3NTAA

Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
565
structure length
565
Chain Sequence
MKKILIIGGVAGGASAAARARRLSETAEIIMFERGEYVSFANCGLPYHISGEIAQRSALVLQTPESFKARFNVEVRVKHEVVAIDRAAKLVTVRRLLDGSEYQESYDTLLLSPGAAPIVPPIPGVDNPLTHSLRNIPDMDRILQTIQMNNVEHATVVGGGFIGLEMMESLHHLGIKTTLLELADQVMTPVDREMAGFAHQAIRDQGVDLRLGTALSEVSYQVQTHVASDAAGEDTAHQHIKGHLSLTLSNGELLETDLLIMAIGVRPETQLARDAGLAIGELGGIKVNAMMQTSDPAIYAVGDAVEEQDFVTGQACLVPLAGPANRQGRMAADNMFGREERYQGTQGTAICKVFDLAVGATGKNEKQLKQAGIAFEKVYVHTASHASYYPGAEVVSFKLLFDPVKGTIFGAQAVGKDGIDKRIDVMAVAQRAGMTVEQLQHLELSYAPPYGSAKDVINQAAFVASNIIKGDATPIHFDQIDNLSEDQLLLDVRNPGELQNGGLEGAVNIPVDELRDRMHELPKDKEIIIFCQVGLRGNVAYRQLVNNGYRARNLIGGYRTYKFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization of an NADH-Dependent Persulfide Reductase from Shewanella loihica PV-4: Implications for the Mechanism of Sulfur Respiration via FAD-Dependent Enzymes .
pubmed doi rcsb
source organism Shewanella loihica
molecule tags Oxidoreductase
molecule keywords FAD-dependent pyridine nucleotide-disulphide oxidoreductase
total genus 162
structure length 565
sequence length 565
chains with identical sequence B
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2010-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3ntaA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ntaA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ntaA01
2VVLG 1N1PA 2X8HA 2XLRA 1E39A 2XVFA 2XYOA 5KVIA 4K8DA 5GRTA 2YM1A 1GN0A 1E1MA 1NG3A 4H2QA 4H50A 3OLHA 1CJCA 4A7AA 1GV4A 4Z24A 3RP8A 2WPEA 3UOZA 3HIXA 2GAHB 4Y4NA 3RNMA 4A9WA 2ZZ0A 1YQ3A 1E1NA 4K7ZA 2Q7VA 2C72A 1CWRA 3GDPA 1L9EA 4LIIA 4B1BA 2C66A 3IPOA 4GDEA 2CDUA 1GEUA 2YG7A 3KD9A 3P9UA 3UKQA 1TDNA 2YG6A 3NN6X 1L0VA 1Q9IA 2V60A 1TYTA 1YT8A 1E1LA 3ICSA 3C4AA 3VR9A 1DJQA 2EQ6A 1PXCA 4Z2UA 4K2XA 4OPTA 1BGNA 3DJEA 1FCDA 2XVIA 2GVCA 2YG4A 2XVHA 1D4DA 3NTDA 3ZYXA 2OUCA 1L9CA 2YLZA 2RGOA 4H4ZA 5M0ZA 1NDAA 1FOHA 4U2TA 1GTHA 3AEGA 2EQ7A 4GUVA 4B68A 2GH5A 1EBDA 1PXBA 2YG5A 1YKJA 1K0JA 1DOEA 1E6EA 5J7XA 4AOSA 3NN0X 4FK1A 3R9UA 2WU5A 3AD7B 2J6PA 2BS2A 2YG3A 3LB8A 1E7PA 1OJDA 1RP0A 1NAAA 4U8NA 2BC0A 2DKIA 3KKJA 1ZOVA 3OZ2A 2W0HA 2DCQA 2Q0LA 1JRZA 1PBDA 2IIDA 3G5JA 1IUVA 3DK9A 3CGBA 4WH9A 1CBOA 2BCGG 1X31B 3ISHA 2C65A 3GWFA 2UZQA 4Z44A 2VSWA 3UKAA 1GALA 2Z5YA 1D5TA 4EQWA 3DK8A 4D03A 5CQFA 1H84A 3RP7A 4X4JA 3ABVA 1D4EA 3NHOX 4N9XA 4AT2A 1H4KX 2XLTA 1BF3A 4PAAA 4CBQA 4Y4LA 2HQMA 3UTEA 1F3PA 2XVJA 3C96A 4JY2A 4EM4A 4ZN0A 4X9MA 4Z26A 2MOIA 1CC2A 2MRMA 3LXDA 3CPHG 3LADA 4Z25A 2JTSA 1NG4A 3AE3A 4DSHA 3PO7A 5KXJA 4A6NA 3L1RA 4GF7A 2B9XA 4H4SA 1K0IA 4OPLA 2H89A 2WP5A 2E4GA 1LV0A 4Z2RA 3FS5A 4WH7A 1D4CA 4AP1A 1V59A 2RGJA 1JEHA 3HZLA 1TDOA 1NHSA 2WDVA 1JNZA 3IHMA 2XLSA 4Z2TA 2JBVA 3KLJA 4P9SA 3UKKA 1VG9A 1DP2A 1MO9A 1OJ9A 2R0CA 3UKPA 1FECA 3LJPA 4J33A 4H2PA 4H4YA 4H4TA 2VRMA 2EG3A 3Q9TA 1EL8A 4I59A 1UARA 4U2LA 1IUSA 3UKHA 3GD4A 3NK1X 3SFDA 1W4XA 2BA9A 2C76A 4GR1A 3C4NA 3UKLA 2TMDA 2FJEA 1N4UA 2JAEA 1DOBA 3NG7X 2WS3A 3BI5A 3PVCA 1GSNA 1Q1WA 4DNAA 3NTAA 1ELIA 1MOKA 2MOLA 1O5WA 2XFOA 3G5SA 2Z5XA 1COYA 2CULA 4XWZA 3CNDA 4APNA 3L8KA 2AR8A 1VG0A 2XFUA 4U8PA 5IQ4A 3BI4A 4AP3A 1PBBA 3BNMA 4H4RA 1H86A 3ADAB 1XHCA 2FJAA 3T37A 1LJ1A 3IHGA 1UKVG 2GB0A 3AEAA 1KFYA 4OPGA 4CY6A 2IVDA 1TYPA 1URHA 4ZCCA 3R2UA 3SFEA 4Z43A 3RP6A 1LTXR 1WV9A 2X8CA 5BRTA 3B6DA 3NH3X 1IUTA 1GRHA 4DSGA 3GDNA 4B64A 1GNDA 3VRAA 2HHGA 1OJAA 1OJTA 3VRBA 1Y56A 2QA2A 3AE2A 1TDFA 4IVOB 3ICRA 2IFVA 4NZHA 3AWIA 2AAQA 2GMJA 3UP4A 2XFQA 2GR1A 3AYJA 4H4UA 3CN8A 5C3JA 1T3KA 1CWTA 1PJ5A 3NHVA 3KVEA 3AE9A 3AAXA 3TG3A 3D1PA 1IUWA 2FJBA 3AE7A 2Q6UA 4ICYA 4X9NA 3UP5A 3AD8B 3IWAA 3AE4A 3LZXA 4YSHA 4U8OA 4AT0A 4EQRA 1YMLA 2APGA 3NYEA 1EL9A 2YLSA 2B9YA 5HBQA 3AE8A 5ER0A 3GK5A 1IUUA 3D8XA 3QJ4A 1F8WA 4UDPA 5FS7A 4YTMA 2WDRA 2OAMA 1S2QA 3UOXA 5IQ1A 4FDCB 1GRFA 2YR5A 1PJ7A 2XLUA 3FLHA 1GT8A 2EQ9A 4WX1A 4C5OA 3QSSA 4LA1A 3DGZA 4IV9A 5C2TA 4ECHA 4YKGA 4A79A 2R0PA 2YR6A 1PBCA 1Y56B 2IVEA 1N4VA 3M13A 1H7WA 1BGJA 2WEUA 3URHA 2KL3A 2NVKX 4CCRA 3UTNX 2GQFA 3GRSA 1B8SA 1GETA 1H81A 4H2RA 1XANA 1L9DA 4H4PA 4U8IA 2R0GA 1NHRA 1VRQB 5HXIA 1GRBA 3CIRA 3P4SA 2R4JA 3S61A 3SM8A 2VRLA 4H4QA 5JCKA 4J31A 2FBWA 2BABA 4M52A 3OP3A 4RG4A 4EMJA 3VQRA 4A5LA 1H82A 3KU9A 4IA6A 4U8JA 3NLCA 4NTCA 1GMXA 1N4WA 3EANA 5U63A 1AOGA 3UOVA 1KNRA 2I0ZA 4J34A 4BURA 1FEAA 2ZBWA 5EBKA 1DNCA 1PXAA 2C3CA 4EQSA 2C64A 3QSMA 5J60A 3DGHA 3NK0X 3F8RA 1F8SA 3IC9A 1GREA 5HPAA 3CNJA 1ZX9A 2GF3A 2J3NA 4NTDA 2WOVA 1Y0PA 2BC1A 5IPYA 3AE1A 4B65A 4EMWA 3FBSA 2B7SA 1DOCA 4J2WA 1KNPA 1TDEA 4RSLA 3GYJA 4TM4A 3QFBA 2WOIA 1DJNA 4B69A 5FS6A 1EL5A 2XFPA 5JCLA 1JRXA 3NT6A 4AOXA 2QAEA 2GEWA 2XVEA 3P4QA 4H4WA 1PJ6A 1B5QA 4E0VA 2B9WA 3BNUA 1KDGA 1H4MX 2B76A 2YLRA 4GDPA 4ZCDA 1B37A 2BK3A 1Q1RA 2PHHA 3TP9A 1YM9A 1ZMDA 5DBJA 4A6NB 4NEVA 2WETA 2IFDA 2V3BA 1PN0A 3AEBA 2AQJA 3O0HA 2K0ZA 1ZKQA 3AAYA 2YVJA 1GXFA 2C73A 1VQWA 2VQ7A 3AE5A 1GPEA 5HBLA 2VVMA 2O9ZA 2GRTA 2BYBA 3FNJA 3GMBA 4C3XA 4YSYA 3CPJG 3B3RA 2XLPA 3GWDA 5KOXA 1GRGA 2QA1A 5FS8A 3AD9B 2XDOA 1LQTA 4TM3A 4BV6A 4C77A 3ATRA 5HBOA 5FMHA 1IUXA 3TG1B 1JRYA 3K30A 4USQA 1KF6A 4I58A 2BS3A 2WU2A 1REOA 1FEBA 1PDHA 1DXLA 3QSEA 3RHAA 1S3EA 3F8PA 3GD3A 2X50A 4YTNA 3AEEA 2GR3A 3ALJA 3H8LA 4OPCA 1ZDLA 3FG2P 4ADWA 4RG3A 1JOAA 2X3NA 1NEKA 2JTQA 1YS0A 4BK3A 2ZZCA 5TR3A 4JY3A 1RYIA 1YQZA 