JA 2GRTA 1PJ6A 3FS5A 2BACA 2J3NA 3IWHA 3GRSA 1BF3A 3HZLA 4USRA 4WH9A 2BXSA 4EMJA 2X8CA 1CWRA 1BGNA 4FDCB 3ZYXA 4Z2UA 1GRBA 1TYTA 2WP9A 4EMIA 1Y56B 3DA1A 3LZWA 4GRTA 4YSYA 4Z2RA 1ZMDA 4H4XA 2IVDA 3ILMA 2IIDA 5CKUA 3TP9A
chains in the Genus database with same CATH superfamily
3UKFA 1GT8A 1JU2A 3UTHA 3FBSA 2IFVA 2BC1A 3FLHA 4G73A 3UTEA 3G5QA 3AB1A 4AP3A 3NK1X 4EQXA 3NH3X 3OC4A 3G5JA 3DJJA 1HZMA 2JTRA 1ELIA 4UDQA 3V3OA 2UZZA 3ADAB 1URHA 1ORBA 4UDRA 4Z44A 4A65A 2YR6A 2WS3A 3AECA 4PAAA 2GV8A 2JBVA 4H2NA 4WCTA 2APGA 2R45A 3G5RA 5M0ZA 5BRTA 5L46A 3E1TA 5HBOA 1W4XA 3BNMA 1CHUA 1LJ1A 2XFNA 2YVGA 5GSNA 1KF6A 1S3BA 3C4NA 5EOWA 3BI2A 3SX6A 2DKHA 2C73A 5U1OA 2JKCA 3AE5A 4C3XA 4CRTA 2MRMA 1T3KA 1BKWA 4APNA 3NN0X 3UP5A 1QXNA 3KLJA 1XDIA 2GMJA 3I6DA 3IF9A 2OALA 3REDA 3AE3A 1L0VA 3QSSA 3GMCA 2VRMA 1RSGA 2JAEA 4LU6A 2C4CA 2QCUA 4EIPA 4I58A 4U8OA 2XLTA 3P3AA 3SQPA 2XYOA 4BJZA 1S2QA 1KNRA 1NHQA 4U8LA 3S61A 1H7XA 1E1LA 2IVEA 2V3AA 1N4VA 3AEDA 3AYLA 2BCPA 4GDEA 1DJNA 5C2TA 4H4ZA 4J36A 2XLRA 2YVJA 1SEZA 3C96A 2C64A 1NHPA 4HA6A 5JCKA 2EG4B 5HPAA 1CC6A 2HQMA 3NTAA 2Z5XA 1GOSA 3DGHA 3KVEA 3NK0X 1GMXA 3ALJA 4NZHA 3CPIG 4U8KA 3NRNA 3GWFA 4K5RA 3JSKA 1OKGA 4NTCA 2V6OA 3UKPA 1GN0A 2YG3A 3PO7A 4C5OA 2OAMA 1O94A 3M12A 1PHHA 1F3PA 2YG5A 2H88A 2X99A 4U2SA 1H84A 2YG4A 1GRTA 3FMWA 1ZKQA 1V59A 2K0ZA 2Y6RA 1EL9A 3I3LA 3UTGA 1M6IA 3T31A 1QB0A 2X8GA 3IC9A 1OJDA 4DSGA 2GQWA 2WOWA 3F4AA 4OPIA 1BOIA 1CWTA 1YQ3A 3GD3A 2WP5A 4NTEA 3SZWA 3DJEA 4FK1A 2BABA 3CNDA 2H89A 2BK3A 4A99A 3NIXA 1CJ3A 1YS0A 3DGZA 1VDCA 4K8DA 3M0OA 4Z25A 3UKKA 4KPRA 1GREA 2JTSA 3QJ4A 2C3CA 2BS4A 5KOWA 2MOLA 2HHGA 3T37A 1VEEA 4WX1A 3SZ0A 4JY2A 4AOXA 2ACZA 1M64A 1K4QA 2EQ6A 4K7ZA 4FX9A 1GESA 2YG7A 4TM3A 3IPPA 2XCGA 3R9UA 4IA5A 3UKLA 1S3EA 4U8PA 3PVCA 1CJCA 1B5QA 1H82A 1H6VA 4GAPA 3CPJG 3UOXA 3VQRA 1F8RA 3P9UA 1Q1RA 2FBWA 2NPXA 1CF3A 1E1KA 1TDNA 3DK4A 2GR2A 3AEGA 4PABA 1QJDA 3ICTA 1IJHA 2XLPA 4XWRA 3CNSA 2GMHA 2XDOA 3NG7X 1FOHA 3BHFA 1TDEA 4MJWA 1N4WA 1GXFA 3LOVA 2C72A 4XWZA 2B76A 2KL3A 4II2A 3SY4A 4H4QA 3URHA 2WPEA 2ZZ0A 2F5ZA 3C4AA 2X3NA 1XHCA 1VG0A 3OZ2A 4CNKA 2FJBA 3QFBA 4OPDA 1D7LA 5C3JA 1LTXR 1PXAA 1TYPA 1P2HA 1DOEA 2BXRA 2CVJA 2QA2A 3BNUA 1GNDA 3AE4A 3AEFA 2R4EA 1PDHA 4NTDA 4Y4NA 1H83A 1TRBA 3K30A 1DNCA 3NHVA 2WDQA 1REOA 3QVRA 4H4YA 2BA9A 4OCGA 3CNTA 3NKSA 4WH7A 1DODA 1QO8A 2YM1A 3KA7A 1ZY8A 4OPUA 2BS3A 5FS9A 2XVFA 1NPXA 2VSWA 3FIMB 5J7XA 1MO9A 4B67A 2ZBWA 1FCDA 4O5UA 5HBPA 2EQ7A 3H8IA 2GWFA 2BRYA 2YR5A 4OPLA 1OJAA 1X31B 2VOUA 1JRYA 1KDGA 1DXLA 3FNJA 3ALMA 1OJCA 3LB8A 4H50A 1D7YA 2GR1A 4NEWA 4Z24A 3T14A 2X8HA 5TR3A 3GYIA 1NENA 4B66A 3LJPA 1DOCA 1N4UA 4JN9A 3VRAA 4G6HA 2VQBA 2VVMA 3CMMA 4YT0A 2XVHA 1MOKA 4IV9A 4K2XA 2C3DA 3AE2A 2XFOA 2B7SA 2C75A 3FPZA 4J33A 1CWSA 1YMLA 3ATRA 4EMWA 2PHHA 1KSSA 1L9CA 2C70A 4C77A 2YLRA 3IHGA 4TM1A 2WBAA 1KFYA 4B63A 1DOBA 4FK1C 1K0IA 3T2ZA 4HB9A 2A2KA 4DNAA 4YTPA 4BJYA 4EM4A 5KMRA 2XVIA 4IA6A 3IHMA 5KXJA 4KX6A 1DP2A 2V5ZA 2A87A 1NEKA 1NAAA 2GAGB 3D8XA 1Y0PA 4ADWA 4JY3A 4B1BA 4Z2TA 4U2TA 1CL0A 3V3NA 3L8KA 3NYEA 4BV6A 2YLSA 2YQUA 3P4PA 4AP1A 5KMSA 2GH5A 2FSXA 2GF3A 1TQ1A 1F6MA 3UKQA 2WLRA 1YY5A 1JEHA 3KKJA 4JQ9A 3AAXA 1P2EA 2BK5A 5JCIA 1VRQB 4CCRA 5JCMA 3ABVA 3CPHG 2TMDA 3GRTA 3V76A 4EQRA 1ZP0A 3NK2X 3GYXA 4YKFA 1D4DA 1JNRA 2VRLA 3II4A 4YSXA 5U25A 4K5SA 2GAHB 1EL7A 1D4CA 1IUXA 2AAQA 2WDVA 2VVLG 3Q9TA 4IVMB 4TLXA 4DSHA 4U8IA 3GK5A 4BK2A 1LQUA 3CGCA 4YSHA 2B9WA 1JRXA 2OA1A 2GVCA 2V3BA 2RGOA 2WP6A 4JNAA 4Z26A 4N9XA 1WHBA 2OLOA 1MXTA 2I0ZA 2XVEA 3IPOA 3P4RA 2ARDA 2WQYA 4H2QA 1EBDA 1KSUA 2C65A 2WPCA 3M13A 4CY6A 4BK1A 2B7RA 3ICRA 2QAEA 4D03A 1JNZA 3F8PA 5IQ4A 2C76A 3VRDB 3CNPA 4B68A 1F8SA 4ECHA 1CBOA 2RABA 4P9SA 1B8SA 4C3YA 3ICSA 2B9XA 2BC0A 3AAYA 1F8WA 1FECA 3I2VA 3AEBA 3NT6A 4RG3A 1D5TA 1O5WA 2R4JA 3EF6A 4YTMA 2BK4A 3HIXA 2YLTA 2C66A 1GRHA 3HWIA 3LADA 3HYXA 4ZCDA 2Y6QA 4A6NB 5JCNA 1PJ7A 2EG3A 2WESA 3GSIA 1XPQA 3RNMA 3EPTA 3VR8A 2EG4A 1GALA 1GTHA 2R46A 3AD9B 3AE8A 3SXIA 3P4SA 4H4UA 3OP3A 2ZZBA 3NHOX 5HYMA 3AYJA 3L1RA 1H86A 2TPRA 4EIQA 1FEBA 3AE7A 4YSZA 2XVJA 1E7PA 3AE6A 2C67A 2FJEA 3NYCA 1Z6LA 4EQWA 5LAOA 3PS9A 1IUVA 1NHSA 1ZK7A 4LA1A 3BI5A 2BYBA 1CC4A 1GRFA 4GR1A 4B69A 4B64A 3CN8A 3TG1B 4C74A 4CNJA 3OLHA 1JOAA 1ONFA 3S5WA 3T2KA 1RYIA 3H8LA 1PN0A 2A8XA 3IWAA 2Q82A 5JCLA 4GDPA 1YQZA 4REKA 3UOVA 4II3A 2C7GA 3CGBA 2GEWA 3GD4A 2W0HA 3AXBA 1IUSA 3CNJA 3HYWA 3NNEA 3B6DA 5KRQA 4ZN0A 4J56A 3SZCA 3SGLA 2WU5A 1ZX9A 4GAVA 2OLNA 3R2UA 1PXCA 3O3WA 4F67A 2XLSA 4YKGA 1YT8A 1DJQA 1ZDLA 2WDRA 3GDNA 2X50A 5KOXA 2Q6UA 2O9ZA 3UTFA 4H7UA 3LXDA 1GV4A 3GMBA 4H4WA 4ICYA 4NEVA 4E0VA 1L9EA 1TDKA 2R0GA 3GDPA 3AEEA 3SM8A 3CIRA 2WPFA 1H7WA 4J57A 1B4VA 2VQ7A 1PBFA 1PXBA 2RGJA 3AD8B 1VQWA 5HXIA 3UP4A 2GR0A 1GERA 3RP6A 2Q0KA 4GCMA 1LQTA 3AWIA 3UOYA 4EM3A 5HY5A 4ZCCA 1FEAA 1CJ4A 2JB1A 5BULA 1GTEA 1NHRA 1RP0A 3G5SA 5U63A 5BUKA 3GWDA 1KNPA 3HZUA 1E6EA 1PBCA 3QSMA 4GUVA 4K22A 1H4MX 1TDOA 1PJ5A 3FG2P 5EBKA 5KMPA 5ER0A 2JB2A 4J31A 2YG6A 3H4KA 4H2PA 2Z5YA 2WLXA 2XFUA 1CJ2A 2PYXA 1BZLA 4H4SA 4G6GA 4AOSA 2YVFA 3KD9A 1K0LA 3CGEA 2BCGG 3CGDA 4Y4MA 5J60A 5LAMA 1IUUA 1Y56A 3BI4A 1ZOYA 4U8NA 3UTNX 2YWLA 2YLWA 1PBEA 2AQJA 5HHFA 5FS7A 3UKAA 4A5LA 4Z43A 2JTQA 1B37A 4G9KA 1ZOVA 4X9NA 2GR3A 1YMDA 4TM0A 3ISHA 2YLZA 2EQ8A 1PBBA 4O5QA 1L9DA 4B65A 1CC2A 2JB3A 3COXA 4H4TA 4BK3A 3F8DA 1PBDA 3D1PA 2WOVA 1EL8A 2VVLA 3NYFA 3QFAA 4H4PA 3NN6X 3RHAA 4YTNA 4OPTA 3T2YA 1GETA 2QA1A 4H2RA 1PS9A 4I59A 2AR8A 3BHKA 2NVKX 2A89A 2FJDA 1EL5A 1YQ4A 2BS2A 5FMHA 1HYUA 3CTYA 5KVHA 1OJ9A 4JNQA 1JRZA 