2ACZA 2GWFA 1NENA 4H2NA 4OPIA 1S3BA 4Y4MA 3KA7A 4U8MA 5HY5A 2F5ZA 5KOWA 2X8GA 1MXTA 2YAUA 1BKWA 5GSNA 1RSGA 1IJHA 1LQUA 1RHDA 4J57A 2C67A 2BXSA 2C7GA 3ICTA 2VVLA 1NHQA 1ZP0A 5EB5A 3ITJA 2WPFA 1BOHA 4H4XA 4EIPA 1D7YA 3P3AA 4JNAA 4UDRA 4FK1C 3BI2A 5BVAA 2WESA 4USRA 3P4PA 2YR4A 1CC4A 1O94A 3ALLA 1H6VA 4B63A 3AYLA 2YQUA 3DK4A 1ZOYA 4UP3A 3HZUA 1GERA 1JU2A 3OC4A 3GSIA 3SGLA 3UOYA 4EQXA 1ZY8A 2GV8A 3ILMA 2VZ2A 3NGCX 1YMDA 2Y6QA 1M6IA 2GQWA 5HYMA 3AYIA 1OKGA 2A87A 3CNTA 3DJJA 1H7XA 3AEDA 4PABA 3NIXA 4HA6A 5JCMA 1P2EA 3E1TA 5JCNA 2CFYA 5LV9A 1YMKA 2OLNA 3S5WA 1GESA 2GR2A 3NYFA 2RABA 1YQ4A 2WQYA 5LAOA 1TRBA 2BK4A 4FX9A 1GRAA 4LU6A 4WCTA 4BK2A 5KWFA 4A99A 3NNEA 5U25A 3GRTA 3G5QA 1QO8A 3JSKA 4TM1A 2WPCA 5U1OA 4K5RA 1CC6A 4O5UA 3IPPA 5BUKA 3Q6JA 5HHFA 5KRQA 1CJ3A 4EM3A 1OJCA 2VQBA 4IA5A 3M12A 3UTHA 2OLOA 4YWOA 2JTRA 3I2VA 3DA1A 2WDQA 4OCGA 3GMCA 1O95A 3UTGA 3P1WA 2OA1A 2YVFA 2BK5A 3I6DA 4OPUA 3IF9A 1NHPA 4JN9A 2UZZA 1F8RA 3DH9A 3IWHA 3D1CA 1ORBA 3M0OA 3P4RA 3V3NA 1CJ4A 3CGDA 3H4KA 2A2KA 1QLBA 2V5ZA 1KSUA 3QVRA 2JB3A 3AEFA 3NRNA 4CRTA 1BOIA 5JCIA 2DKHA 2ORAA 1GRTA 1HYUA 5HBPA 1TDKA 3UKFA 2WHDA 4K5SA 1Z6LA 2R46A 1QB0A 4JGTA 1SEZA 3NYCA 4JQ9A 4CY8A 3DJGX 1F6MA 3CGCA 1LVLA 3NK2X 1HZMA 1ZMCA 3FPZA 4MJWA 3UTFA 4BJZA 2Y6RA 3K9RA 4XXGA 1CF3A 1BWCA 4UDQA 3BHKA 4BK1A 4OPDA 3CPIG 1E1KA 4CNJA 3H8IA 4U8LA 1VEEA 2BXRA 2FJDA 2RGHA 4XWRA 2XFNA 2BCPA 3CGEA 4F67A 1XPQA 4D04A 4H4VA 2BS4A 2WBAA 3VRDB 3UCLA 3ZDNA 2CVJA 3AECA 3DMEA 1EL7A 2TPRA 4JDRA 3AB1A 4OVIA 4REKA 1C25A 4O5QA 3EF6A 1B4VA 2A89A 2E5VA 4JNQA 4GCMA 2EG4A 1LPFA 1WHBA 1PBEA 2V61A 3F4AA 3EAOA 4YSZA 2GR0A 2GAGB 3PS9A 2YWLA 4C3YA 3MZZA 2BACA 1K4QA 1QJDA 3EPTA 3NKSA 4A65A 2V3AA 4DGKA 2B7RA 4YKFA 1GTEA 2V6OA 3CTYA 4K22A 2R4EA 1DODA 3II4A 1RHSA 1S2YA 2E1MA 2YLTA 3FIMB 4YSXA 4C74A 1H83A 2FSXA 2GMHA 1FL2A 4GRTA 2JKCA 2QCUA 2VOUA 3G5RA 2OALA 4BJYA 1ONFA 4YT0A 5M10A 1NPXA 2X99A 2XCGA 3FMWA 1CHUA 2EQ8A 4B67A 2WOWA 4NEWA 4NTEA 3V76A 3ATQA 3AE6A 2WP9A 2YLWA 1P2HA 3QFAA 5CKUA 1XDIA 5EB4A 2Q0KA 4U8KA 2A8XA 2WP6A 5FS9A 4TLZA 3K7MX 4TLXA 2JB1A 4B66A 1PBFA 1M64A 3KPFA 3F8DA 1QXNA 3GYIA 3QVPA 4TM0A 2C75A 3BHFA 2R45A 5KVHA 3ALMA 1ZK7A 2YVGA 3SQPA 4HB9A 2EG4B 1JNRA 1E0CA 4YXDA 1PHHA 1TQ1A 2JK6A 2YLXA 3FOJA 4U2SA 1GOSA 2NPXA 3AXBA 4J36A 1CL0A 1D7LA 2C3DA 4CCQA 3VR8A 2PYXA 5L46A 4CNKA 3O3WA 1K0LA 2ARDA 3CNSA 4IVMB 5LAMA 5EOWA 3I3LA 3DJDA 2YM2A 4KPRA 2ZZBA 3CNPA 2H88A 4J56A 2R9ZA 1CJ2A 3LZWA 1VDCA 2WLXA 3REDA 3COXA 3K7TA 3WE0A 4EMIA 2JB2A 3LOVA 1KSSA 2C70A 3K7QX 4KX6A 1PS9A 5BULA 1CWSA 4H7UA 2WLRA 3I3UA 4EIQA 4YTPA 3V3OA 1BZLA 3HWIA 1YY5A
chains in the Genus database with same CATH superfamily
2VVLG 1N1PA 2X8HA 2XLRA 1E39A 2XVFA 2XYOA 3HYVA 4K8DA 5KVIA 5GRTA 2YM1A 1GN0A 1E1MA 1NG3A 4H2QA 4H50A 3OLHA 1CJCA 4A7AA 1GV4A 4Z24A 3RP8A 2WPEA 3UOZA 3HIXA 2GAHB 4Y4NA 3RNMA 4A9WA 2ZZ0A 1YQ3A 1E1NA 4K7ZA 2Q7VA 2C72A 1CWRA 3GDPA 1L9EA 4LIIA 4B1BA 2C66A 3IPOA 4GDEA 2CDUA 1GEUA 2BRYA 2YG7A 3KD9A 3P9UA 3UKQA 1TDNA 2YG6A 3NN6X 1L0VA 1Q9IA 2V60A 1TYTA 3T2KA 1YT8A 1E1LA 3ICSA 3C4AA 3VR9A 1DJQA 2EQ6A 1PXCA 4Z2UA 4K2XA 4OPTA 1BGNA 3DJEA 1FCDA 2XVIA 2GVCA 2YG4A 2XVHA 1D4DA 3NTDA 4G9KA 3ZYXA 2OUCA 1L9CA 2YLZA 2RGOA 4H4ZA 5M0ZA 1NDAA 1FOHA 4U2TA 1GTHA 3AEGA 2EQ7A 4GUVA 4B68A 2GH5A 1EBDA 1PXBA 2YG5A 1YKJA 1K0JA 1DOEA 1E6EA 5J7XA 4AOSA 3NN0X 4FK1A 3R9UA 2WU5A 3AD7B 2J6PA 2BS2A 2YG3A 3LB8A 1E7PA 1OJDA 1RP0A 3SX6A 1NAAA 4U8NA 4II3A 2BC0A 2DKIA 3SZFA 3KKJA 1ZOVA 3HYWA 3OZ2A 2W0HA 5KMRA 2DCQA 2Q0LA 1JRZA 1PBDA 2IIDA 3G5JA 1IUVA 3DK9A 3CGBA 4WH9A 1CBOA 2BCGG 1X31B 3ISHA 2C65A 3GWFA 2UZQA 4Z44A 2VSWA 3UKAA 1GALA 2Z5YA 1D5TA 4EQWA 3DK8A 4D03A 5CQFA 1H84A 3RP7A 4X4JA 3ABVA 1D4EA 3NHOX 4N9XA 4AT2A 1H4KX 2XLTA 1BF3A 4PAAA 4CBQA 4Y4LA 2HQMA 3UTEA 1F3PA 2XVJA 3C96A 4JY2A 4EM4A 4ZN0A 4X9MA 4Z26A 2MOIA 1CC2A 2MRMA 3LXDA 3CPHG 3LADA 4Z25A 2JTSA 1NG4A 3AE3A 4DSHA 3PO7A 5KXJA 4A6NA 3L1RA 4GF7A 2B9XA 4H4SA 1K0IA 4OPLA 2H89A 2WP5A 2E4GA 1LV0A 4Z2RA 3FS5A 4WH7A 1D4CA 4AP1A 1V59A 2RGJA 1JEHA 3HZLA 1TDOA 1NHSA 2WDVA 1JNZA 3IHMA 2XLSA 4Z2TA 2JBVA 3KLJA 4P9SA 3UKKA 1VG9A 1DP2A 1MO9A 1OJ9A 2R0CA 3UKPA 1FECA 3LJPA 4J33A 4H2PA 4H4YA 4H4TA 2VRMA 2EG3A 3Q9TA 1EL8A 4I59A 4NNJA 3SY4A 1UARA 5KMQA 4U2LA 1IUSA 3UKHA 3GD4A 3NK1X 3SFDA 1W4XA 2BA9A 2C76A 4GR1A 3C4NA 3UKLA 2TMDA 2FJEA 1N4UA 2JAEA 1DOBA 3NG7X 2WS3A 3BI5A 3PVCA 1GSNA 1Q1WA 4DNAA 3NTAA 1ELIA 1MOKA 2MOLA 1O5WA 2XFOA 3G5SA 2Z5XA 1COYA 2CULA 4XWZA 2BRAA 3CNDA 4APNA 3L8KA 2AR8A 4GAPA 1VG0A 2XFUA 4U8PA 5IQ4A 3BI4A 4AP3A 1PBBA 3BNMA 4H4RA 1H86A 3ADAB 1XHCA 2FJAA 3T37A 1LJ1A 3IHGA 1UKVG 2GB0A 3AEAA 1KFYA 4OPGA 4CY6A 2IVDA 1TYPA 1URHA 4ZCCA 3R2UA 3SFEA 4Z43A 3RP6A 1LTXR 1WV9A 2X8CA 5BRTA 3B6DA 3NH3X 1IUTA 1GRHA 4DSGA 3GDNA 4B64A 1GNDA 3VRAA 2HHGA 1OJAA 1OJTA 3VRBA 1Y56A 3SZCA 2QA2A 3CMMA 3AE2A 1TDFA 4IVOB 3ICRA 2IFVA 4NZHA 3AWIA 2AAQA 2GMJA 3UP4A 2XFQA 2GR1A 2Q82A 3AYJA 4H4UA 3CN8A 5C3JA 1T3KA 1CWTA 1PJ5A 3NHVA 3KVEA 3AE9A 3AAXA 3TG3A 3D1PA 1IUWA 2FJBA 3AE7A 2Q6UA 4ICYA 4X9NA 3UP5A 3AD8B 3IWAA 3AE4A 3LZXA 4YSHA 4U8OA 4AT0A 4EQRA 1YMLA 2APGA 3NYEA 1EL9A 2YLSA 2B9YA 5HBQA 3AE8A 5ER0A 3GK5A 1IUUA 3D8XA 3QJ4A 1F8WA 4UDPA 5FS7A 4YTMA 2WDRA 2OAMA 1S2QA 3UOXA 5IQ1A 4FDCB 1GRFA 2YR5A 3SYIA 1PJ7A 2XLUA 3FLHA 1GT8A 2EQ9A 4WX1A 3KPKA 4G6GA 4C5OA 3QSSA 4LA1A 3DGZA 4IV9A 3SZWA 5C2TA 4ECHA 4YKGA 4A79A 2R0PA 2YR6A 1PBCA 1Y56B 2IVEA 3T2ZA 1N4VA 3M13A 1H7WA 1BGJA 2WEUA 3URHA 2KL3A 2NVKX 4CCRA 3UTNX 2GQFA 3GRSA 1B8SA 1GETA 1H81A 4H2RA 1XANA 1L9DA 4H4PA 4U8IA 2R0GA 1NHRA 1VRQB 5HXIA 1GRBA 5KMSA 3CIRA 3P4SA 3GYXA 2R4JA 4NWZA 3S61A 3SM8A 2VRLA 4H4QA 5JCKA 4J31A 2FBWA 2BABA 5KMPA 4M52A 3OP3A 4RG4A 4EMJA 3VQRA 4A5LA 1H82A 3KU9A 4IA6A 4U8JA 3NLCA 4NTCA 1GMXA 1N4WA 3EANA 5U63A 1AOGA 3UOVA 1KNRA 2I0ZA 4J34A 4BURA 1FEAA 2ZBWA 4GAVA 1DNCA 1PXAA 2C3CA 5EBKA 4EQSA 2C64A 3QSMA 5J60A 3DGHA 3NK0X 3F8RA 1F8SA 3IC9A 1GREA 5HPAA 3CNJA 1ZX9A 2GF3A 2J3NA 4NTDA 2WOVA 1Y0PA 2BC1A 5IPYA 3AE1A 4II2A 4B65A 4EMWA 3FBSA 2B7SA 1DOCA 4J2WA 1KNPA 1TDEA 4RSLA 3GYJA 4TM4A 3QFBA 2WOIA 1DJNA 4B69A 5FS6A 1EL5A 2XFPA 5JCLA 1JRXA 3NT6A 4AOXA 2QAEA 2GEWA 2XVEA 3P4QA 4H4WA 1PJ6A 1B5QA 4E0VA 2B9WA 3BNUA 1KDGA 1H4MX 2B76A 2YLRA 4GDPA 4ZCDA 1B37A 2BK3A 1Q1RA 2PHHA 4G74A 3TP9A 1YM9A 1ZMDA 5DBJA 4A6NB 4NEVA 2WETA 2IFDA 2V3BA 1PN0A 3AEBA 2AQJA 3O0HA 2K0ZA 1ZKQA 3AAYA 2YVJA 1GXFA 2C73A 1VQWA 2VQ7A 3AE5A 1GPEA 5HBLA 2VVMA 2O9ZA 2GRTA 2BYBA 3FNJA 3GMBA 4C3XA 4YSYA 3CPJG 3B3RA 2XLPA 3GWDA 5KOXA 1GRGA 2QA1A 5FS8A 3AD9B 2XDOA 1LQTA 4TM3A 4BV6A 4C77A 3ATRA 5HBOA 5FMHA 1IUXA 3TG1B 1JRYA 3K30A 4USQA 1KF6A 4I58A 2BS3A 2WU2A 3T31A 1REOA 1FEBA 1PDHA 1DXLA 3T2YA 3QSEA 3RHAA 1S3EA 3F8PA 3GD3A 2X50A 4YTNA 3AEEA 2GR3A 3ALJA 3H8LA 4G6HA 4OPCA 1ZDLA 3FG2P 4ADWA 4RG3A 1JOAA 2X3NA 3T0KA 1NEKA 2JTQA 1YS0A 4BK3A 2ZZCA 5TR3A 4JY3A 1RYIA 1YQZA 2ACZA 2GWFA 1NENA 4H2NA 4OPIA 1S3BA 4Y4MA 3KA7A 4U8MA 5HY5A 2F5ZA 5KOWA 2X8GA 1MXTA 2YAUA 1BKWA 5GSNA 1RSGA 1IJHA 1LQUA 1RHDA 4J57A 2C67A 2BXSA 2C7GA 3ICTA 2VVLA 1NHQA 1ZP0A 5EB5A 3ITJA 2WPFA 1BOHA 4H4XA 4EIPA 1D7YA 3P3AA 4JNAA 4UDRA 4FK1C 3BI2A 5BVAA 2WESA 4USRA 3P4PA 2YR4A 1CC4A 1O94A 3ALLA 1H6VA 4B63A 3AYLA 2YQUA 3DK4A 1ZOYA 4UP3A 3HZUA 1GERA 1JU2A 3OC4A 3GSIA 3SGLA 3UOYA 4EQXA 1ZY8A 2GV8A 3ILMA 2VZ2A 3NGCX 1YMDA 2Y6QA 1M6IA 2GQWA 5HYMA 3AYIA 1OKGA 2A87A 3CNTA 3DJJA 1H7XA 3AEDA 4PABA 3NIXA 4HA6A 5JCMA 1P2EA 3E1TA 5JCNA 2CFYA 5LV9A 1YMKA 2OLNA 3S5WA 1GESA 2GR2A 3NYFA 2RABA 1YQ4A 2WQYA 5LAOA 1TRBA 2BK4A 4FX9A 1GRAA 4LU6A 4WCTA 4BK2A 5KWFA 4A99A 3NNEA 5U25A 3GRTA 3G5QA 1QO8A 3JSKA 4TM1A 2WPCA 5U1OA 4K5RA 1CC6A 4O5UA 3IPPA 5BUKA 3Q6JA 5HHFA 5KRQA 2C4CA 1CJ3A 4EM3A 1OJCA 2VQBA 4IA5A 3M12A 3UTHA 2OLOA 3SZ0A 4YWOA 2JTRA 3I2VA 3DA1A 2WDQA 4OCGA 3GMCA 1O95A 3UTGA 3P1WA 2OA1A 2YVFA 2BK5A 3I6DA 4OPUA 3IF9A 1NHPA 4JN9A 2UZZA 1F8RA 3DH9A 3IWHA 3D1CA 1ORBA 3M0OA 3P4RA 3V3NA 1CJ4A 3CGDA 3H4KA 2A2KA 1QLBA 2V5ZA 1KSUA 3QVRA 2JB3A 3AEFA 3NRNA 4CRTA 1BOIA 5JCIA 2DKHA 2ORAA 1GRTA 1HYUA 5HBPA 1TDKA 3UKFA 2WHDA 5KNLA 4K5SA 1Z6LA 2R46A 1QB0A 4JGTA 1SEZA 3NYCA 4JQ9A 4CY8A 3DJGX 1F6MA 3CGCA 1LVLA 3NK2X 1HZMA 1ZMCA 3FPZA 3SXIA 4MJWA 3UTFA 4BJZA 2Y6RA 3K9RA 4XXGA 1CF3A 1BWCA 4UDQA 3HYXA 3BHKA 4BK1A 4OPDA 3CPIG 1E1KA 4CNJA 3H8IA 4U8LA 1VEEA 2BXRA 2FJDA 2RGHA 4XWRA 2XFNA 2BCPA 3CGEA 4F67A 1XPQA 4D04A 4H4VA 2BS4A 2WBAA 3VRDB 3UCLA 3ZDNA 2CVJA 3AECA 3DMEA 1EL7A 2TPRA 4JDRA 3AB1A 4OVIA 4REKA 1C25A 4G73A 4O5QA 3EF6A 1B4VA 2A89A 2E5VA 4JNQA 4GCMA 2EG4A 1LPFA 1WHBA 1PBEA 2V61A 3F4AA 3EAOA 4YSZA 2GR0A 2GAGB 3PS9A 2YWLA 4C3YA 3MZZA 2BACA 1K4QA 1QJDA 3EPTA 3NKSA 4A65A 2V3AA 4DGKA 2B7RA 4YKFA 1GTEA 2V6OA 3CTYA 4K22A 2R4EA 1DODA 3II4A 1RHSA 1S2YA 2E1MA 2YLTA 3FIMB 4YSXA 4C74A 1H83A 2FSXA 2GMHA 1FL2A 4GRTA 2JKCA 2QCUA 2VOUA 3G5RA 2OALA 4BJYA 1ONFA 4YT0A 5M10A 1NPXA 2X99A 2XCGA 3FMWA 1CHUA 2EQ8A 4B67A 2WOWA 4NEWA 4NTEA 3V76A 3ATQA 3AE6A 2WP9A 2YLWA 1P2HA 3QFAA 5CKUA 1XDIA 5EB4A 2Q0KA 4U8KA 2A8XA 2WP6A 5FS9A 4TLZA 3K7MX 4TLXA 2JB1A 4B66A 1PBFA 1M64A 3KPFA 3F8DA 1QXNA 3GYIA 3QVPA 4TM0A 2C75A 3BHFA 2R45A 5KVHA 3ALMA 1ZK7A 2YVGA 3SQPA 4HB9A 2EG4B 1JNRA 1E0CA 4YXDA 1PHHA 1TQ1A 2JK6A 2YLXA 3FOJA 4U2SA 1GOSA 2NPXA 3AXBA 4J36A 1CL0A 1D7LA 2C3DA 4CCQA 3VR8A 2PYXA 5L46A 4CNKA 3O3WA 1K0LA 2ARDA 3CNSA 4IVMB 5LAMA 5EOWA 3I3LA 3DJDA 2YM2A 4KPRA 2ZZBA 3CNPA 2H88A 4J56A 2R9ZA 1CJ2A 3LZWA 1VDCA 2WLXA 3REDA 3COXA 3K7TA 3WE0A 4EMIA 2JB2A 3LOVA 1KSSA 2C70A 3K7QX 4KX6A 1PS9A 5BULA 1CWSA 4H7UA 2WLRA 3I3UA 4EIQA 4YTPA 3V3OA 1BZLA 3HWIA 3T14A 1YY5A
chains in the Genus database with same CATH topology
2VVLG 1N1PA 2X8HA 2XLRA 1E39A 2XVFA 2XYOA 3HYVA 4K8DA 5KVIA 5GRTA 2YM1A 1GN0A 1E1MA 1NG3A 4H2QA 4H50A 3OLHA 1CJCA 4A7AA 1GV4A 4Z24A 3RP8A 2WPEA 3UOZA 3HIXA 2GAHB 4Y4NA 3RNMA 4A9WA 2ZZ0A 1YQ3A 1E1NA 4K7ZA 2Q7VA 2C72A 1CWRA 3GDPA 1L9EA 4LIIA 4B1BA 2C66A 3IPOA 4GDEA 2CDUA 1GEUA 2BRYA 2YG7A 3KD9A 3P9UA 3UKQA 1TDNA 2YG6A 3NN6X 1L0VA 1Q9IA 2V60A 1TYTA 3T2KA 1YT8A 1E1LA 3ICSA 3C4AA 3VR9A 1DJQA 2EQ6A 1PXCA 4Z2UA 4K2XA 4OPTA 1BGNA 3DJEA 1FCDA 2XVIA 2GVCA 2YG4A 2XVHA 1D4DA 3NTDA 4G9KA 3ZYXA 2OUCA 1L9CA 2YLZA 2RGOA 4H4ZA 5M0ZA 1NDAA 1FOHA 4U2TA 1GTHA 3AEGA 2EQ7A 4GUVA 4B68A 2GH5A 1EBDA 1PXBA 2YG5A 1YKJA 1K0JA 1DOEA 1E6EA 5J7XA 4AOSA 3NN0X 4FK1A 3R9UA 2WU5A 3AD7B 2J6PA 2BS2A 2YG3A 3LB8A 1E7PA 1OJDA 1RP0A 3SX6A 1NAAA 4U8NA 4II3A 2BC0A 2DKIA 3SZFA 3KKJA 1ZOVA 3HYWA 3OZ2A 2W0HA 5KMRA 2DCQA 2Q0LA 1JRZA 1PBDA 2IIDA 3G5JA 1IUVA 3DK9A 3CGBA 4WH9A 1CBOA 2BCGG 1X31B 3ISHA 2C65A 3GWFA 2UZQA 4Z44A 2VSWA 3UKAA 1GALA 2Z5YA 1D5TA 4EQWA 3DK8A 4D03A 5CQFA 1H84A 3RP7A 4X4JA 3ABVA 1D4EA 3NHOX 4N9XA 4AT2A 1H4KX 2XLTA 1BF3A 4PAAA 4CBQA 4Y4LA 2HQMA 3UTEA 1F3PA 2XVJA 3C96A 4JY2A 4EM4A 4ZN0A 4X9MA 4Z26A 2MOIA 1CC2A 2MRMA 3LXDA 3CPHG 3LADA 