4Y4LA 3I3UA 1ZMCA 3KPFA 4A9WA 4TM4A 1YMKA 2OUCA 2R0CA 4U8JA 3KPKA 3K9RA 3TG3A 4J2WA 4TLZA 1XANA 3MZZA 4JDRA 3WE0A 3GYJA 4EQSA 5M10A 4JGTA 2WU2A 3VR9A 3DJDA 1E39A 2E1MA 2XLUA 3EAOA 3QVPA 4RG4A 4YXDA 2BRAA 2GQFA 3SFDA 3HYVA 4CY8A 3F8RA 1NDAA 4YWOA 3AYIA 2CFYA 3EANA 4RSLA 2WEUA 5HBQA 3AEAA 3NLCA 1YM9A 3VRBA 4AT2A 2YLXA 3B3RA 1GRAA 5BVAA 2IFDA 4CCQA 5EB4A 1GSNA 4OPGA 1E1NA 3RP8A 2YAUA 5FS8A 5IQ1A 3ZDNA 2DKIA 4DGKA 4IVOB 3UKHA 1C25A 4XXGA 1LV0A 4GF7A 2XFPA 4NNJA 4D04A 4UP3A 1RHSA 3D1CA 1D4EA 4J34A 3SZFA 1LPFA 3UCLA 3ATQA 3SFEA 5IPYA 4OPCA 1S2YA 2DCQA 1GRGA 5HBLA 1YKJA 3QSEA 3T0KA 5KWFA 2ORAA 1E1MA 3DJGX 5FS6A 3K7MX 3AE9A 3ITJA 2WETA 1VG9A 2JK6A 3O0HA 4CBQA 4BURA 2E4GA 2R9ZA 1H4KX 1IUTA 1COYA 2GB0A 3KU9A 2FJAA 1E0CA 5LV9A 2ZZCA 3P1WA 3P4QA 4H4VA 4UDPA 1AOGA 1UARA 3DK9A 4U8MA 2RGHA 1NG4A 3ALLA 2VZ2A 3UOZA 4A7AA 2CULA 2YM2A 4A79A 2XFQA 2WHDA 3DK8A 3K7TA 4X9MA 1Q9IA 4M52A 1BWCA 1RHDA 1LVLA 2Q0LA 1FL2A 2EQ9A 1GPEA 3LZXA 5CQFA 5EB5A 1IUWA 2UZQA 1BOHA 1K0JA 1N1PA 1NG3A 1TDFA 2V60A 5KMQA 2YR4A 2J6PA 2R0PA 4G74A 4U2LA 2V61A 3FOJA 3NTDA 1QLBA 4OVIA 4USQA 3SYIA 5DBJA 5GRTA 4AT0A 2MOIA 1BGJA 2CDUA 3K7QX 4H4RA 3RP7A 1GEUA 1H81A 1OJTA 1Q1WA 2Q7VA 2B9YA 3AD7B 3DMEA 3Q6JA 4LIIA 5KVIA 3NGCX 4A6NA 3DH9A 1UKVG 2E5VA 3AE1A 1WV9A 2WOIA 1O95A 4X4JA 2GRTA 1PJ6A 3FS5A 2BACA 2J3NA 3IWHA 3GRSA 1BF3A 3HZLA 4USRA 4WH9A 2BXSA 4EMJA 2X8CA 4NWZA 1CWRA 1BGNA 4FDCB 3ZYXA 4Z2UA 1GRBA 1TYTA 2WP9A 4EMIA 1Y56B 3DA1A 3LZWA 4GRTA 4YSYA 4Z2RA 1ZMDA 5KNLA 4H4XA 2IVDA 3ILMA 2IIDA 5CKUA 3TP9A
chains in the Genus database with same CATH topology
3UKFA 1GT8A 1JU2A 3UTHA 3FBSA 2IFVA 2BC1A 3FLHA 4G73A 3UTEA 3G5QA 3AB1A 4AP3A 3NK1X 4EQXA 3NH3X 3OC4A 3G5JA 3DJJA 1HZMA 2JTRA 1ELIA 4UDQA 3V3OA 2UZZA 3ADAB 1URHA 1ORBA 4UDRA 4Z44A 4A65A 2YR6A 2WS3A 3AECA 4PAAA 2GV8A 2JBVA 4H2NA 4WCTA 2APGA 2R45A 3G5RA 5M0ZA 5BRTA 5L46A 3E1TA 5HBOA 1W4XA 3BNMA 1CHUA 1LJ1A 2XFNA 2YVGA 5GSNA 1KF6A 1S3BA 3C4NA 5EOWA 3BI2A 3SX6A 2DKHA 2C73A 5U1OA 2JKCA 3AE5A 4C3XA 4CRTA 2MRMA 1T3KA 1BKWA 4APNA 3NN0X 3UP5A 1QXNA 3KLJA 1XDIA 2GMJA 3I6DA 3IF9A 2OALA 3REDA 3AE3A 1L0VA 3QSSA 3GMCA 2VRMA 1RSGA 2JAEA 4LU6A 2C4CA 2QCUA 4EIPA 4I58A 4U8OA 2XLTA 3P3AA 3SQPA 2XYOA 4BJZA 1S2QA 1KNRA 1NHQA 4U8LA 3S61A 1H7XA 1E1LA 2IVEA 2V3AA 1N4VA 3AEDA 3AYLA 2BCPA 4GDEA 1DJNA 5C2TA 4H4ZA 4J36A 2XLRA 2YVJA 1SEZA 3C96A 2C64A 1NHPA 4HA6A 5JCKA 2EG4B 5HPAA 1CC6A 2HQMA 3NTAA 2Z5XA 1GOSA 3DGHA 3KVEA 3NK0X 1GMXA 3ALJA 4NZHA 3CPIG 4U8KA 3NRNA 3GWFA 4K5RA 3JSKA 1OKGA 4NTCA 2V6OA 3UKPA 1GN0A 2YG3A 3PO7A 4C5OA 2OAMA 1O94A 3M12A 1PHHA 1F3PA 2YG5A 2H88A 2X99A 4U2SA 1H84A 2YG4A 1GRTA 3FMWA 1ZKQA 1V59A 2K0ZA 2Y6RA 1EL9A 3I3LA 3UTGA 1M6IA 3T31A 1QB0A 2X8GA 3IC9A 1OJDA 4DSGA 2GQWA 2WOWA 3F4AA 4OPIA 1BOIA 1CWTA 1YQ3A 3GD3A 2WP5A 4NTEA 3SZWA 3DJEA 4FK1A 2BABA 3CNDA 2H89A 2BK3A 4A99A 3NIXA 1CJ3A 1YS0A 3DGZA 1VDCA 4K8DA 3M0OA 4Z25A 3UKKA 4KPRA 1GREA 2JTSA 3QJ4A 2C3CA 2BS4A 5KOWA 2MOLA 2HHGA 3T37A 1VEEA 4WX1A 3SZ0A 4JY2A 4AOXA 2ACZA 1M64A 1K4QA 2EQ6A 4K7ZA 4FX9A 1GESA 2YG7A 4TM3A 3IPPA 2XCGA 3R9UA 4IA5A 3UKLA 1S3EA 4U8PA 3PVCA 1CJCA 1B5QA 1H82A 1H6VA 4GAPA 3CPJG 3UOXA 3VQRA 1F8RA 3P9UA 1Q1RA 2FBWA 2NPXA 1CF3A 1E1KA 1TDNA 3DK4A 2GR2A 3AEGA 4PABA 1QJDA 3ICTA 1IJHA 2XLPA 4XWRA 3CNSA 2GMHA 2XDOA 3NG7X 1FOHA 3BHFA 1TDEA 4MJWA 1N4WA 1GXFA 3LOVA 2C72A 4XWZA 2B76A 2KL3A 4II2A 3SY4A 4H4QA 3URHA 2WPEA 2ZZ0A 2F5ZA 3C4AA 2X3NA 1XHCA 1VG0A 3OZ2A 4CNKA 2FJBA 3QFBA 4OPDA 1D7LA 5C3JA 1LTXR 1PXAA 1TYPA 1P2HA 1DOEA 2BXRA 2CVJA 2QA2A 3BNUA 1GNDA 3AE4A 3AEFA 2R4EA 1PDHA 4NTDA 4Y4NA 1H83A 1TRBA 3K30A 1DNCA 3NHVA 2WDQA 1REOA 3QVRA 4H4YA 2BA9A 4OCGA 3CNTA 3NKSA 4WH7A 1DODA 1QO8A 2YM1A 3KA7A 1ZY8A 4OPUA 2BS3A 5FS9A 2XVFA 1NPXA 2VSWA 3FIMB 5J7XA 1MO9A 4B67A 2ZBWA 1FCDA 4O5UA 5HBPA 2EQ7A 3H8IA 2GWFA 2BRYA 2YR5A 4OPLA 1OJAA 1X31B 2VOUA 1JRYA 1KDGA 1DXLA 3FNJA 3ALMA 1OJCA 3LB8A 4H50A 1D7YA 2GR1A 4NEWA 4Z24A 3T14A 2X8HA 5TR3A 3GYIA 1NENA 4B66A 3LJPA 1DOCA 1N4UA 4JN9A 3VRAA 4G6HA 2VQBA 2VVMA 3CMMA 4YT0A 2XVHA 1MOKA 4IV9A 4K2XA 2C3DA 3AE2A 2XFOA 2B7SA 2C75A 3FPZA 4J33A 1CWSA 1YMLA 3ATRA 4EMWA 2PHHA 1KSSA 1L9CA 2C70A 4C77A 2YLRA 3IHGA 4TM1A 2WBAA 1KFYA 4B63A 1DOBA 4FK1C 1K0IA 3T2ZA 4HB9A 2A2KA 4DNAA 4YTPA 4BJYA 4EM4A 5KMRA 2XVIA 4IA6A 3IHMA 5KXJA 4KX6A 1DP2A 2V5ZA 2A87A 1NEKA 1NAAA 2GAGB 3D8XA 1Y0PA 4ADWA 4JY3A 4B1BA 4Z2TA 4U2TA 1CL0A 3V3NA 3L8KA 3NYEA 4BV6A 2YLSA 2YQUA 3P4PA 4AP1A 5KMSA 2GH5A 2FSXA 2GF3A 1TQ1A 1F6MA 3UKQA 2WLRA 1YY5A 1JEHA 3KKJA 4JQ9A 3AAXA 1P2EA 2BK5A 5JCIA 1VRQB 4CCRA 5JCMA 3ABVA 3CPHG 2TMDA 3GRTA 3V76A 4EQRA 1ZP0A 3NK2X 3GYXA 4YKFA 1D4DA 1JNRA 2VRLA 3II4A 4YSXA 5U25A 4K5SA 2GAHB 1EL7A 1D4CA 1IUXA 2AAQA 2WDVA 2VVLG 3Q9TA 4IVMB 4TLXA 4DSHA 4U8IA 3GK5A 4BK2A 1LQUA 3CGCA 4YSHA 2B9WA 1JRXA 2OA1A 2GVCA 2V3BA 2RGOA 2WP6A 4JNAA 4Z26A 4N9XA 1WHBA 2OLOA 1MXTA 2I0ZA 2XVEA 3IPOA 3P4RA 2ARDA 2WQYA 4H2QA 1EBDA 1KSUA 2C65A 2WPCA 3M13A 4CY6A 4BK1A 2B7RA 3ICRA 2QAEA 4D03A 1JNZA 3F8PA 5IQ4A 2C76A 3VRDB 3CNPA 4B68A 1F8SA 4ECHA 1CBOA 2RABA 4P9SA 1B8SA 4C3YA 3ICSA 2B9XA 2BC0A 3AAYA 1F8WA 1FECA 3I2VA 3AEBA 3NT6A 4RG3A 1D5TA 1O5WA 2R4JA 3EF6A 4YTMA 2BK4A 3HIXA 2YLTA 2C66A 1GRHA 3HWIA 3LADA 3HYXA 4ZCDA 2Y6QA 4A6NB 5JCNA 1PJ7A 2EG3A 2WESA 3GSIA 1XPQA 3RNMA 3EPTA 3VR8A 2EG4A 1GALA 1GTHA 2R46A 3AD9B 3AE8A 3SXIA 3P4SA 4H4UA 3OP3A 2ZZBA 3NHOX 5HYMA 3AYJA 3L1RA 1H86A 2TPRA 4EIQA 1FEBA 3AE7A 4YSZA 2XVJA 1E7PA 3AE6A 2C67A 2FJEA 3NYCA 1Z6LA 4EQWA 5LAOA 3PS9A 1IUVA 1NHSA 1ZK7A 4LA1A 3BI5A 2BYBA 1CC4A 1GRFA 4GR1A 4B69A 4B64A 3CN8A 3TG1B 4C74A 4CNJA 3OLHA 