4Z25A 2JTSA 1NG4A 3AE3A 4DSHA 3PO7A 5KXJA 4A6NA 3L1RA 4GF7A 2B9XA 4H4SA 1K0IA 4OPLA 2H89A 2WP5A 2E4GA 1LV0A 4Z2RA 3FS5A 4WH7A 1D4CA 4AP1A 1V59A 2RGJA 1JEHA 3HZLA 1TDOA 1NHSA 2WDVA 1JNZA 3IHMA 2XLSA 4Z2TA 2JBVA 3KLJA 4P9SA 3UKKA 1VG9A 1DP2A 1MO9A 1OJ9A 2R0CA 3UKPA 1FECA 3LJPA 4J33A 4H2PA 4H4YA 4H4TA 2VRMA 2EG3A 3Q9TA 1EL8A 4I59A 4NNJA 3SY4A 1UARA 5KMQA 4U2LA 1IUSA 3UKHA 3GD4A 3NK1X 3SFDA 1W4XA 2BA9A 2C76A 4GR1A 3C4NA 3UKLA 2TMDA 2FJEA 1N4UA 2JAEA 1DOBA 3NG7X 2WS3A 3BI5A 3PVCA 1GSNA 1Q1WA 4DNAA 3NTAA 1ELIA 1MOKA 2MOLA 1O5WA 2XFOA 3G5SA 2Z5XA 1COYA 2CULA 4XWZA 2BRAA 3CNDA 4APNA 3L8KA 2AR8A 4GAPA 1VG0A 2XFUA 4U8PA 5IQ4A 3BI4A 4AP3A 1PBBA 3BNMA 4H4RA 1H86A 3ADAB 1XHCA 2FJAA 3T37A 1LJ1A 3IHGA 1UKVG 2GB0A 3AEAA 1KFYA 4OPGA 4CY6A 2IVDA 1TYPA 1URHA 4ZCCA 3R2UA 3SFEA 4Z43A 3RP6A 1LTXR 1WV9A 2X8CA 5BRTA 3B6DA 3NH3X 1IUTA 1GRHA 4DSGA 3GDNA 4B64A 1GNDA 3VRAA 2HHGA 1OJAA 1OJTA 3VRBA 1Y56A 3SZCA 2QA2A 3CMMA 3AE2A 1TDFA 4IVOB 3ICRA 2IFVA 4NZHA 3AWIA 2AAQA 2GMJA 3UP4A 2XFQA 2GR1A 3AYJA 4H4UA 3CN8A 5C3JA 1T3KA 1CWTA 1PJ5A 3NHVA 3KVEA 3AE9A 3AAXA 3TG3A 3D1PA 1IUWA 2FJBA 3AE7A 2Q6UA 4ICYA 4X9NA 3UP5A 3AD8B 3IWAA 3AE4A 3LZXA 4YSHA 4U8OA 4AT0A 4EQRA 1YMLA 2APGA 3NYEA 1EL9A 2YLSA 2B9YA 5HBQA 3AE8A 5ER0A 3GK5A 1IUUA 3D8XA 3QJ4A 1F8WA 4UDPA 5FS7A 4YTMA 2WDRA 2OAMA 1S2QA 3UOXA 5IQ1A 4FDCB 1GRFA 2YR5A 3SYIA 1PJ7A 2XLUA 3FLHA 1GT8A 2EQ9A 4WX1A 3KPKA 4G6GA 4C5OA 3QSSA 4LA1A 3DGZA 4IV9A 3SZWA 5C2TA 4ECHA 4YKGA 4A79A 2R0PA 2YR6A 1PBCA 1Y56B 2IVEA 3T2ZA 1N4VA 3M13A 1H7WA 1BGJA 2WEUA 3URHA 2KL3A 2NVKX 4CCRA 3UTNX 2GQFA 3GRSA 1B8SA 1GETA 1H81A 4H2RA 1XANA 1L9DA 4H4PA 4U8IA 2R0GA 1NHRA 1VRQB 5HXIA 1GRBA 5KMSA 3CIRA 3P4SA 3GYXA 2R4JA 4NWZA 3S61A 3SM8A 2VRLA 4H4QA 5JCKA 4J31A 2FBWA 2BABA 5KMPA 4M52A 3OP3A 4RG4A 4EMJA 3VQRA 4A5LA 1H82A 3KU9A 4IA6A 4U8JA 3NLCA 4NTCA 1GMXA 1N4WA 3EANA 5U63A 1AOGA 3UOVA 1KNRA 2I0ZA 4J34A 4BURA 1FEAA 2ZBWA 4GAVA 1DNCA 1PXAA 2C3CA 5EBKA 4EQSA 2C64A 3QSMA 5J60A 3DGHA 3NK0X 3F8RA 1F8SA 3IC9A 1GREA 5HPAA 3CNJA 1ZX9A 2GF3A 2J3NA 4NTDA 2WOVA 1Y0PA 2BC1A 5IPYA 3AE1A 4II2A 4B65A 4EMWA 3FBSA 2B7SA 1DOCA 4J2WA 1KNPA 1TDEA 4RSLA 3GYJA 4TM4A 3QFBA 2WOIA 1DJNA 4B69A 5FS6A 1EL5A 2XFPA 5JCLA 1JRXA 3NT6A 4AOXA 2QAEA 2GEWA 2XVEA 3P4QA 4H4WA 1PJ6A 1B5QA 4E0VA 2B9WA 3BNUA 1KDGA 1H4MX 2B76A 2YLRA 4GDPA 4ZCDA 1B37A 2BK3A 1Q1RA 2PHHA 4G74A 3TP9A 1YM9A 1ZMDA 5DBJA 4A6NB 4NEVA 2WETA 2IFDA 2V3BA 1PN0A 3AEBA 2AQJA 3O0HA 2K0ZA 1ZKQA 3AAYA 2YVJA 1GXFA 2C73A 1VQWA 2VQ7A 3AE5A 1GPEA 5HBLA 2VVMA 2O9ZA 2GRTA 2BYBA 3FNJA 3GMBA 4C3XA 4YSYA 3CPJG 3B3RA 2XLPA 3GWDA 5KOXA 1GRGA 2QA1A 5FS8A 3AD9B 2XDOA 1LQTA 4TM3A 4BV6A 4C77A 3ATRA 5HBOA 5FMHA 1IUXA 3TG1B 1JRYA 3K30A 4USQA 1KF6A 4I58A 2BS3A 2WU2A 3T31A 1REOA 1FEBA 1PDHA 1DXLA 3T2YA 3QSEA 3RHAA 1S3EA 3F8PA 3GD3A 2X50A 4YTNA 3AEEA 2GR3A 3ALJA 3H8LA 4G6HA 4OPCA 1ZDLA 3FG2P 4ADWA 4RG3A 1JOAA 2X3NA 3T0KA 1NEKA 2JTQA 1YS0A 4BK3A 2ZZCA 5TR3A 4JY3A 1RYIA 1YQZA 2ACZA 2GWFA 1NENA 4H2NA 4OPIA 1S3BA 4Y4MA 3KA7A 4U8MA 5HY5A 2F5ZA 5KOWA 2X8GA 1MXTA 2YAUA 1BKWA 5GSNA 1RSGA 1IJHA 1LQUA 1RHDA 4J57A 2C67A 2BXSA 2C7GA 3ICTA 2VVLA 1NHQA 1ZP0A 5EB5A 3ITJA 2WPFA 1BOHA 4H4XA 4EIPA 1D7YA 3P3AA 4JNAA 4UDRA 4FK1C 3BI2A 5BVAA 2WESA 4USRA 3P4PA 2YR4A 1CC4A 1O94A 3ALLA 1H6VA 4B63A 3AYLA 2YQUA 3DK4A 1ZOYA 4UP3A 3HZUA 1GERA 1JU2A 3OC4A 3GSIA 3SGLA 3UOYA 4EQXA 1ZY8A 2GV8A 3ILMA 2VZ2A 3NGCX 1YMDA 2Y6QA 1M6IA 2GQWA 5HYMA 3AYIA 1OKGA 2A87A 3CNTA 3DJJA 1H7XA 3AEDA 4PABA 3NIXA 4HA6A 5JCMA 1P2EA 3E1TA 5JCNA 2CFYA 5LV9A 1YMKA 2OLNA 3S5WA 1GESA 2GR2A 3NYFA 2RABA 1YQ4A 2WQYA 5LAOA 1TRBA 2BK4A 4FX9A 1GRAA 4LU6A 4WCTA 4BK2A 5KWFA 4A99A 3NNEA 5U25A 3GRTA 3G5QA 1QO8A 3JSKA 4TM1A 2WPCA 5U1OA 4K5RA 1CC6A 4O5UA 3IPPA 5BUKA 3Q6JA 5HHFA 5KRQA 2C4CA 1CJ3A 4EM3A 1OJCA 2VQBA 4IA5A 3M12A 3UTHA 2OLOA 3SZ0A 4YWOA 2JTRA 3I2VA 3DA1A 2WDQA 4OCGA 3GMCA 1O95A 3UTGA 3P1WA 2OA1A 2YVFA 2BK5A 3I6DA 4OPUA 3IF9A 1NHPA 4JN9A 2UZZA 1F8RA 3DH9A 3IWHA 3D1CA 1ORBA 3M0OA 3P4RA 3V3NA 1CJ4A 3CGDA 3H4KA 2A2KA 1QLBA 2V5ZA 1KSUA 3QVRA 2JB3A 3AEFA 3NRNA 4CRTA 1BOIA 5JCIA 2DKHA 2ORAA 1GRTA 1HYUA 5HBPA 1TDKA 3UKFA 2WHDA 5KNLA 4K5SA 1Z6LA 2R46A 1QB0A 4JGTA 1SEZA 3NYCA 4JQ9A 4CY8A 3DJGX 1F6MA 3CGCA 1LVLA 3NK2X 1HZMA 1ZMCA 3FPZA 3SXIA 4MJWA 3UTFA 4BJZA 2Y6RA 3K9RA 4XXGA 1CF3A 1BWCA 4UDQA 3HYXA 3BHKA 4BK1A 4OPDA 3CPIG 1E1KA 4CNJA 3H8IA 4U8LA 1VEEA 2BXRA 2FJDA 2RGHA 4XWRA 2XFNA 2BCPA 3CGEA 4F67A 1XPQA 4D04A 4H4VA 2BS4A 2WBAA 3VRDB 3UCLA 3ZDNA 2CVJA 3AECA 3DMEA 1EL7A 2TPRA 4JDRA 3AB1A 4OVIA 4REKA 1C25A 4G73A 4O5QA 3EF6A 1B4VA 2A89A 2E5VA 4JNQA 4GCMA 2EG4A 1LPFA 1WHBA 1PBEA 2V61A 3F4AA 3EAOA 4YSZA 2GR0A 2GAGB 3PS9A 2YWLA 4C3YA 3MZZA 2BACA 1K4QA 1QJDA 3EPTA 3NKSA 4A65A 2V3AA 4DGKA 2B7RA 4YKFA 1GTEA 2V6OA 3CTYA 4K22A 2R4EA 1DODA 3II4A 1RHSA 1S2YA 2E1MA 2YLTA 3FIMB 4YSXA 4C74A 1H83A 2FSXA 2GMHA 1FL2A 4GRTA 2JKCA 2QCUA 2VOUA 3G5RA 2OALA 4BJYA 1ONFA 4YT0A 5M10A 1NPXA 2X99A 2XCGA 3FMWA 1CHUA 2EQ8A 4B67A 2WOWA 4NEWA 4NTEA 3V76A 3ATQA 3AE6A 2WP9A 2YLWA 1P2HA 3QFAA 5CKUA 1XDIA 5EB4A 2Q0KA 4U8KA 2A8XA 2WP6A 5FS9A 4TLZA 3K7MX 4TLXA 2JB1A 4B66A 1PBFA 1M64A 3KPFA 3F8DA 1QXNA 3GYIA 3QVPA 4TM0A 2C75A 3BHFA 2R45A 5KVHA 3ALMA 1ZK7A 2YVGA 3SQPA 4HB9A 2EG4B 1JNRA 1E0CA 4YXDA 1PHHA 1TQ1A 2JK6A 2YLXA 3FOJA 4U2SA 1GOSA 2NPXA 3AXBA 4J36A 1CL0A 1D7LA 2C3DA 4CCQA 3VR8A 2PYXA 5L46A 4CNKA 3O3WA 1K0LA 2ARDA 