1JOAA 1ONFA 3S5WA 3T2KA 1RYIA 3H8LA 1PN0A 2A8XA 3IWAA 5JCLA 4GDPA 1YQZA 4REKA 3UOVA 4II3A 2C7GA 3CGBA 2GEWA 3GD4A 2W0HA 3AXBA 1IUSA 3CNJA 3HYWA 3NNEA 3B6DA 5KRQA 4ZN0A 4J56A 3SZCA 3SGLA 2WU5A 1ZX9A 4GAVA 2OLNA 3R2UA 1PXCA 3O3WA 4F67A 2XLSA 4YKGA 1YT8A 1DJQA 1ZDLA 2WDRA 3GDNA 2X50A 5KOXA 2Q6UA 2O9ZA 3UTFA 4H7UA 3LXDA 1GV4A 3GMBA 4H4WA 4ICYA 4NEVA 4E0VA 1L9EA 1TDKA 2R0GA 3GDPA 3AEEA 3SM8A 3CIRA 2WPFA 1H7WA 4J57A 1B4VA 2VQ7A 1PBFA 1PXBA 2RGJA 3AD8B 1VQWA 5HXIA 3UP4A 2GR0A 1GERA 3RP6A 2Q0KA 4GCMA 1LQTA 3AWIA 3UOYA 4EM3A 5HY5A 4ZCCA 1FEAA 1CJ4A 2JB1A 5BULA 1GTEA 1NHRA 1RP0A 3G5SA 5U63A 5BUKA 3GWDA 1KNPA 3HZUA 1E6EA 1PBCA 3QSMA 4GUVA 4K22A 1H4MX 1TDOA 1PJ5A 3FG2P 5EBKA 5KMPA 5ER0A 2JB2A 4J31A 2YG6A 3H4KA 4H2PA 2Z5YA 2WLXA 2XFUA 1CJ2A 2PYXA 1BZLA 4H4SA 4G6GA 4AOSA 2YVFA 3KD9A 1K0LA 3CGEA 2BCGG 3CGDA 4Y4MA 5J60A 5LAMA 1IUUA 1Y56A 3BI4A 1ZOYA 4U8NA 3UTNX 2YWLA 2YLWA 1PBEA 2AQJA 5HHFA 5FS7A 3UKAA 4A5LA 4Z43A 2JTQA 1B37A 4G9KA 1ZOVA 4X9NA 2GR3A 1YMDA 4TM0A 3ISHA 2YLZA 2EQ8A 1PBBA 4O5QA 1L9DA 4B65A 1CC2A 2JB3A 3COXA 4H4TA 4BK3A 3F8DA 1PBDA 3D1PA 2WOVA 1EL8A 2VVLA 3NYFA 3QFAA 4H4PA 3NN6X 3RHAA 4YTNA 4OPTA 3T2YA 1GETA 2QA1A 4H2RA 1PS9A 4I59A 2AR8A 3BHKA 2NVKX 2A89A 2FJDA 1EL5A 1YQ4A 2BS2A 5FMHA 1HYUA 3CTYA 5KVHA 1OJ9A 4JNQA 1JRZA 4Y4LA 3I3UA 1ZMCA 3KPFA 4A9WA 4TM4A 1YMKA 2OUCA 2R0CA 4U8JA 3KPKA 3K9RA 3TG3A 4J2WA 4TLZA 1XANA 3MZZA 4JDRA 3WE0A 3GYJA 4EQSA 5M10A 4JGTA 2WU2A 3VR9A 3DJDA 1E39A 2E1MA 2XLUA 3EAOA 3QVPA 4RG4A 4YXDA 2BRAA 2GQFA 3SFDA 3HYVA 4CY8A 3F8RA 1NDAA 4YWOA 3AYIA 2CFYA 3EANA 4RSLA 2WEUA 5HBQA 3AEAA 3NLCA 1YM9A 3VRBA 4AT2A 2YLXA 3B3RA 1GRAA 5BVAA 2IFDA 4CCQA 5EB4A 1GSNA 4OPGA 1E1NA 3RP8A 2YAUA 5FS8A 5IQ1A 3ZDNA 2DKIA 4DGKA 4IVOB 3UKHA 1C25A 4XXGA 1LV0A 4GF7A 2XFPA 4NNJA 4D04A 4UP3A 1RHSA 3D1CA 1D4EA 4J34A 3SZFA 1LPFA 3UCLA 3ATQA 3SFEA 5IPYA 4OPCA 1S2YA 2DCQA 1GRGA 5HBLA 1YKJA 3QSEA 3T0KA 5KWFA 2ORAA 1E1MA 3DJGX 5FS6A 3K7MX 3AE9A 3ITJA 2WETA 1VG9A 2JK6A 3O0HA 4CBQA 4BURA 2E4GA 2R9ZA 1H4KX 1IUTA 1COYA 2GB0A 3KU9A 2FJAA 1E0CA 5LV9A 2ZZCA 3P1WA 3P4QA 4H4VA 4UDPA 1AOGA 1UARA 3DK9A 4U8MA 2RGHA 1NG4A 3ALLA 2VZ2A 3UOZA 4A7AA 2CULA 2YM2A 4A79A 2XFQA 2WHDA 3DK8A 3K7TA 4X9MA 1Q9IA 4M52A 1BWCA 1RHDA 1LVLA 2Q0LA 1FL2A 2EQ9A 1GPEA 3LZXA 5CQFA 5EB5A 1IUWA 2UZQA 1BOHA 1K0JA 1N1PA 1NG3A 1TDFA 2V60A 5KMQA 2YR4A 2J6PA 2R0PA 4G74A 4U2LA 2V61A 3FOJA 3NTDA 1QLBA 4OVIA 4USQA 3SYIA 5DBJA 5GRTA 4AT0A 2MOIA 1BGJA 2CDUA 3K7QX 4H4RA 3RP7A 1GEUA 1H81A 1OJTA 1Q1WA 2Q7VA 2B9YA 3AD7B 3DMEA 3Q6JA 4LIIA 5KVIA 3NGCX 4A6NA 3DH9A 1UKVG 2E5VA 3AE1A 1WV9A 2WOIA 1O95A 4X4JA 2GRTA 1PJ6A 3FS5A 2BACA 2J3NA 3IWHA 3GRSA 1BF3A 3HZLA 4USRA 4WH9A 2BXSA 4EMJA 2X8CA 4NWZA 1CWRA 1BGNA 4FDCB 3ZYXA 4Z2UA 1GRBA 1TYTA 2WP9A 4EMIA 1Y56B 3DA1A 3LZWA 4GRTA 4YSYA 4Z2RA 1ZMDA 5KNLA 4H4XA 2IVDA 3ILMA 2IIDA 5CKUA 3TP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKF A;  1GT8 A;  1JU2 A;  3UTH A;  3FBS A;  2IFV A;  2BC1 A;  3FLH A;  3UTE A;  3G5Q A;  3AB1 A;  4AP3 A;  3NK1 X;  4EQX A;  3NH3 X;  3OC4 A;  3G5J A;  3DJJ A;  1HZM A;  2JTR A;  1ELI A;  4UDQ A;  3V3O A;  2UZZ A;  3ADA B;  1URH A;  1ORB A;  4UDR A;  4Z44 A;  4A65 A;  2YR6 A;  2WS3 A;  3AEC A;  4PAA A;  2GV8 A;  2JBV A;  4H2N A;  4WCT A;  2APG A;  2R45 A;  3G5R A;  5M0Z A;  5BRT A;  5L46 A;  3E1T A;  5HBO A;  1W4X A;  3BNM A;  1CHU A;  1LJ1 A;  2XFN A;  2YVG A;  5GSN A;  1KF6 A;  1S3B A;  3C4N A;  5EOW A;  3BI2 A;  2DKH A;  2C73 A;  5U1O A;  2JKC A;  3AE5 A;  4C3X A;  4CRT A;  2MRM A;  1T3K A;  1BKW A;  4APN A;  3NN0 X;  3UP5 A;  1QXN A;  3KLJ A;  1XDI A;  2GMJ A;  3I6D A;  3IF9 A;  2OAL A;  3RED A;  3AE3 A;  1L0V A;  3QSS A;  3GMC A;  2VRM A;  1RSG A;  2JAE A;  4LU6 A;  4EIP A;  2QCU A;  4I58 A;  4U8O A;  2XLT A;  3P3A A;  3SQP A;  2XYO A;  4BJZ A;  1S2Q A;  1KNR A;  1NHQ A;  4U8L A;  3S61 A;  1H7X A;  1E1L A;  2IVE A;  2V3A A;  1N4V A;  3AED A;  3AYL A;  2BCP A;  4GDE A;  1DJN A;  5C2T A;  4H4Z A;  4J36 A;  2XLR A;  2YVJ A;  1SEZ A;  3C96 A;  2C64 A;  1NHP A;  4HA6 A;  5JCK A;  2EG4 B;  5HPA A;  1CC6 A;  2HQM A;  3NTA A;  2Z5X A;  1GOS A;  3DGH A;  3KVE A;  3NK0 X;  1GMX A;  3ALJ A;  4NZH A;  3CPI G;  4U8K A;  3NRN A;  3GWF A;  4K5R A;  3JSK A;  1OKG A;  4NTC A;  2V6O A;  3UKP A;  1GN0 A;  2YG3 A;  3PO7 A;  4C5O A;  2OAM A;  1O94 A;  3M12 A;  1PHH A;  1F3P A;  2YG5 A;  2H88 A;  2X99 A;  4U2S A;  1H84 A;  2YG4 A;  1GRT A;  3FMW A;  1ZKQ A;  1V59 A;  2K0Z A;  2Y6R A;  1EL9 A;  3I3L A;  3UTG A;  1M6I A;  1QB0 A;  2X8G A;  3IC9 A;  1OJD A;  4DSG A;  2GQW A;  2WOW A;  3F4A A;  4OPI A;  1BOI A;  1CWT A;  1YQ3 A;  3GD3 A;  2WP5 A;  4NTE A;  3DJE A;  4FK1 A;  2BAB A;  3CND A;  2H89 A;  2BK3 A;  4A99 A;  3NIX A;  1CJ3 A;  1YS0 A;  3DGZ A;  1VDC A;  4K8D A;  3M0O A;  4Z25 A;  3UKK A;  4KPR A;  1GRE A;  2JTS A;  3QJ4 A;  2C3C A;  2BS4 A;  5KOW A;  2MOL A;  2HHG A;  3T37 A;  1VEE A;  4WX1 A;  4AOX A;  4JY2 A;  2ACZ A;  1M64 A;  1K4Q A;  2EQ6 A;  4K7Z A;  4FX9 A;  1GES A;  2YG7 A;  4TM3 A;  3IPP A;  2XCG A;  3R9U A;  4IA5 A;  3UKL A;  1S3E A;  4U8P A;  3PVC A;  1CJC A;  1B5Q A;  1H82 A;  1H6V A;  3UOX A;  3CPJ G;  3VQR A;  1F8R A;  3P9U A;  1Q1R A;  2FBW A;  2NPX A;  1CF3 A;  1E1K A;  1TDN A;  3DK4 A;  2GR2 A;  3AEG A;  4PAB A;  1QJD A;  3ICT A;  1IJH A;  2XLP A;  4XWR A;  3CNS A;  2GMH A;  2XDO A;  3NG7 X;  1FOH A;  3BHF A;  1TDE A;  4MJW A;  1N4W A;  1GXF A;  3LOV A;  2C72 A;  4XWZ A;  2B76 A;  2KL3 A;  3URH A;  4H4Q A;  2WPE A;  2ZZ0 A;  2F5Z A;  3C4A A;  2X3N A;  1XHC A;  1VG0 A;  3OZ2 A;  4CNK A;  2FJB A;  3QFB A;  4OPD A;  1D7L A;  5C3J A;  1LTX R;  1PXA A;  1TYP A;  1P2H A;  1DOE A;  2BXR A;  2CVJ A;  2QA2 A;  3BNU A;  1GND A;  3AE4 A;  3AEF A;  2R4E A;  1PDH A;  4NTD A;  4Y4N A;  1H83 A;  1TRB A;  3K30 A;  1DNC A;  3NHV A;  2WDQ A;  1REO A;  3QVR A;  4H4Y A;  2BA9 A;  4OCG A;  3CNT A;  3NKS A;  4WH7 A;  1DOD A;  1QO8 A;  2YM1 A;  3KA7 A;  1ZY8 A;  4OPU A;  2BS3 A;  5FS9 A;  2XVF A;  1NPX A;  2VSW A;  3FIM B;  5J7X A;  1MO9 A;  4B67 A;  2ZBW A;  1FCD A;  4O5U A;  5HBP A;  2EQ7 A;  3H8I A;  2GWF A;  2YR5 A;  4OPL A;  1OJA A;  1X31 B;  2VOU A;  1JRY A;  1KDG A;  1DXL A;  3FNJ A;  3ALM A;  1OJC A;  3LB8 A;  4H50 A;  1D7Y A;  2GR1 A;  4NEW A;  4Z24 A;  2X8H A;  5TR3 A;  3GYI A;  1NEN A;  4B66 A;  3LJP A;  1DOC A;  1N4U A;  4JN9 A;  3VRA A;  2VQB A;  2VVM A;  4YT0 A;  2XVH A;  1MOK A;  4IV9 A;  4K2X A;  2C3D A;  3AE2 A;  2XFO A;  2B7S A;  2C75 A;  3FPZ A;  4J33 A;  1CWS A;  1YML A;  3ATR A;  4EMW A;  2PHH A;  1KSS A;  1L9C A;  2C70 A;  4C77 A;  2YLR A;  3IHG A;  4TM1 A;  2WBA A;  1KFY A;  4B63 A;  1DOB A;  4FK1 C;  1K0I A;  4HB9 A;  2A2K A;  4DNA A;  4YTP A;  4BJY A;  4EM4 A;  2XVI A;  4IA6 A;  3IHM A;  5KXJ A;  4KX6 A;  1DP2 A;  2V5Z A;  2A87 A;  1NEK A;  1NAA A;  2GAG B;  3D8X A;  1Y0P A;  4ADW A;  4JY3 A;  4B1B A;  4Z2T A;  4U2T A;  1CL0 A;  3V3N A;  3L8K A;  3NYE A;  4BV6 A;  2YLS A;  2YQU A;  3P4P A;  4AP1 A;  2GH5 A;  2FSX A;  2GF3 A;  1TQ1 A;  1F6M A;  3UKQ A;  2WLR A;  1YY5 A;  1JEH A;  3KKJ A;  4JQ9 A;  3AAX A;  1P2E A;  2BK5 A;  5JCI A;  1VRQ B;  4CCR A;  5JCM A;  3ABV A;  3CPH G;  2TMD A;  3GRT A;  3V76 A;  4EQR A;  1ZP0 A;  3NK2 X;  4YKF A;  1D4D A;  1JNR A;  2VRL A;  3II4 A;  4YSX A;  5U25 A;  4K5S A;  2GAH B;  1EL7 A;  1D4C A;  1IUX A;  2AAQ A;  2WDV A;  2VVL G;  3Q9T A;  4IVM B;  4TLX A;  4DSH A;  4U8I A;  3GK5 A;  4BK2 A;  1LQU A;  3CGC A;  4YSH A;  2B9W A;  1JRX A;  2OA1 A;  2GVC A;  2V3B A;  2RGO A;  2WP6 A;  4JNA A;  4Z26 A;  4N9X A;  1WHB A;  2OLO A;  1MXT A;  2I0Z A;  2XVE A;  3IPO A;  3P4R A;  2ARD A;  2WQY A;  4H2Q A;  1EBD A;  1KSU A;  2C65 A;  2WPC A;  3M13 A;  4CY6 A;  4BK1 A;  2B7R A;  3ICR A;  2QAE A;  4D03 A;  1JNZ A;  3F8P A;  5IQ4 A;  2C76 A;  3VRD B;  3CNP A;  4B68 A;  1F8S A;  4ECH A;  1CBO A;  2RAB A;  4P9S A;  1B8S A;  4C3Y A;  3ICS A;  2B9X A;  2BC0 A;  3AAY A;  1F8W A;  1FEC A;  3I2V A;  3AEB A;  3NT6 A;  4RG3 A;  1D5T A;  1O5W A;  2R4J A;  3EF6 A;  4YTM A;  2BK4 A;  3HIX A;  2YLT A;  2C66 A;  1GRH A;  3HWI A;  3LAD A;  4ZCD A;  2Y6Q A;  4A6N B;  5JCN A;  1PJ7 A;  2EG3 A;  2WES A;  3GSI A;  1XPQ A;  3RNM A;  3EPT A;  3VR8 A;  2EG4 A;  1GAL A;  1GTH A;  2R46 A;  3AD9 B;  3AE8 A;  3P4S A;  4H4U A;  3OP3 A;  2ZZB A;  3NHO X;  5HYM A;  3AYJ A;  3L1R A;  1H86 A;  2TPR A;  4EIQ A;  1FEB A;  3AE7 A;  4YSZ A;  2XVJ A;  1E7P A;  3AE6 A;  2C67 A;  2FJE A;  3NYC A;  1Z6L A;  4EQW A;  5LAO A;  3PS9 A;  1IUV A;  1NHS A;  1ZK7 A;  4LA1 A;  3BI5 A;  2BYB A;  1CC4 A;  1GRF A;  4GR1 A;  4B69 A;  4B64 A;  3CN8 A;  3TG1 B;  4C74 A;  4CNJ A;  3OLH A;  1JOA A;  1ONF A;  3S5W A;  1RYI A;  3H8L A;  1PN0 A;  2A8X A;  3IWA A;  5JCL A;  4GDP A;  1YQZ A;  4REK A;  3UOV A;  2C7G A;  3CGB A;  2GEW A;  3GD4 A;  2W0H A;  3AXB A;  1IUS A;  3CNJ A;  3NNE A;  3B6D A;  5KRQ A;  4ZN0 A;  4J56 A;  3SGL A;  2WU5 A;  1ZX9 A;  2OLN A;  3R2U A;  1PXC A;  3O3W A;  4F67 A;  2XLS A;  4YKG A;  1YT8 A;  1DJQ A;  1ZDL A;  2WDR A;  3GDN A;  2X50 A;  5KOX A;  2Q6U A;  2O9Z A;  3UTF A;  4H7U A;  3LXD A;  1GV4 A;  3GMB A;  4H4W A;  4ICY A;  4NEV A;  4E0V A;  1L9E A;  1TDK A;  2R0G A;  3GDP A;  3AEE A;  3SM8 A;  3CIR A;  2WPF A;  1H7W A;  4J57 A;  1B4V A;  2VQ7 A;  1PBF A;  1PXB A;  2RGJ A;  3AD8 B;  1VQW A;  5HXI A;  3UP4 A;  2GR0 A;  1GER A;  3RP6 A;  2Q0K A;  4GCM A;  1LQT A;  3AWI A;  3UOY A;  4EM3 A;  5HY5 A;  4ZCC A;  1FEA A;  1CJ4 A;  2JB1 A;  5BUL A;  1GTE A;  1NHR A;  1RP0 A;  3G5S A;  5U63 A;  5BUK A;  3GWD A;  1KNP A;  3HZU A;  1E6E A;  1PBC A;  3QSM A;  4GUV A;  4K22 A;  1H4M X;  1TDO A;  1PJ5 A;  3FG2 P;  5EBK A;  5ER0 A;  2JB2 A;  4J31 A;  2YG6 A;  3H4K A;  4H2P A;  2Z5Y A;  2WLX A;  2XFU A;  1CJ2 A;  2PYX A;  1BZL A;  4H4S A;  4AOS A;  2YVF A;  3KD9 A;  1K0L A;  3CGE A;  2BCG G;  3CGD A;  4Y4M A;  5J60 A;  5LAM A;  1IUU A;  1Y56 A;  3BI4 A;  1ZOY A;  4U8N A;  3UTN X;  2YWL A;  2YLW A;  1PBE A;  2AQJ A;  5HHF A;  5FS7 A;  3UKA A;  4A5L A;  4Z43 A;  2JTQ A;  1B37 A;  1ZOV A;  4X9N A;  2GR3 A;  1YMD A;  4TM0 A;  3ISH A;  2YLZ A;  2EQ8 A;  1PBB A;  4O5Q A;  1L9D A;  4B65 A;  1CC2 A;  2JB3 A;  3COX A;  4H4T A;  4BK3 A;  3F8D A;  1PBD A;  3D1P A;  2WOV A;  1EL8 A;  2VVL A;  3NYF A;  3QFA A;  4H4P A;  3NN6 X;  3RHA A;  4YTN A;  4OPT A;  1GET A;  2QA1 A;  4H2R A;  1PS9 A;  4I59 A;  2AR8 A;  3BHK A;  2NVK X;  2A89 A;  2FJD A;  1EL5 A;  1YQ4 A;  2BS2 A;  5FMH A;  1HYU A;  3CTY A;  5KVH A;  1OJ9 A;  4JNQ A;  1JRZ A;  4Y4L A;  3I3U A;  1ZMC A;  3KPF A;  4A9W A;  4TM4 A;  1YMK A;  2OUC A;  2R0C A;  4U8J A;  3K9R A;  3TG3 A;  4J2W A;  4TLZ A;  1XAN A;  3MZZ A;  4JDR A;  3WE0 A;  3GYJ A;  4EQS A;  5M10 A;  4JGT A;  2WU2 A;  3VR9 A;  3DJD A;  1E39 A;  2E1M A;  2XLU A;  3EAO A;  3QVP A;  4RG4 A;  4YXD A;  2GQF A;  3SFD A;  4CY8 A;  3F8R A;  1NDA A;  4YWO A;  3AYI A;  2CFY A;  3EAN A;  4RSL A;  2WEU A;  5HBQ A;  3AEA A;  3NLC A;  1YM9 A;  3VRB A;  4AT2 A;  2YLX A;  3B3R A;  1GRA A;  5BVA A;  2IFD A;  4CCQ A;  5EB4 A;  1GSN A;  4OPG A;  1E1N A;  3RP8 A;  2YAU A;  5FS8 A;  