3CNSA 4IVMB 5LAMA 5EOWA 3I3LA 3DJDA 2YM2A 4KPRA 2ZZBA 3CNPA 2H88A 4J56A 2R9ZA 1CJ2A 3LZWA 1VDCA 2WLXA 3REDA 3COXA 3K7TA 3WE0A 4EMIA 2JB2A 3LOVA 1KSSA 2C70A 3K7QX 4KX6A 1PS9A 5BULA 1CWSA 4H7UA 2WLRA 3I3UA 4EIQA 4YTPA 3V3OA 1BZLA 3HWIA 3T14A 1YY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VVL G;  1N1P A;  2X8H A;  2XLR A;  1E39 A;  2XVF A;  2XYO A;  5KVI A;  4K8D A;  5GRT A;  2YM1 A;  1GN0 A;  1E1M A;  1NG3 A;  4H2Q A;  4H50 A;  3OLH A;  1CJC A;  4A7A A;  1GV4 A;  4Z24 A;  3RP8 A;  2WPE A;  3UOZ A;  3HIX A;  2GAH B;  4Y4N A;  3RNM A;  4A9W A;  2ZZ0 A;  1YQ3 A;  1E1N A;  4K7Z A;  2Q7V A;  2C72 A;  1CWR A;  3GDP A;  1L9E A;  4LII A;  4B1B A;  2C66 A;  3IPO A;  4GDE A;  2CDU A;  1GEU A;  2YG7 A;  3KD9 A;  3P9U A;  3UKQ A;  1TDN A;  2YG6 A;  3NN6 X;  1L0V A;  1Q9I A;  2V60 A;  1TYT A;  1YT8 A;  1E1L A;  3ICS A;  3C4A A;  3VR9 A;  1DJQ A;  2EQ6 A;  1PXC A;  4Z2U A;  4K2X A;  4OPT A;  1BGN A;  3DJE A;  1FCD A;  2XVI A;  2GVC A;  2YG4 A;  2XVH A;  1D4D A;  3NTD A;  3ZYX A;  2OUC A;  1L9C A;  2YLZ A;  2RGO A;  4H4Z A;  5M0Z A;  1NDA A;  1FOH A;  4U2T A;  1GTH A;  3AEG A;  2EQ7 A;  4GUV A;  4B68 A;  2GH5 A;  1EBD A;  1PXB A;  2YG5 A;  1YKJ A;  1K0J A;  1DOE A;  1E6E A;  5J7X A;  4AOS A;  3NN0 X;  4FK1 A;  3R9U A;  2WU5 A;  3AD7 B;  2J6P A;  2BS2 A;  2YG3 A;  3LB8 A;  1E7P A;  1OJD A;  1RP0 A;  1NAA A;  4U8N A;  2BC0 A;  2DKI A;  3KKJ A;  1ZOV A;  3OZ2 A;  2W0H A;  2DCQ A;  2Q0L A;  1JRZ A;  1PBD A;  2IID A;  3G5J A;  1IUV A;  3DK9 A;  3CGB A;  4WH9 A;  1CBO A;  2BCG G;  1X31 B;  3ISH A;  2C65 A;  3GWF A;  2UZQ A;  4Z44 A;  2VSW A;  3UKA A;  1GAL A;  2Z5Y A;  1D5T A;  4EQW A;  3DK8 A;  4D03 A;  5CQF A;  1H84 A;  3RP7 A;  4X4J A;  3ABV A;  1D4E A;  3NHO X;  4N9X A;  4AT2 A;  1H4K X;  2XLT A;  1BF3 A;  4PAA A;  4CBQ A;  4Y4L A;  2HQM A;  3UTE A;  1F3P A;  2XVJ A;  3C96 A;  4JY2 A;  4EM4 A;  4ZN0 A;  4X9M A;  4Z26 A;  2MOI A;  1CC2 A;  2MRM A;  3LXD A;  3CPH G;  3LAD A;  4Z25 A;  2JTS A;  1NG4 A;  3AE3 A;  4DSH A;  3PO7 A;  5KXJ A;  4A6N A;  3L1R A;  4GF7 A;  2B9X A;  4H4S A;  1K0I A;  4OPL A;  2H89 A;  2WP5 A;  2E4G A;  1LV0 A;  4Z2R A;  3FS5 A;  4WH7 A;  1D4C A;  4AP1 A;  1V59 A;  2RGJ A;  1JEH A;  3HZL A;  1TDO A;  1NHS A;  2WDV A;  1JNZ A;  3IHM A;  2XLS A;  4Z2T A;  2JBV A;  3KLJ A;  4P9S A;  3UKK A;  1VG9 A;  1DP2 A;  1MO9 A;  1OJ9 A;  2R0C A;  3UKP A;  1FEC A;  3LJP A;  4J33 A;  4H2P A;  4H4Y A;  4H4T A;  2VRM A;  2EG3 A;  3Q9T A;  1EL8 A;  4I59 A;  1UAR A;  4U2L A;  1IUS A;  3UKH A;  3GD4 A;  3NK1 X;  3SFD A;  1W4X A;  2BA9 A;  2C76 A;  4GR1 A;  3C4N A;  3UKL A;  2TMD A;  2FJE A;  1N4U A;  2JAE A;  1DOB A;  3NG7 X;  2WS3 A;  3BI5 A;  3PVC A;  1GSN A;  1Q1W A;  4DNA A;  3NTA A;  1ELI A;  1MOK A;  2MOL A;  1O5W A;  2XFO A;  3G5S A;  2Z5X A;  1COY A;  2CUL A;  4XWZ A;  3CND A;  4APN A;  3L8K A;  2AR8 A;  1VG0 A;  2XFU A;  4U8P A;  5IQ4 A;  3BI4 A;  4AP3 A;  1PBB A;  3BNM A;  4H4R A;  1H86 A;  3ADA B;  1XHC A;  2FJA A;  3T37 A;  1LJ1 A;  3IHG A;  1UKV G;  2GB0 A;  3AEA A;  1KFY A;  4OPG A;  4CY6 A;  2IVD A;  1TYP A;  1URH A;  4ZCC A;  3R2U A;  3SFE A;  4Z43 A;  3RP6 A;  1LTX R;  1WV9 A;  2X8C A;  5BRT A;  3B6D A;  3NH3 X;  1IUT A;  1GRH A;  4DSG A;  3GDN A;  4B64 A;  1GND A;  3VRA A;  2HHG A;  1OJA A;  1OJT A;  3VRB A;  1Y56 A;  2QA2 A;  3AE2 A;  1TDF A;  4IVO B;  3ICR A;  2IFV A;  4NZH A;  3AWI A;  2AAQ A;  2GMJ A;  3UP4 A;  2XFQ A;  2GR1 A;  3AYJ A;  4H4U A;  3CN8 A;  5C3J A;  1T3K A;  1CWT A;  1PJ5 A;  3NHV A;  3KVE A;  3AE9 A;  3AAX A;  3TG3 A;  3D1P A;  1IUW A;  2FJB A;  3AE7 A;  2Q6U A;  4ICY A;  4X9N A;  3UP5 A;  3AD8 B;  3IWA A;  3AE4 A;  3LZX A;  4YSH A;  4U8O A;  4AT0 A;  4EQR A;  1YML A;  2APG A;  3NYE A;  1EL9 A;  2YLS A;  2B9Y A;  5HBQ A;  3AE8 A;  5ER0 A;  3GK5 A;  1IUU A;  3D8X A;  3QJ4 A;  1F8W A;  4UDP A;  5FS7 A;  4YTM A;  2WDR A;  2OAM A;  1S2Q A;  3UOX A;  5IQ1 A;  4FDC B;  1GRF A;  2YR5 A;  1PJ7 A;  2XLU A;  3FLH A;  1GT8 A;  2EQ9 A;  4WX1 A;  4C5O A;  3QSS A;  4LA1 A;  3DGZ A;  4IV9 A;  5C2T A;  4ECH A;  4YKG A;  4A79 A;  2R0P A;  2YR6 A;  1PBC A;  1Y56 B;  2IVE A;  1N4V A;  3M13 A;  1H7W A;  1BGJ A;  2WEU A;  3URH A;  2KL3 A;  2NVK X;  4CCR A;  3UTN X;  2GQF A;  3GRS A;  1B8S A;  1GET A;  1H81 A;  4H2R A;  1XAN A;  1L9D A;  4H4P A;  4U8I A;  2R0G A;  1NHR A;  1VRQ B;  5HXI A;  1GRB A;  3CIR A;  3P4S A;  2R4J A;  3S61 A;  3SM8 A;  2VRL A;  4H4Q A;  5JCK A;  4J31 A;  2FBW A;  2BAB A;  4M52 A;  3OP3 A;  4RG4 A;  4EMJ A;  3VQR A;  4A5L A;  1H82 A;  3KU9 A;  4IA6 A;  4U8J A;  3NLC A;  4NTC A;  1GMX A;  1N4W A;  3EAN A;  5U63 A;  1AOG A;  3UOV A;  1KNR A;  2I0Z A;  4J34 A;  4BUR A;  1FEA A;  2ZBW A;  5EBK A;  1DNC A;  1PXA A;  2C3C A;  4EQS A;  2C64 A;  3QSM A;  5J60 A;  3DGH A;  3NK0 X;  3F8R A;  1F8S A;  3IC9 A;  1GRE A;  5HPA A;  3CNJ A;  1ZX9 A;  2GF3 A;  2J3N A;  4NTD A;  2WOV A;  1Y0P A;  2BC1 A;  5IPY A;  3AE1 A;  4B65 A;  4EMW A;  3FBS A;  2B7S A;  1DOC A;  4J2W A;  1KNP A;  1TDE A;  4RSL A;  3GYJ A;  4TM4 A;  3QFB A;  2WOI A;  1DJN A;  4B69 A;  5FS6 A;  1EL5 A;  2XFP A;  5JCL A;  1JRX A;  3NT6 A;  4AOX A;  2QAE A;  2GEW A;  2XVE A;  3P4Q A;  4H4W A;  1PJ6 A;  1B5Q A;  4E0V A;  2B9W A;  3BNU A;  1KDG A;  1H4M X;  2B76 A;  2YLR A;  4GDP A;  4ZCD A;  1B37 A;  2BK3 A;  1Q1R A;  2PHH