5IQ1 A;  3ZDN A;  2DKI A;  4DGK A;  4IVO B;  3UKH A;  1C25 A;  4XXG A;  1LV0 A;  4GF7 A;  2XFP A;  4D04 A;  4UP3 A;  1RHS A;  3D1C A;  1D4E A;  4J34 A;  3UCL A;  1LPF A;  5IPY A;  3ATQ A;  3SFE A;  4OPC A;  1S2Y A;  2DCQ A;  1GRG A;  5HBL A;  1YKJ A;  3QSE A;  5KWF A;  2ORA A;  1E1M A;  3DJG X;  5FS6 A;  3K7M X;  3AE9 A;  3ITJ A;  2WET A;  1VG9 A;  2JK6 A;  3O0H A;  4CBQ A;  4BUR A;  2E4G A;  2R9Z A;  1H4K X;  1IUT A;  1COY A;  2GB0 A;  3KU9 A;  2FJA A;  1E0C A;  5LV9 A;  2ZZC A;  3P1W A;  3P4Q A;  4H4V A;  4UDP A;  1AOG A;  1UAR A;  3DK9 A;  4U8M A;  2RGH A;  1NG4 A;  3ALL A;  2VZ2 A;  3UOZ A;  4A7A A;  2CUL A;  2YM2 A;  4A79 A;  2XFQ A;  2WHD A;  3DK8 A;  3K7T A;  4X9M A;  1Q9I A;  4M52 A;  1BWC A;  1RHD A;  1LVL A;  2Q0L A;  1FL2 A;  2EQ9 A;  1GPE A;  3LZX A;  5CQF A;  5EB5 A;  1IUW A;  2UZQ A;  1BOH A;  1K0J A;  1N1P A;  1NG3 A;  1TDF A;  2V60 A;  2YR4 A;  2J6P A;  2R0P A;  4U2L A;  2V61 A;  3FOJ A;  3NTD A;  1QLB A;  4OVI A;  4USQ A;  5DBJ A;  5GRT A;  4AT0 A;  2MOI A;  1BGJ A;  2CDU A;  3K7Q X;  4H4R A;  3RP7 A;  1GEU A;  1H81 A;  1OJT A;  1Q1W A;  2Q7V A;  2B9Y A;  3AD7 B;  3DME A;  3Q6J A;  4LII A;  5KVI A;  3NGC X;  4A6N A;  3DH9 A;  1UKV G;  2E5V A;  3AE1 A;  1WV9 A;  2WOI A;  1O95 A;  4X4J A;  2GRT A;  1PJ6 A;  3FS5 A;  2BAC A;  2J3N A;  3IWH A;  3GRS A;  1BF3 A;  3HZL A;  4USR A;  4WH9 A;  2BXS A;  4EMJ A;  2X8C A;  1CWR A;  1BGN A;  4FDC B;  3ZYX A;  4Z2U A;  1GRB A;  1TYT A;  2WP9 A;  4EMI A;  1Y56 B;  3DA1 A;  3LZW A;  4GRT A;  4YSY A;  4Z2R A;  1ZMD A;  4H4X A;  2IVD A;  3ILM A;  2IID A;  5CKU A;  3TP9 A; 
#chains in the Genus database with same CATH topology
 3UKF A;  1GT8 A;  1JU2 A;  3UTH A;  3FBS A;  2IFV A;  2BC1 A;  3FLH A;  4G73 A;  3UTE A;  3G5Q A;  3AB1 A;  4AP3 A;  3NK1 X;  4EQX A;  3NH3 X;  3OC4 A;  3G5J A;  3DJJ A;  1HZM A;  2JTR A;  1ELI A;  4UDQ A;  3V3O A;  2UZZ A;  3ADA B;  1URH A;  1ORB A;  4UDR A;  4Z44 A;  4A65 A;  2YR6 A;  2WS3 A;  3AEC A;  4PAA A;  2GV8 A;  2JBV A;  4H2N A;  4WCT A;  2APG A;  2R45 A;  3G5R A;  5M0Z A;  5BRT A;  5L46 A;  3E1T A;  5HBO A;  1W4X A;  3BNM A;  1CHU A;  1LJ1 A;  2XFN A;  2YVG A;  5GSN A;  1KF6 A;  1S3B A;  3C4N A;  5EOW A;  3BI2 A;  3SX6 A;  2DKH A;  2C73 A;  5U1O A;  2JKC A;  3AE5 A;  4C3X A;  4CRT A;  2MRM A;  1T3K A;  1BKW A;  4APN A;  3NN0 X;  3UP5 A;  1QXN A;  3KLJ A;  1XDI A;  2GMJ A;  3I6D A;  3IF9 A;  2OAL A;  3RED A;  3AE3 A;  1L0V A;  3QSS A;  3GMC A;  2VRM A;  1RSG A;  2JAE A;  4LU6 A;  2C4C A;  2QCU A;  4EIP A;  4I58 A;  4U8O A;  2XLT A;  3P3A A;  3SQP A;  2XYO A;  4BJZ A;  1S2Q A;  1KNR A;  1NHQ A;  4U8L A;  3S61 A;  1H7X A;  1E1L A;  2IVE A;  2V3A A;  1N4V A;  3AED A;  3AYL A;  2BCP A;  4GDE A;  1DJN A;  5C2T A;  4H4Z A;  4J36 A;  2XLR A;  2YVJ A;  1SEZ A;  3C96 A;  2C64 A;  1NHP A;  4HA6 A;  5JCK A;  2EG4 B;  5HPA A;  1CC6 A;  2HQM A;  3NTA A;  2Z5X A;  1GOS A;  3DGH A;  3KVE A;  3NK0 X;  1GMX A;  3ALJ A;  4NZH A;  3CPI G;  4U8K A;  3NRN A;  3GWF A;  4K5R A;  3JSK A;  1OKG A;  4NTC A;  2V6O A;  3UKP A;  1GN0 A;  2YG3 A;  3PO7 A;  4C5O A;  2OAM A;  1O94 A;  3M12 A;  1PHH A;  1F3P A;  2YG5 A;  2H88 A;  2X99 A;  4U2S A;  1H84 A;  2YG4 A;  1GRT A;  3FMW A;  1ZKQ A;  1V59 A;  2K0Z A;  2Y6R A;  1EL9 A;  3I3L A;  3UTG A;  1M6I A;  3T31 A;  1QB0 A;  2X8G A;  3IC9 A;  1OJD A;  4DSG A;  2GQW A;  2WOW A;  3F4A A;  4OPI A;  1BOI A;  1CWT A;  1YQ3 A;  3GD3 A;  2WP5 A;  4NTE A;  3SZW A;  3DJE A;  4FK1 A;  2BAB A;  3CND A;  2H89 A;  2BK3 A;  4A99 A;  3NIX A;  1CJ3 A;  1YS0 A;  3DGZ A;  1VDC A;  4K8D A;  3M0O A;  4Z25 A;  3UKK A;  4KPR A;  1GRE A;  2JTS A;  3QJ4 A;  2C3C A;  2BS4 A;  5KOW A;  2MOL A;  2HHG A;  3T37 A;  1VEE A;  4WX1 A;  3SZ0 A;  4JY2 A;  4AOX A;  2ACZ A;  1M64 A;  1K4Q A;  2EQ6 A;  4K7Z A;  4FX9 A;  1GES A;  2YG7 A;  4TM3 A;  3IPP A;  2XCG A;  3R9U A;  4IA5 A;  3UKL A;  1S3E A;  4U8P A;  3PVC A;  1CJC A;  1B5Q A;  1H82 A;  1H6V A;  4GAP A;  3CPJ G;  3UOX A;  3VQR A;  1F8R A;  3P9U A;  1Q1R A;  2FBW A;  2NPX A;  1CF3 A;  1E1K A;  1TDN A;  3DK4 A;  2GR2 A;  3AEG A;  4PAB A;  1QJD A;  3ICT A;  1IJH A;  2XLP A;  4XWR A;  3CNS A;  2GMH A;  2XDO A;  3NG7 X;  1FOH A;  3BHF A;  1TDE A;  4MJW A;  1N4W A;  1GXF A;  3LOV A;  2C72 A;  4XWZ A;  2B76 A;  2KL3 A;  4II2 A;  3SY4 A;  4H4Q A;  3URH A;  2WPE A;  2ZZ0 A;  2F5Z A;  3C4A A;  2X3N A;  1XHC A;  1VG0 A;  3OZ2 A;  4CNK A;  2FJB A;  3QFB A;  4OPD A;  1D7L A;  5C3J A;  1LTX R;  1PXA A;  1TYP A;  1P2H A;  1DOE A;  2BXR A;  2CVJ A;  2QA2 A;  3BNU A;  1GND A;  3AE4 A;  3AEF A;  2R4E A;  1PDH A;  4NTD A;  4Y4N A;  1H83 A;  1TRB A;  3K30 A;  1DNC A;  3NHV A;  2WDQ A;  1REO A;  3QVR A;  4H4Y A;  2BA9 A;  4OCG A;  3CNT A;  3NKS A;  4WH7 A;  1DOD A;  1QO8 A;  2YM1 A;  3KA7 A;  1ZY8 A;  4OPU A;  2BS3 A;  5FS9 A;  2XVF A;  1NPX A;  2VSW A;  3FIM B;  5J7X A;  1MO9 A;  4B67 A;  2ZBW A;  1FCD A;  4O5U A;  5HBP A;  2EQ7 A;  3H8I A;  2GWF A;  2BRY A;  2YR5 A;  4OPL A;  1OJA A;  1X31 B;  2VOU A;  1JRY A;  1KDG A;  1DXL A;  3FNJ A;  3ALM A;  1OJC A;  3LB8 A;  4H50 A;  1D7Y A;  2GR1 A;  4NEW A;  4Z24 A;  3T14 A;  2X8H A;  5TR3 A;  3GYI A;  1NEN A;  4B66 A;  3LJP A;  1DOC A;  1N4U A;  4JN9 A;  3VRA A;  4G6H A;  2VQB A;  2VVM A;  3CMM A;  4YT0 A;  2XVH A;  1MOK A;  4IV9 A;  4K2X A;  2C3D A;  3AE2 A;  2XFO A;  2B7S A;  2C75 A;  3FPZ A;  4J33 A;  1CWS A;  1YML A;  3ATR A;  4EMW A;  2PHH A;  1KSS A;  1L9C A;  2C70 A;  4C77 A;  2YLR A;  3IHG A;  4TM1 A;  2WBA A;  1KFY A;  4B63 A;  