A;  3TP9 A;  1YM9 A;  1ZMD A;  5DBJ A;  4A6N B;  4NEV A;  2WET A;  2IFD A;  2V3B A;  1PN0 A;  3AEB A;  2AQJ A;  3O0H A;  2K0Z A;  1ZKQ A;  3AAY A;  2YVJ A;  1GXF A;  2C73 A;  1VQW A;  2VQ7 A;  3AE5 A;  1GPE A;  5HBL A;  2VVM A;  2O9Z A;  2GRT A;  2BYB A;  3FNJ A;  3GMB A;  4C3X A;  4YSY A;  3CPJ G;  3B3R A;  2XLP A;  3GWD A;  5KOX A;  1GRG A;  2QA1 A;  5FS8 A;  3AD9 B;  2XDO A;  1LQT A;  4TM3 A;  4BV6 A;  4C77 A;  3ATR A;  5HBO A;  5FMH A;  1IUX A;  3TG1 B;  1JRY A;  3K30 A;  4USQ A;  1KF6 A;  4I58 A;  2BS3 A;  2WU2 A;  1REO A;  1FEB A;  1PDH A;  1DXL A;  3QSE A;  3RHA A;  1S3E A;  3F8P A;  3GD3 A;  2X50 A;  4YTN A;  3AEE A;  2GR3 A;  3ALJ A;  3H8L A;  4OPC A;  1ZDL A;  3FG2 P;  4ADW A;  4RG3 A;  1JOA A;  2X3N A;  1NEK A;  2JTQ A;  1YS0 A;  4BK3 A;  2ZZC A;  5TR3 A;  4JY3 A;  1RYI A;  1YQZ A;  2ACZ A;  2GWF A;  1NEN A;  4H2N A;  4OPI A;  1S3B A;  4Y4M A;  3KA7 A;  4U8M A;  5HY5 A;  2F5Z A;  5KOW A;  2X8G A;  1MXT A;  2YAU A;  1BKW A;  5GSN A;  1RSG A;  1IJH A;  1LQU A;  1RHD A;  4J57 A;  2C67 A;  2BXS A;  2C7G A;  3ICT A;  2VVL A;  1NHQ A;  1ZP0 A;  5EB5 A;  3ITJ A;  2WPF A;  1BOH A;  4H4X A;  4EIP A;  1D7Y A;  3P3A A;  4JNA A;  4UDR A;  4FK1 C;  3BI2 A;  5BVA A;  2WES A;  4USR A;  3P4P A;  2YR4 A;  1CC4 A;  1O94 A;  3ALL A;  1H6V A;  4B63 A;  3AYL A;  2YQU A;  3DK4 A;  1ZOY A;  4UP3 A;  3HZU A;  1GER A;  1JU2 A;  3OC4 A;  3GSI A;  3SGL A;  3UOY A;  4EQX A;  1ZY8 A;  2GV8 A;  3ILM A;  2VZ2 A;  3NGC X;  1YMD A;  2Y6Q A;  1M6I A;  2GQW A;  5HYM A;  3AYI A;  1OKG A;  2A87 A;  3CNT A;  3DJJ A;  1H7X A;  3AED A;  4PAB A;  3NIX A;  4HA6 A;  5JCM A;  1P2E A;  3E1T A;  5JCN A;  2CFY A;  5LV9 A;  1YMK A;  2OLN A;  3S5W A;  1GES A;  2GR2 A;  3NYF A;  2RAB A;  1YQ4 A;  2WQY A;  5LAO A;  1TRB A;  2BK4 A;  4FX9 A;  1GRA A;  4LU6 A;  4WCT A;  4BK2 A;  5KWF A;  4A99 A;  3NNE A;  5U25 A;  3GRT A;  3G5Q A;  1QO8 A;  3JSK A;  4TM1 A;  2WPC A;  5U1O A;  4K5R A;  1CC6 A;  4O5U A;  3IPP A;  5BUK A;  3Q6J A;  5HHF A;  5KRQ A;  1CJ3 A;  4EM3 A;  1OJC A;  2VQB A;  4IA5 A;  3M12 A;  3UTH A;  2OLO A;  4YWO A;  2JTR A;  3I2V A;  3DA1 A;  2WDQ A;  4OCG A;  3GMC A;  1O95 A;  3UTG A;  3P1W A;  2OA1 A;  2YVF A;  2BK5 A;  3I6D A;  4OPU A;  3IF9 A;  1NHP A;  4JN9 A;  2UZZ A;  1F8R A;  3DH9 A;  3IWH A;  3D1C A;  1ORB A;  3M0O A;  3P4R A;  3V3N A;  1CJ4 A;  3CGD A;  3H4K A;  2A2K A;  1QLB A;  2V5Z A;  1KSU A;  3QVR A;  2JB3 A;  3AEF A;  3NRN A;  4CRT A;  1BOI A;  5JCI A;  2DKH A;  2ORA A;  1GRT A;  1HYU A;  5HBP A;  1TDK A;  3UKF A;  2WHD A;  4K5S A;  1Z6L A;  2R46 A;  1QB0 A;  4JGT A;  1SEZ A;  3NYC A;  4JQ9 A;  4CY8 A;  3DJG X;  1F6M A;  3CGC A;  1LVL A;  3NK2 X;  1HZM A;  1ZMC A;  3FPZ A;  4MJW A;  3UTF A;  4BJZ A;  2Y6R A;  3K9R A;  4XXG A;  1CF3 A;  1BWC A;  4UDQ A;  3BHK A;  4BK1 A;  4OPD A;  3CPI G;  1E1K A;  4CNJ A;  3H8I A;  4U8L A;  1VEE A;  2BXR A;  2FJD A;  2RGH A;  4XWR A;  2XFN A;  2BCP A;  3CGE A;  4F67 A;  1XPQ A;  4D04 A;  4H4V A;  2BS4 A;  2WBA A;  3VRD B;  3UCL A;  3ZDN A;  2CVJ A;  3AEC A;  3DME A;  1EL7 A;  2TPR A;  4JDR A;  3AB1 A;  4OVI A;  4REK A;  1C25 A;  4O5Q A;  3EF6 A;  1B4V A;  2A89 A;  2E5V A;  4JNQ A;  4GCM A;  2EG4 A;  1LPF A;  1WHB A;  1PBE A;  2V61 A;  3F4A A;  3EAO A;  4YSZ A;  2GR0 A;  2GAG B;  3PS9 A;  2YWL A;  4C3Y A;  3MZZ A;  2BAC A;  1K4Q A;  1QJD A;  3EPT A;  3NKS A;  4A65 A;  2V3A A;  4DGK A;  2B7R A;  4YKF A;  1GTE A;  2V6O A;  3CTY A;  4K22 A;  2R4E A;  1DOD A;  3II4 A;  1RHS A;  1S2Y A;  2E1M A;  2YLT A;  3FIM B;  4YSX A;  4C74 A;  1H83 A;  2FSX A;  2GMH A;  1FL2 A;  4GRT A;  2JKC A;  2QCU A;  2VOU A;  3G5R A;  2OAL A;  4BJY A;  1ONF A;  4YT0 A;  5M10 A;  1NPX A;  2X99 A;  2XCG A;  3FMW A;  1CHU A;  2EQ8 A;  4B67 A;  2WOW A;  4NEW A;  4NTE A;  3V76 A;  3ATQ A;  3AE6 A;  2WP9 A;  2YLW A;  1P2H A;  3QFA A;  5CKU A;  1XDI A;  5EB4 A;  2Q0K A;  4U8K A;  2A8X A;  2WP6 A;  5FS9 A;  4TLZ A;  3K7M X;  4TLX A;  2JB1 A;  4B66 A;  1PBF A;  1M64 A;  3KPF A;  3F8D A;  1QXN A;  3GYI A;  3QVP A;  4TM0 A;  2C75 A;  3BHF A;  2R45 A;  5KVH A;  3ALM A;  1ZK7 A;  2YVG A;  3SQP A;  4HB9 A;  2EG4 B;  1JNR A;  1E0C A;  4YXD A;  1PHH A;  1TQ1 A;  2JK6 A;  2YLX A;  3FOJ A;  4U2S A;  1GOS A;  2NPX A;  3AXB A;  4J36 A;  1CL0 A;  1D7L A;  2C3D A;  4CCQ A;  3VR8 A;  2PYX A;  5L46 A;  4CNK A;  3O3W A;  1K0L A;  2ARD A;  3CNS A;  4IVM B;  5LAM A;  5EOW A;  3I3L A;  3DJD A;  2YM2 A;  4KPR A;  2ZZB A;  3CNP A;  2H88 A;  4J56 A;  2R9Z A;  1CJ2 A;  3LZW A;  1VDC A;  2WLX A;  3RED A;  3COX A;  3K7T A;  3WE0 A;  4EMI A;  2JB2 A;  3LOV A;  1KSS A;  2C70 A;  3K7Q X;  4KX6 A;  1PS9 A;  5BUL A;  1CWS A;  4H7U A;  2WLR A;  3I3U A;  4EIQ A;  4YTP A;  3V3O A;  1BZL A;  3HWI A;  1YY5 A; 
#chains in the Genus database with same CATH topology
 2VVL G;  1N1P A;  2X8H A;  2XLR A;  1E39 A;  2XVF A;  2XYO A;  3HYV A;  4K8D A;  5KVI A;  5GRT A;  2YM1 A;  1GN0 A;  1E1M A;  1NG3 A;  4H2Q A;  4H50 A;  3OLH A;  1CJC A;  4A7A A;  1GV4 A;  4Z24 A;  3RP8 A;  2WPE A;  3UOZ A;  3HIX A;  2GAH B;  4Y4N A;  3RNM A;  4A9W A;  2ZZ0 A;  1YQ3 A;  1E1N A;  4K7Z A;  2Q7V A;  2C72 A;  1CWR A;  3GDP A;  1L9E A;  4LII A;  4B1B A;  2C66 A;  3IPO A;  4GDE A;  2CDU A;  1GEU A;  2BRY A;  2YG7 A;  3KD9 A;  3P9U A;  3UKQ A;  1TDN A;  2YG6 A;  3NN6 X;  1L0V A;  1Q9I A;  2V60 A;  1TYT A;  3T2K A;  1YT8 A;  1E1L A;  3ICS A;  3C4A A;  3VR9 A;  1DJQ A;  2EQ6 A;  1PXC A;  4Z2U A;  4K2X A;  4OPT A;  1BGN A;  3DJE A;  1FCD A;  2XVI A;  2GVC A;  2YG4 A;  2XVH A;  1D4D A;  3NTD A;  4G9K A;  3ZYX A;  2OUC A;  1L9C A;  2YLZ A;  2RGO A;  4H4Z A;  5M0Z A;  1NDA A;  1FOH A;  4U2T A;  1GTH A;  3AEG A;  2EQ7 A;  4GUV A;  4B68 A;  2GH5 A;  1EBD A;  1PXB A;  2YG5 A;  1YKJ A;  1K0J A;  1DOE A;  1E6E A;  5J7X A;  4AOS A;  3NN0 X;  4FK1 A;  3R9U A;  2WU5 A;  3AD7 B;  2J6P A;  2BS2 A;  2YG3 A;  3LB8 A;  1E7P A;  1OJD A;  1RP0 A;  3SX6 A;  1NAA A;  4U8N A;  4II3 A;  2BC0 A;  2DKI A;  3SZF A;  3KKJ A;  1ZOV A;  3HYW A;  3OZ2 A;  2W0H A;  5KMR A;  2DCQ A;  2Q0L A;  1JRZ A;  1PBD A;  2IID A;  3G5J A;  1IUV A;  3DK9 A;  3CGB A;  4WH9 A;  1CBO A;  2BCG G;  1X31 B;  3ISH A;  2C65 A;  3GWF A;  2UZQ A;  4Z44 A;  2VSW A;  3UKA A;  1GAL A;  2Z5Y A;  1D5T A;  4EQW A;  3DK8 A;  4D03 A;  5CQF A;  1H84 A;  3RP7 A;  4X4J A;  3ABV A;  1D4E A;  3NHO X;  4N9X A;  4AT2 A;  1H4K X;  2XLT A;  1BF3 A;  4PAA A;  4CBQ A;  4Y4L A;  2HQM A;  3UTE A;  1F3P A;  2XVJ A;  3C96 A;  4JY2 A;  4EM4 A;  4ZN0 A;  4X9M A;  4Z26 A;  2MOI A;  1CC2 A;  2MRM A;  3LXD A;  3CPH G;  3LAD A;  4Z25 A;  2JTS A;  1NG4 A;  3AE3 A;  4DSH A;  3PO7 A;  5KXJ A;  4A6N A;  3L1R A;  4GF7 A;  2B9X A;  4H4S A;  1K0I A;  4OPL A;  2H89 A;  2WP5 A;  2E4G A;  1LV0 A;  4Z2R A;  3FS5 A;  4WH7 A;  1D4C A;  4AP1 A;  1V59 A;  2RGJ A;  1JEH A;  3HZL A;  1TDO A;  1NHS A;  2WDV A;  1JNZ A;  3IHM A;  2XLS A;  4Z2T A;  2JBV A;  3KLJ A;  4P9S A;  3UKK A;  1VG9 A;  1DP2 A;  1MO9 A;  1OJ9 A;  2R0C A;  3UKP A;  1FEC A;  3LJP A;  4J33 A;  4H2P A;  4H4Y A;  4H4T A;  2VRM A;  2EG3 A;  3Q9T A;  1EL8 A;  4I59 A;  4NNJ A;  3SY4 A;  1UAR A;  5KMQ A;  4U2L A;  1IUS A;  3UKH A;  3GD4 A;  3NK1 X;  3SFD A;  1W4X A;  2BA9 A;  2C76 A;  4GR1 A;  3C4N A;  3UKL A;  2TMD A;  2FJE A;  1N4U A;  2JAE A;  1DOB A;  3NG7 X;  2WS3 A;  3BI5 A;  3PVC A;  1GSN A;  1Q1W A;  4DNA A;  3NTA A;  1ELI A;  1MOK A;  2MOL A;  1O5W A;  2XFO A;  3G5S A;  2Z5X A;  1COY A;  2CUL A;  4XWZ A;  2BRA A;  3CND A;  4APN A;  3L8K A;  2AR8 A;  4GAP A;  1VG0 A;  2XFU A;  4U8P A;  5IQ4 A;  3BI4 A;  4AP3 A;  1PBB A;  3BNM A;  4H4R A;  1H86 A;  3ADA B;  1XHC A;  2FJA A;  3T37 A;  1LJ1 A;  3IHG A;  1UKV G;  2GB0 A;  3AEA A;  1KFY A;  4OPG A;  4CY6 A;  2IVD A;  1TYP A;  1URH A;  4ZCC A;  3R2U A;  3SFE A;  4Z43 A;  3RP6 A;  1LTX R;  1WV9 A;  2X8C A;  5BRT A;  3B6D A;  3NH3 X;  1IUT A;  1GRH A;  4DSG A;  3GDN A;  4B64 A;  1GND A;  3VRA A;  2HHG A;  1OJA A;  1OJT A;  3VRB A;  1Y56 A;  3SZC A;  2QA2 A;  3CMM A;  3AE2 A;  1TDF A;  4IVO B;  3ICR A;  2IFV A;  4NZH A;  3AWI A;  2AAQ A;  2GMJ A;  3UP4 A;  2XFQ A;  2GR1 A;  2Q82 A;  3AYJ A;  4H4U A;  3CN8 A;  5C3J A;  1T3K A;  1CWT A;  1PJ5 A;  3NHV A;  3KVE A;  3AE9 A;  3AAX A;  3TG3 A;  3D1P A;  1IUW A;  2FJB A;  3AE7 A;  2Q6U A;  4ICY A;  4X9N A;  3UP5 A;  3AD8 B;  3IWA A;  3AE4 A;  3LZX A;  4YSH A;  4U8O A;  4AT0 A;  4EQR A;  1YML A;  2APG A;  3NYE A;  1EL9 A;  2YLS A;  2B9Y A;  5HBQ A;  3AE8 A;  5ER0 A;  3GK5 A;  1IUU A;  3D8X A;  3QJ4 A;  1F8W A;  4UDP A;  5FS7 A;  4YTM A;  2WDR A;  2OAM A;  1S2Q A;  3UOX A;  5IQ1 A;  4FDC B;  1GRF A;  2YR5 A;  3SYI A;  1PJ7 A;  2XLU A;  3FLH A;  1GT8 A;  2EQ9 A;  4WX1 A;  3KPK A;  4G6G A;  4C5O A;  3QSS A;  4LA1 A;  3DGZ A;  4IV9 A;  3SZW A;  5C2T A;  4ECH A;  4YKG A;  4A79 A;  2R0P A;  2YR6 A;  1PBC A;  1Y56 B;  2IVE A;  3T2Z A;  1N4V A;  3M13 A;  1H7W A;  1BGJ A;  2WEU A;  3URH A;  2KL3 A;  2NVK X;  4CCR A;  3UTN X;  2GQF A;  3GRS A;  1B8S A;  1GET A;  1H81 A;  4H2R A;  1XAN A;  1L9D A;  4H4P A;  4U8I A;  2R0G A;  1NHR A;  1VRQ B;  5HXI A;  1GRB A;  5KMS A;  3CIR A;  3P4S A;  3GYX A;  2R4J A;  4NWZ A;  3S61 A;  3SM8 A;  2VRL A;  4H4Q A;  5JCK A;  4J31 A;  2FBW A;  2BAB A;  5KMP A;  4M52 A;  3OP3 A;  4RG4 A;  4EMJ A;  3VQR A;  4A5L A;  1H82 A;  3KU9 A;  4IA6 A;  4U8J A;  3NLC A;  4NTC A;  1GMX A;  1N4W A;  3EAN A;  5U63 A;  1AOG A;  3UOV A;  1KNR A;  2I0Z A;  4J34 A;  4BUR A;  1FEA A;  2ZBW A;  4GAV A;  1DNC A;  1PXA A;  2C3C A;  5EBK A;  4EQS A;  2C64 A;  3QSM A;  5J60 A;  3DGH A;  3NK0 X;  3F8R A;  1F8S A;  3IC9 A;  1GRE A;  5HPA A;  3CNJ A;  1ZX9 A;  2GF3 A;  2J3N A;  4NTD A;  2WOV A;  1Y0P A;  2BC1 A;  5IPY A;  3AE1 A;  4II2 A;  4B65 A;  4EMW A;  3FBS A;  2B7S A;  1DOC A;  4J2W A;  1KNP A;  1TDE A;  4RSL A;  3GYJ A;  4TM4 A;  3QFB A;  2WOI A;  1DJN A;  4B69 A;  5FS6 A;  1EL5 A;  2XFP A;  5JCL A;  1JRX A;  3NT6 A;  4AOX A;  2QAE A;  2GEW A;  2XVE A;  3P4Q A;  4H4W A;  1PJ6 A;  1B5Q A;  4E0V A;  2B9W A;  3BNU A;  1KDG A;  1H4M X;  2B76 A;  2YLR A;  4GDP A;  4ZCD A;  1B37 A;  2BK3 A;  1Q1R A;  2PHH A;  4G74 A;  3TP9 A;  1YM9 A;  1ZMD A;  5DBJ A;  4A6N B;  4NEV A;  2WET A;  2IFD A;  2V3B A;  1PN0 A;  3AEB A;  2AQJ A;  3O0H A;  2K0Z A;  1ZKQ A;  3AAY A;  2YVJ A;  1GXF A;  2C73 A;  1VQW A;  2VQ7 A;  3AE5 A;  1GPE A;  5HBL A;  2VVM A;  2O9Z A;  2GRT A;  2BYB A;  3FNJ A;  3GMB A;  4C3X A;  4YSY A;  3CPJ G;  3B3R A;  2XLP A;  3GWD A;  5KOX A;  1GRG A;  2QA1 A;  5FS8 A;  3AD9 B;  2XDO A;  1LQT A;  4TM3 A;  4BV6 A;  4C77 A;  3ATR A;  5HBO A;  5FMH A;  1IUX A;  3TG1 B;  1JRY A;  3K30 A;  4USQ A;  1KF6 A;  4I58 A;  2BS3 A;  2WU2 A;  3T31 