1DOB A;  4FK1 C;  1K0I A;  3T2Z A;  4HB9 A;  2A2K A;  4DNA A;  4YTP A;  4BJY A;  4EM4 A;  5KMR A;  2XVI A;  4IA6 A;  3IHM A;  5KXJ A;  4KX6 A;  1DP2 A;  2V5Z A;  2A87 A;  1NEK A;  1NAA A;  2GAG B;  3D8X A;  1Y0P A;  4ADW A;  4JY3 A;  4B1B A;  4Z2T A;  4U2T A;  1CL0 A;  3V3N A;  3L8K A;  3NYE A;  4BV6 A;  2YLS A;  2YQU A;  3P4P A;  4AP1 A;  5KMS A;  2GH5 A;  2FSX A;  2GF3 A;  1TQ1 A;  1F6M A;  3UKQ A;  2WLR A;  1YY5 A;  1JEH A;  3KKJ A;  4JQ9 A;  3AAX A;  1P2E A;  2BK5 A;  5JCI A;  1VRQ B;  4CCR A;  5JCM A;  3ABV A;  3CPH G;  2TMD A;  3GRT A;  3V76 A;  4EQR A;  1ZP0 A;  3NK2 X;  3GYX A;  4YKF A;  1D4D A;  1JNR A;  2VRL A;  3II4 A;  4YSX A;  5U25 A;  4K5S A;  2GAH B;  1EL7 A;  1D4C A;  1IUX A;  2AAQ A;  2WDV A;  2VVL G;  3Q9T A;  4IVM B;  4TLX A;  4DSH A;  4U8I A;  3GK5 A;  4BK2 A;  1LQU A;  3CGC A;  4YSH A;  2B9W A;  1JRX A;  2OA1 A;  2GVC A;  2V3B A;  2RGO A;  2WP6 A;  4JNA A;  4Z26 A;  4N9X A;  1WHB A;  2OLO A;  1MXT A;  2I0Z A;  2XVE A;  3IPO A;  3P4R A;  2ARD A;  2WQY A;  4H2Q A;  1EBD A;  1KSU A;  2C65 A;  2WPC A;  3M13 A;  4CY6 A;  4BK1 A;  2B7R A;  3ICR A;  2QAE A;  4D03 A;  1JNZ A;  3F8P A;  5IQ4 A;  2C76 A;  3VRD B;  3CNP A;  4B68 A;  1F8S A;  4ECH A;  1CBO A;  2RAB A;  4P9S A;  1B8S A;  4C3Y A;  3ICS A;  2B9X A;  2BC0 A;  3AAY A;  1F8W A;  1FEC A;  3I2V A;  3AEB A;  3NT6 A;  4RG3 A;  1D5T A;  1O5W A;  2R4J A;  3EF6 A;  4YTM A;  2BK4 A;  3HIX A;  2YLT A;  2C66 A;  1GRH A;  3HWI A;  3LAD A;  3HYX A;  4ZCD A;  2Y6Q A;  4A6N B;  5JCN A;  1PJ7 A;  2EG3 A;  2WES A;  3GSI A;  1XPQ A;  3RNM A;  3EPT A;  3VR8 A;  2EG4 A;  1GAL A;  1GTH A;  2R46 A;  3AD9 B;  3AE8 A;  3SXI A;  3P4S A;  4H4U A;  3OP3 A;  2ZZB A;  3NHO X;  5HYM A;  3AYJ A;  3L1R A;  1H86 A;  2TPR A;  4EIQ A;  1FEB A;  3AE7 A;  4YSZ A;  2XVJ A;  1E7P A;  3AE6 A;  2C67 A;  2FJE A;  3NYC A;  1Z6L A;  4EQW A;  5LAO A;  3PS9 A;  1IUV A;  1NHS A;  1ZK7 A;  4LA1 A;  3BI5 A;  2BYB A;  1CC4 A;  1GRF A;  4GR1 A;  4B69 A;  4B64 A;  3CN8 A;  3TG1 B;  4C74 A;  4CNJ A;  3OLH A;  1JOA A;  1ONF A;  3S5W A;  3T2K A;  1RYI A;  3H8L A;  1PN0 A;  2A8X A;  3IWA A;  2Q82 A;  5JCL A;  4GDP A;  1YQZ A;  4REK A;  3UOV A;  4II3 A;  2C7G A;  3CGB A;  2GEW A;  3GD4 A;  2W0H A;  3AXB A;  1IUS A;  3CNJ A;  3HYW A;  3NNE A;  3B6D A;  5KRQ A;  4ZN0 A;  4J56 A;  3SZC A;  3SGL A;  2WU5 A;  1ZX9 A;  4GAV A;  2OLN A;  3R2U A;  1PXC A;  3O3W A;  4F67 A;  2XLS A;  4YKG A;  1YT8 A;  1DJQ A;  1ZDL A;  2WDR A;  3GDN A;  2X50 A;  5KOX A;  2Q6U A;  2O9Z A;  3UTF A;  4H7U A;  3LXD A;  1GV4 A;  3GMB A;  4H4W A;  4ICY A;  4NEV A;  4E0V A;  1L9E A;  1TDK A;  2R0G A;  3GDP A;  3AEE A;  3SM8 A;  3CIR A;  2WPF A;  1H7W A;  4J57 A;  1B4V A;  2VQ7 A;  1PBF A;  1PXB A;  2RGJ A;  3AD8 B;  1VQW A;  5HXI A;  3UP4 A;  2GR0 A;  1GER A;  3RP6 A;  2Q0K A;  4GCM A;  1LQT A;  3AWI A;  3UOY A;  4EM3 A;  5HY5 A;  4ZCC A;  1FEA A;  1CJ4 A;  2JB1 A;  5BUL A;  1GTE A;  1NHR A;  1RP0 A;  3G5S A;  5U63 A;  5BUK A;  3GWD A;  1KNP A;  3HZU A;  1E6E A;  1PBC A;  3QSM A;  4GUV A;  4K22 A;  1H4M X;  1TDO A;  1PJ5 A;  3FG2 P;  5EBK A;  5KMP A;  5ER0 A;  2JB2 A;  4J31 A;  2YG6 A;  3H4K A;  4H2P A;  2Z5Y A;  2WLX A;  2XFU A;  1CJ2 A;  2PYX A;  1BZL A;  4H4S A;  4G6G A;  4AOS A;  2YVF A;  3KD9 A;  1K0L A;  3CGE A;  2BCG G;  3CGD A;  4Y4M A;  5J60 A;  5LAM A;  1IUU A;  1Y56 A;  3BI4 A;  1ZOY A;  4U8N A;  3UTN X;  2YWL A;  2YLW A;  1PBE A;  2AQJ A;  5HHF A;  5FS7 A;  3UKA A;  4A5L A;  4Z43 A;  2JTQ A;  1B37 A;  4G9K A;  1ZOV A;  4X9N A;  2GR3 A;  1YMD A;  4TM0 A;  3ISH A;  2YLZ A;  2EQ8 A;  1PBB A;  4O5Q A;  1L9D A;  4B65 A;  1CC2 A;  2JB3 A;  3COX A;  4H4T A;  4BK3 A;  3F8D A;  1PBD A;  3D1P A;  2WOV A;  1EL8 A;  2VVL A;  3NYF A;  3QFA A;  4H4P A;  3NN6 X;  3RHA A;  4YTN A;  4OPT A;  3T2Y A;  1GET A;  2QA1 A;  4H2R A;  1PS9 A;  4I59 A;  2AR8 A;  3BHK A;  2NVK X;  2A89 A;  2FJD A;  1EL5 A;  1YQ4 A;  2BS2 A;  5FMH A;  1HYU A;  3CTY A;  5KVH A;  1OJ9 A;  4JNQ A;  1JRZ A;  4Y4L A;  3I3U A;  1ZMC A;  3KPF A;  4A9W A;  4TM4 A;  1YMK A;  2OUC A;  2R0C A;  4U8J A;  3KPK A;  3K9R A;  3TG3 A;  4J2W A;  4TLZ A;  1XAN A;  3MZZ A;  4JDR A;  3WE0 A;  3GYJ A;  4EQS A;  5M10 A;  4JGT A;  2WU2 A;  3VR9 A;  3DJD A;  1E39 A;  2E1M A;  2XLU A;  3EAO A;  3QVP A;  4RG4 A;  4YXD A;  2BRA A;  2GQF A;  3SFD A;  3HYV A;  4CY8 A;  3F8R A;  1NDA A;  4YWO A;  3AYI A;  2CFY A;  3EAN A;  4RSL A;  2WEU A;  5HBQ A;  3AEA A;  3NLC A;  1YM9 A;  3VRB A;  4AT2 A;  2YLX A;  3B3R A;  1GRA A;  5BVA A;  2IFD A;  4CCQ A;  5EB4 A;  1GSN A;  4OPG A;  1E1N A;  3RP8 A;  2YAU A;  5FS8 A;  5IQ1 A;  3ZDN A;  2DKI A;  4DGK A;  4IVO B;  3UKH A;  1C25 A;  4XXG A;  1LV0 A;  4GF7 A;  2XFP A;  4NNJ A;  4D04 A;  4UP3 A;  1RHS A;  3D1C A;  1D4E A;  4J34 A;  3SZF A;  1LPF A;  3UCL A;  3ATQ A;  3SFE A;  5IPY A;  4OPC A;  1S2Y A;  2DCQ A;  1GRG A;  5HBL A;  1YKJ A;  3QSE A;  3T0K A;  5KWF A;  2ORA A;  1E1M A;  3DJG X;  5FS6 A;  3K7M X;  3AE9 A;  3ITJ A;  2WET A;  1VG9 A;  2JK6 A;  3O0H A;  4CBQ A;  4BUR A;  2E4G A;  2R9Z A;  1H4K X;  1IUT A;  1COY A;  2GB0 A;  3KU9 A;  2FJA A;  1E0C A;  5LV9 A;  2ZZC A;  3P1W A;  3P4Q A;  4H4V A;  4UDP A;  1AOG A;  1UAR A;  3DK9 A;  4U8M A;  2RGH A;  1NG4 A;  3ALL A;  2VZ2 A;  3UOZ A;  4A7A A;  2CUL A;  2YM2 A;  4A79 A;  2XFQ A;  2WHD A;  3DK8 A;  3K7T A;  4X9M A;  1Q9I A;  4M52 A;  1BWC A;  1RHD A;  1LVL A;  2Q0L A;  1FL2 A;  2EQ9 A;  1GPE A;  3LZX A;  5CQF A;  5EB5 A;  1IUW A;  2UZQ A;  1BOH A;  1K0J A;  1N1P A;  1NG3 A;  1TDF A;  2V60 A;  5KMQ A;  2YR4 A;  2J6P A;  2R0P A;  4G74 A;  4U2L A;  2V61 A;  3FOJ A;  3NTD A;  1QLB A;  4OVI A;  4USQ A;  3SYI A;  5DBJ A;  5GRT A;  4AT0 A;  2MOI A;  1BGJ A;  2CDU A;  3K7Q X;  4H4R A;  3RP7 A;  1GEU A;  1H81 A;  1OJT A;  1Q1W A;  2Q7V A;  2B9Y A;  3AD7 B;  3DME A;  3Q6J A;  4LII A;  5KVI A;  3NGC X;  4A6N A;  3DH9 A;  1UKV G;  2E5V A;  3AE1 A;  1WV9 A;  2WOI A;  1O95 A;  4X4J A;  2GRT A;  1PJ6 A;  3FS5 A;  2BAC A;  2J3N A;  3IWH A;  3GRS A;  1BF3 A;  3HZL A;  4USR A;  4WH9 A;  2BXS A;  4EMJ A;  2X8C A;  4NWZ A;  1CWR A;  1BGN A;  4FDC B;  3ZYX A;  4Z2U A;  1GRB A;  1TYT A;  2WP9 A;  4EMI A;  1Y56 B;  3DA1 A;  3LZW A;  4GRT A;  4YSY A;  4Z2R A;  1ZMD A;  5KNL A;  4H4X A;  2IVD A;  3ILM A;  2IID A;  5CKU A;  3TP9 A; 
#chains in the Genus database with same CATH homology
 3UKF A;  1GT8 A;  1JU2 A;  3UTH A;  3FBS A;  2IFV A;  2BC1 A;  3FLH A;  4G73 A;  3UTE A;  3G5Q A;  3AB1 A;  4AP3 A;  3NK1 X;  4EQX A;  3NH3 X;  3OC4 A;  3G5J A;  3DJJ A;  1HZM A;  2JTR A;  1ELI A;  4UDQ A;  3V3O A;  2UZZ A;  3ADA B;  1URH A;  1ORB A;  4UDR A;  4Z44 A;  4A65 A;  2YR6 A;  2WS3 A;  3AEC A;  4PAA A;  2GV8 A;  2JBV A;  4H2N A;  4WCT A;  2APG A;  2R45 A;  3G5R A;  5M0Z A;  5BRT A;  5L46 A;  3E1T A;  5HBO A;  1W4X A;  3BNM A;  1CHU A;  1LJ1 A;  2XFN A;  2YVG A;  5GSN A;  1KF6 A;  1S3B A;  3C4N A;  5EOW A;  3BI2 A;  3SX6 A;  2DKH A;  2C73 A;  5U1O A;  2JKC A;  3AE5 A;  4C3X A;  4CRT A;  2MRM A;  1T3K A;  1BKW A;  4APN A;  3NN0 X;  3UP5 A;  1QXN A;  3KLJ A;  1XDI A;  2GMJ A;  3I6D A;  3IF9 A;  2OAL A;  3RED A;  3AE3 A;  1L0V A;  3QSS A;  3GMC A;  2VRM A;  1RSG A;  2JAE A;  4LU6 A;  2C4C A;  2QCU A;  4EIP A;  4I58 A;  4U8O A;  2XLT A;  3P3A A;  3SQP A;  2XYO A;  4BJZ A;  1S2Q A;  1KNR A;  1NHQ A;  4U8L A;  3S61 A;  1H7X A;  1E1L A;  2IVE A;  2V3A A;  1N4V A;  3AED A;  3AYL A;  2BCP A;  4GDE A;  1DJN A;  5C2T A;  4H4Z A;  4J36 A;  2XLR A;  2YVJ A;  1SEZ A;  3C96 A;  2C64 A;  1NHP A;  4HA6 A;  5JCK A;  2EG4 B;  5HPA A;  1CC6 A;  2HQM A;  3NTA A;  2Z5X A;  1GOS A;  3DGH A;  3KVE A;  3NK0 X;  1GMX A;  3ALJ A;  4NZH A;  3CPI G;  4U8K A;  3NRN A;  3GWF A;  4K5R A;  3JSK A;  1OKG A;  4NTC A;  2V6O A;  3UKP A;  1GN0 A;  2YG3 A;  3PO7 A;  4C5O A;  2OAM A;  1O94 A;  3M12 A;  1PHH A;  1F3P A;  2YG5 A;  2H88 A;  2X99 A;  4U2S A;  1H84 A;  2YG4 A;  1GRT A;  3FMW A;  1ZKQ A;  1V59 A;  2K0Z A;  2Y6R A;  1EL9 A;  3I3L A;  3UTG A;  1M6I A;  3T31 A;  1QB0 A;  2X8G A;  3IC9 A;  1OJD A;  4DSG A;  2GQW A;  2WOW A;  3F4A A;  4OPI A;  1BOI A;  1CWT A;  1YQ3 A;  3GD3 A;  2WP5 A;  4NTE A;  3SZW A;  3DJE A;  4FK1 A;  2BAB A;  3CND A;  2H89 A;  2BK3 A;  4A99 A;  3NIX A;  1CJ3 A;  1YS0 A;  3DGZ A;  1VDC A;  4K8D A;  3M0O A;  4Z25 A;  3UKK A;  4KPR A;  1GRE A;  2JTS A;  3QJ4 A;  2C3C A;  2BS4 A;  5KOW A;  2MOL A;  2HHG A;  3T37 A;  1VEE A;  4WX1 A;  3SZ0 A;  4JY2 A;  4AOX A;  2ACZ A;  1M64 A;  1K4Q A;  2EQ6 A;  4K7Z A;  4FX9 A;  1GES A;  2YG7 A;  4TM3 A;  3IPP A;  2XCG A;  3R9U A;  4IA5 A;  3UKL A;  1S3E A;  4U8P A;  3PVC A;  1CJC A;  1B5Q A;  1H82 A;  1H6V A;  4GAP A;  3CPJ G;  3UOX A;  3VQR A;  1F8R A;  3P9U A;  1Q1R A;  2FBW A;  2NPX A;  1CF3 A;  1E1K A;  1TDN A;  3DK4 A;  2GR2 A;  3AEG A;  4PAB A;  1QJD A;  3ICT A;  1IJH A;  2XLP A;  4XWR A;  3CNS A;  2GMH A;  2XDO A;  3NG7 X;  1FOH A;  3BHF A;  1TDE A;  4MJW A;  1N4W A;  1GXF A;  3LOV A;  2C72 A;  4XWZ A;  2B76 A;  2KL3 A;  4II2 A;  3SY4 A;  4H4Q A;  3URH A;  2WPE A;  2ZZ0 A;  2F5Z A;  3C4A A;  2X3N A;  1XHC A;  1VG0 A;  3OZ2 A;  4CNK A;  2FJB A;  3QFB A;  4OPD A;  1D7L A;  5C3J A;  1LTX R;  1PXA A;  1TYP A;  1P2H A;  1DOE A;  2BXR A;  2CVJ A;  2QA2 A;  3BNU A;  1GND A;  3AE4 A;  3AEF A;  2R4E A;  1PDH A;  4NTD A;  4Y4N A;  1H83 A;  1TRB A;  3K30 A;  1DNC A;  3NHV A;  2WDQ A;  1REO A;  3QVR A;  4H4Y A;  2BA9 A;  4OCG A;  3CNT A;  3NKS A;  4WH7 A;  1DOD A;  1QO8 A;  2YM1 A;  3KA7 A;  1ZY8 A;  4OPU A;  2BS3 A;  5FS9 A;  2XVF A;  1NPX A;  2VSW A;  3FIM B;  5J7X A;  1MO9 A;  4B67 A;  2ZBW A;  1FCD A;  4O5U A;  5HBP A;  2EQ7 A;  3H8I A;  2GWF A;  2BRY A;  2YR5 A;  4OPL A;  1OJA A;  1X31 B;  2VOU A;  1JRY A;  1KDG A;  1DXL A;  3FNJ A;  3ALM A;  1OJC A;  3LB8 A;  4H50 A;  1D7Y A;  2GR1 A;  4NEW A;  4Z24 A;  3T14 A;  2X8H A;  5TR3 A;  3GYI A;  1NEN A;  4B66 A;  3LJP A;  1DOC A;  1N4U A;  4JN9 A;  3VRA A;  4G6H A;  2VQB A;  2VVM A;  3CMM A;  4YT0 A;  2XVH A;  1MOK A;  4IV9 A;  4K2X A;  2C3D A;  3AE2 A;  2XFO A;  2B7S A;  2C75 A;  3FPZ A;  4J33 A;  1CWS A;  1YML A;  3ATR A;  4EMW A;  2PHH A;  1KSS A;  1L9C A;  2C70 A;  4C77 A;  2YLR A;  3IHG A;  4TM1 A;  2WBA A;  1KFY A;  4B63 A;  1DOB A;  4FK1 C;  1K0I A;  3T2Z A;  4HB9 A;  2A2K A;  4DNA A;  4YTP A;  4BJY A;  4EM4 A;  5KMR A;  2XVI A;  4IA6 A;  3IHM A;  5KXJ A;  4KX6 A;  1DP2 A;  2V5Z A;  2A87 A;  1NEK A;  1NAA A;  2GAG B;  3D8X A;  1Y0P A;  4ADW A;  4JY3 A;  4B1B A;  4Z2T A;  4U2T A;  1CL0 A;  3V3N A;  3L8K A;  3NYE A;  4BV6 A;  2YLS A;  2YQU A;  3P4P A;  4AP1 A;  5KMS A;  2GH5 A;  2FSX A;  2GF3 A;  1TQ1 A;  1F6M A;  3UKQ A;  2WLR A;  1YY5 A;  1JEH A;  3KKJ A;  4JQ9 A;  3AAX A;  1P2E A;  2BK5 A;  5JCI A;  1VRQ B;  4CCR A;  5JCM A;  3ABV A;  3CPH G;  2TMD A;  3GRT A;  3V76 A;  4EQR A;  1ZP0 A;  3NK2 X;  3GYX A;  4YKF A;  1D4D A;  1JNR A;  2VRL A;  3II4 A;  4YSX A;  5U25 A;  4K5S A;  2GAH B;  1EL7 A;  1D4C A;  1IUX A;  2AAQ A;  2WDV A;  2VVL G;  3Q9T A;  4IVM B;  4TLX A;  4DSH A;  4U8I A;  3GK5 A;  4BK2 A;  1LQU A;  3CGC A;  4YSH A;  2B9W A;  1JRX A;  2OA1 A;  2GVC A;  2V3B A;  2RGO A;  2WP6 A;  4JNA A;  4Z26 A;  4N9X A;  1WHB A;  2OLO A;  1MXT A;  2I0Z A;  2XVE A;  3IPO A;  3P4R A;  2ARD A;  2WQY A;  4H2Q A;  1EBD A;  1KSU A;  2C65 A;  2WPC A;  3M13 A;  4CY6 A;  4BK1 A;  2B7R A;  3ICR A;  2QAE A;  4D03 A;  1JNZ A;  3F8P A;  5IQ4 A;  2C76 A;  3VRD B;  3CNP A;  4B68 A;  1F8S A;  4ECH A;  1CBO A;  2RAB A;  4P9S A;  1B8S A;  4C3Y A;  3ICS A;  2B9X A;  2BC0 A;  3AAY A;  1F8W A;  1FEC A;  3I2V A;  3AEB A;  3NT6 A;  4RG3 A;  1D5T A;  1O5W A;  2R4J A;  3EF6 A;  4YTM A;  2BK4 A;  3HIX A;  2YLT A;  2C66 A;  1GRH A;  3HWI A;  3LAD A;  3HYX A;  4ZCD A;  2Y6Q A;  4A6N B;  5JCN A;  1PJ7 A;  2EG3 A;  2WES A;  3GSI A;  1XPQ A;  3RNM A;  3EPT A;  3VR8 A;  2EG4 A;  1GAL A;  1GTH A;  2R46 A;  3AD9 B;  3AE8 A;  3SXI A;  3P4S A;  4H4U A;  3OP3 A;  2ZZB A;  3NHO X;  5HYM A;  3AYJ A;  3L1R A;  1H86 A;  2TPR A;  4EIQ A;  1FEB A;  3AE7 A;  4YSZ A;  2XVJ A;  1E7P A;  3AE6 A;  2C67 A;  2FJE A;  3NYC A;  1Z6L A;  4EQW A;  5LAO A;  3PS9 A;  1IUV A;  1NHS A;  1ZK7 A;  4LA1 A;  3BI5 A;  2BYB A;  1CC4 A;  1GRF A;  4GR1 A;  4B69 A;  4B64 A;  3CN8 A;  3TG1 B;  4C74 A;  4CNJ A;  3OLH A;  1JOA A;  1ONF A;  3S5W A;  3T2K A;  1RYI A;  3H8L A;  1PN0 A;  2A8X A;  3IWA A;  5JCL A;  4GDP A;  1YQZ A;  4REK A;  3UOV A;  4II3 A;  2C7G A;  3CGB A;  2GEW A;  3GD4 A;  2W0H A;  3AXB A;  1IUS A;  3CNJ A;  3HYW A;  3NNE A;  3B6D A;  5KRQ A;  4ZN0 A;  4J56 A;  3SZC A;  3SGL A;  2WU5 A;  1ZX9 A;  4GAV A;  2OLN A;  3R2U A;  1PXC A;  3O3W A;  4F67 A;  2XLS A;  4YKG A;  1YT8 A;  1DJQ A;  1ZDL A;  2WDR A;  3GDN A;  2X50 A;  5KOX A;  2Q6U A;  2O9Z A;  3UTF A;  4H7U A;  3LXD A;  1GV4 A;  3GMB A;  4H4W A;  4ICY A;  4NEV A;  4E0V A;  1L9E A;  1TDK A;  2R0G A;  3GDP A;  3AEE A;  3SM8 A;  3CIR A;  2WPF A;  1H7W A;  4J57 A;  1B4V A;  2VQ7 A;  1PBF A;  1PXB A;  2RGJ A;  3AD8 B;  1VQW A;  5HXI A;  3UP4 A;  2GR0 A;  1GER A;  3RP6 A;  2Q0K A;  4GCM A;  1LQT A;  3AWI A;  3UOY A;  4EM3 A;  5HY5 A;  4ZCC A;  1FEA A;  1CJ4 A;  2JB1 A;  5BUL A;  1GTE A;  1NHR A;  1RP0 A;  3G5S A;  5U63 A;  5BUK A;  3GWD A;  1KNP A;  3HZU A;  1E6E A;  1PBC A;  3QSM A;  4GUV A;  4K22 A;  1H4M X;  1TDO A;  1PJ5 A;  3FG2 P;  5EBK A;  5KMP A;  5ER0 A;  2JB2 A;  4J31 A;  2YG6 A;  3H4K A;  4H2P A;  2Z5Y A;  2WLX A;  2XFU A;  1CJ2 A;  2PYX A;  1BZL A;  4H4S A;  4G6G A;  4AOS A;  2YVF A;  3KD9 A;  1K0L A;  3CGE A;  2BCG G;  3CGD A;  4Y4M A;  5J60 A;  5LAM A;  1IUU A;  1Y56 A;  3BI4 A;  1ZOY A;  4U8N A;  3UTN X;  2YWL A;  2YLW A;  1PBE A;  2AQJ A;  5HHF A;  5FS7 A;  3UKA A;  4A5L A;  4Z43 A;  2JTQ A;  1B37 A;  4G9K A;  1ZOV A;  4X9N A;  2GR3 A;  1YMD A;  4TM0 A;  3ISH A;  2YLZ A;  2EQ8 A;  1PBB A;  4O5Q A;  1L9D A;  4B65 A;  1CC2 A;  2JB3 A;  3COX A;  4H4T A;  4BK3 A;  3F8D A;  1PBD A;  3D1P A;  2WOV A;  1EL8 A;  2VVL A;  3NYF A;  3QFA A;  4H4P A;  3NN6 X;  3RHA A;  4YTN A;  4OPT A;  3T2Y A;  1GET A;  2QA1 A;  4H2R A;  1PS9 A;  4I59 A;  2AR8 A;  3BHK A;  2NVK X;  2A89 A;  2FJD A;  1EL5 A;  1YQ4 A;  2BS2 A;  5FMH A;  1HYU A;  3CTY A;  5KVH A;  1OJ9 A;  4JNQ A;  1JRZ A;  4Y4L A;  3I3U A;  1ZMC A;  3KPF A;  4A9W A;  4TM4 A;  1YMK A;  2OUC A;  2R0C A;  4U8J A;  3KPK A;  3K9R A;  3TG3 A;  4J2W A;  4TLZ A;  1XAN A;  3MZZ A;  4JDR A;  3WE0 A;  3GYJ A;  4EQS A;  5M10 A;  4JGT A;  2WU2 A;  3VR9 A;  3DJD A;  1E39 A;  2E1M A;  2XLU A;  3EAO A;  3QVP A;  4RG4 A;  4YXD A;  2BRA A;  2GQF A;  3SFD A;  3HYV A;  4CY8 A;  3F8R A;  1NDA A;  4YWO A;  3AYI A;  2CFY A;  3EAN A;  4RSL A;  2WEU A;  5HBQ A;  3AEA A;  3NLC A;  1YM9 A;  3VRB A;  4AT2 A;  2YLX A;  3B3R A;  1GRA A;  5BVA A;  2IFD A;  4CCQ A;  5EB4 A;  1GSN A;  4OPG A;  1E1N A;  3RP8 A;  2YAU A;  5FS8 A;  5IQ1 A;  3ZDN A;  2DKI A;  4DGK A;  4IVO B;  3UKH A;  1C25 A;  4XXG A;  1LV0 A;  4GF7 A;  2XFP A;  4NNJ A;  4D04 A;  4UP3 A;  1RHS A;  3D1C A;  1D4E A;  4J34 A;  3SZF A;  1LPF A;  3UCL A;  3ATQ A;  3SFE A;  5IPY A;  4OPC A;  1S2Y A;  2DCQ A;  1GRG A;  5HBL A;  1YKJ A;  3QSE A;  3T0K A;  5KWF A;  2ORA A;  1E1M A;  3DJG X;  5FS6 A;  3K7M X;  3AE9 A;  3ITJ A;  2WET A;  1VG9 A;  2JK6 A;  3O0H A;  4CBQ A;  4BUR A;  2E4G A;  2R9Z A;  1H4K X;  1IUT A;  1COY A;  2GB0 A;  3KU9 A;  2FJA A;  1E0C A;  5LV9 A;  2ZZC A;  3P1W A;  3P4Q A;  4H4V A;  4UDP A;  1AOG A;  1UAR A;  3DK9 A;  4U8M A;  2RGH A;  1NG4 A;  3ALL A;  2VZ2 A;  3UOZ A;  4A7A A;  2CUL A;  2YM2 A;  4A79 A;  2XFQ A;  2WHD A;  3DK8 A;  3K7T A;  4X9M A;  1Q9I A;  4M52 A;  1BWC A;  1RHD A;  1LVL A;  2Q0L A;  1FL2 A;  2EQ9 A;  1GPE A;  3LZX A;  5CQF A;  5EB5 A;  1IUW A;  2UZQ A;  1BOH A;  1K0J A;  1N1P A;  1NG3 A;  1TDF A;  2V60 A;  5KMQ A;  2YR4 A;  2J6P A;  2R0P A;  4G74 A;  4U2L A;  2V61 A;  3FOJ A;  3NTD A;  1QLB A;  4OVI A;  4USQ A;  3SYI A;  5DBJ A;  5GRT A;  4AT0 A;  2MOI A;  1BGJ A;  2CDU A;  3K7Q X;  4H4R A;  3RP7 A;  1GEU A;  1H81 A;  1OJT A;  1Q1W A;  2Q7V A;  2B9Y A;  3AD7 B;  3DME A;  3Q6J A;  4LII A;  5KVI A;  3NGC X;  4A6N A;  3DH9 A;  1UKV G;  2E5V A;  3AE1 A;  1WV9 A;  2WOI A;  1O95 A;  4X4J A;  2GRT A;  1PJ6 A;  3FS5 A;  2BAC A;  2J3N A;  3IWH A;  3GRS A;  1BF3 A;  3HZL A;  4USR A;  4WH9 A;  2BXS A;  4EMJ A;  2X8C A;  4NWZ A;  1CWR A;  1BGN A;  4FDC B;  3ZYX A;  4Z2U A;  1GRB A;  1TYT A;  2WP9 A;  4EMI A;  1Y56 B;  3DA1 A;  3LZW A;  4GRT A;  4YSY A;  4Z2R A;  1ZMD A;  5KNL A;  4H4X A;  2IVD A;  3ILM A;  2IID A;  5CKU A;  3TP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...