A;  1REO A;  1FEB A;  1PDH A;  1DXL A;  3T2Y A;  3QSE A;  3RHA A;  1S3E A;  3F8P A;  3GD3 A;  2X50 A;  4YTN A;  3AEE A;  2GR3 A;  3ALJ A;  3H8L A;  4G6H A;  4OPC A;  1ZDL A;  3FG2 P;  4ADW A;  4RG3 A;  1JOA A;  2X3N A;  3T0K A;  1NEK A;  2JTQ A;  1YS0 A;  4BK3 A;  2ZZC A;  5TR3 A;  4JY3 A;  1RYI A;  1YQZ A;  2ACZ A;  2GWF A;  1NEN A;  4H2N A;  4OPI A;  1S3B A;  4Y4M A;  3KA7 A;  4U8M A;  5HY5 A;  2F5Z A;  5KOW A;  2X8G A;  1MXT A;  2YAU A;  1BKW A;  5GSN A;  1RSG A;  1IJH A;  1LQU A;  1RHD A;  4J57 A;  2C67 A;  2BXS A;  2C7G A;  3ICT A;  2VVL A;  1NHQ A;  1ZP0 A;  5EB5 A;  3ITJ A;  2WPF A;  1BOH A;  4H4X A;  4EIP A;  1D7Y A;  3P3A A;  4JNA A;  4UDR A;  4FK1 C;  3BI2 A;  5BVA A;  2WES A;  4USR A;  3P4P A;  2YR4 A;  1CC4 A;  1O94 A;  3ALL A;  1H6V A;  4B63 A;  3AYL A;  2YQU A;  3DK4 A;  1ZOY A;  4UP3 A;  3HZU A;  1GER A;  1JU2 A;  3OC4 A;  3GSI A;  3SGL A;  3UOY A;  4EQX A;  1ZY8 A;  2GV8 A;  3ILM A;  2VZ2 A;  3NGC X;  1YMD A;  2Y6Q A;  1M6I A;  2GQW A;  5HYM A;  3AYI A;  1OKG A;  2A87 A;  3CNT A;  3DJJ A;  1H7X A;  3AED A;  4PAB A;  3NIX A;  4HA6 A;  5JCM A;  1P2E A;  3E1T A;  5JCN A;  2CFY A;  5LV9 A;  1YMK A;  2OLN A;  3S5W A;  1GES A;  2GR2 A;  3NYF A;  2RAB A;  1YQ4 A;  2WQY A;  5LAO A;  1TRB A;  2BK4 A;  4FX9 A;  1GRA A;  4LU6 A;  4WCT A;  4BK2 A;  5KWF A;  4A99 A;  3NNE A;  5U25 A;  3GRT A;  3G5Q A;  1QO8 A;  3JSK A;  4TM1 A;  2WPC A;  5U1O A;  4K5R A;  1CC6 A;  4O5U A;  3IPP A;  5BUK A;  3Q6J A;  5HHF A;  5KRQ A;  2C4C A;  1CJ3 A;  4EM3 A;  1OJC A;  2VQB A;  4IA5 A;  3M12 A;  3UTH A;  2OLO A;  3SZ0 A;  4YWO A;  2JTR A;  3I2V A;  3DA1 A;  2WDQ A;  4OCG A;  3GMC A;  1O95 A;  3UTG A;  3P1W A;  2OA1 A;  2YVF A;  2BK5 A;  3I6D A;  4OPU A;  3IF9 A;  1NHP A;  4JN9 A;  2UZZ A;  1F8R A;  3DH9 A;  3IWH A;  3D1C A;  1ORB A;  3M0O A;  3P4R A;  3V3N A;  1CJ4 A;  3CGD A;  3H4K A;  2A2K A;  1QLB A;  2V5Z A;  1KSU A;  3QVR A;  2JB3 A;  3AEF A;  3NRN A;  4CRT A;  1BOI A;  5JCI A;  2DKH A;  2ORA A;  1GRT A;  1HYU A;  5HBP A;  1TDK A;  3UKF A;  2WHD A;  5KNL A;  4K5S A;  1Z6L A;  2R46 A;  1QB0 A;  4JGT A;  1SEZ A;  3NYC A;  4JQ9 A;  4CY8 A;  3DJG X;  1F6M A;  3CGC A;  1LVL A;  3NK2 X;  1HZM A;  1ZMC A;  3FPZ A;  3SXI A;  4MJW A;  3UTF A;  4BJZ A;  2Y6R A;  3K9R A;  4XXG A;  1CF3 A;  1BWC A;  4UDQ A;  3HYX A;  3BHK A;  4BK1 A;  4OPD A;  3CPI G;  1E1K A;  4CNJ A;  3H8I A;  4U8L A;  1VEE A;  2BXR A;  2FJD A;  2RGH A;  4XWR A;  2XFN A;  2BCP A;  3CGE A;  4F67 A;  1XPQ A;  4D04 A;  4H4V A;  2BS4 A;  2WBA A;  3VRD B;  3UCL A;  3ZDN A;  2CVJ A;  3AEC A;  3DME A;  1EL7 A;  2TPR A;  4JDR A;  3AB1 A;  4OVI A;  4REK A;  1C25 A;  4G73 A;  4O5Q A;  3EF6 A;  1B4V A;  2A89 A;  2E5V A;  4JNQ A;  4GCM A;  2EG4 A;  1LPF A;  1WHB A;  1PBE A;  2V61 A;  3F4A A;  3EAO A;  4YSZ A;  2GR0 A;  2GAG B;  3PS9 A;  2YWL A;  4C3Y A;  3MZZ A;  2BAC A;  1K4Q A;  1QJD A;  3EPT A;  3NKS A;  4A65 A;  2V3A A;  4DGK A;  2B7R A;  4YKF A;  1GTE A;  2V6O A;  3CTY A;  4K22 A;  2R4E A;  1DOD A;  3II4 A;  1RHS A;  1S2Y A;  2E1M A;  2YLT A;  3FIM B;  4YSX A;  4C74 A;  1H83 A;  2FSX A;  2GMH A;  1FL2 A;  4GRT A;  2JKC A;  2QCU A;  2VOU A;  3G5R A;  2OAL A;  4BJY A;  1ONF A;  4YT0 A;  5M10 A;  1NPX A;  2X99 A;  2XCG A;  3FMW A;  1CHU A;  2EQ8 A;  4B67 A;  2WOW A;  4NEW A;  4NTE A;  3V76 A;  3ATQ A;  3AE6 A;  2WP9 A;  2YLW A;  1P2H A;  3QFA A;  5CKU A;  1XDI A;  5EB4 A;  2Q0K A;  4U8K A;  2A8X A;  2WP6 A;  5FS9 A;  4TLZ A;  3K7M X;  4TLX A;  2JB1 A;  4B66 A;  1PBF A;  1M64 A;  3KPF A;  3F8D A;  1QXN A;  3GYI A;  3QVP A;  4TM0 A;  2C75 A;  3BHF A;  2R45 A;  5KVH A;  3ALM A;  1ZK7 A;  2YVG A;  3SQP A;  4HB9 A;  2EG4 B;  1JNR A;  1E0C A;  4YXD A;  1PHH A;  1TQ1 A;  2JK6 A;  2YLX A;  3FOJ A;  4U2S A;  1GOS A;  2NPX A;  3AXB A;  4J36 A;  1CL0 A;  1D7L A;  2C3D A;  4CCQ A;  3VR8 A;  2PYX A;  5L46 A;  4CNK A;  3O3W A;  1K0L A;  2ARD A;  3CNS A;  4IVM B;  5LAM A;  5EOW A;  3I3L A;  3DJD A;  2YM2 A;  4KPR A;  2ZZB A;  3CNP A;  2H88 A;  4J56 A;  2R9Z A;  1CJ2 A;  3LZW A;  1VDC A;  2WLX A;  3RED A;  3COX A;  3K7T A;  3WE0 A;  4EMI A;  2JB2 A;  3LOV A;  1KSS A;  2C70 A;  3K7Q X;  4KX6 A;  1PS9 A;  5BUL A;  1CWS A;  4H7U A;  2WLR A;  3I3U A;  4EIQ A;  4YTP A;  3V3O A;  1BZL A;  3HWI A;  3T14 A;  1YY5 A; 
#chains in the Genus database with same CATH homology
 2VVL G;  1N1P A;  2X8H A;  2XLR A;  1E39 A;  2XVF A;  2XYO A;  3HYV A;  4K8D A;  5KVI A;  5GRT A;  2YM1 A;  1GN0 A;  1E1M A;  1NG3 A;  4H2Q A;  4H50 A;  3OLH A;  1CJC A;  4A7A A;  1GV4 A;  4Z24 A;  3RP8 A;  2WPE A;  3UOZ A;  3HIX A;  2GAH B;  4Y4N A;  3RNM A;  4A9W A;  2ZZ0 A;  1YQ3 A;  1E1N A;  4K7Z A;  2Q7V A;  2C72 A;  1CWR A;  3GDP A;  1L9E A;  4LII A;  4B1B A;  2C66 A;  3IPO A;  4GDE A;  2CDU A;  1GEU A;  2BRY A;  2YG7 A;  3KD9 A;  3P9U A;  3UKQ A;  1TDN A;  2YG6 A;  3NN6 X;  1L0V A;  1Q9I A;  2V60 A;  1TYT A;  3T2K A;  1YT8 A;  1E1L A;  3ICS A;  3C4A A;  3VR9 A;  1DJQ A;  2EQ6 A;  1PXC A;  4Z2U A;  4K2X A;  4OPT A;  1BGN A;  3DJE A;  1FCD A;  2XVI A;  2GVC A;  2YG4 A;  2XVH A;  1D4D A;  3NTD A;  4G9K A;  3ZYX A;  2OUC A;  1L9C A;  2YLZ A;  2RGO A;  4H4Z A;  5M0Z A;  1NDA A;  1FOH A;  4U2T A;  1GTH A;  3AEG A;  2EQ7 A;  4GUV A;  4B68 A;  2GH5 A;  1EBD A;  1PXB A;  2YG5 A;  1YKJ A;  1K0J A;  1DOE A;  1E6E A;  5J7X A;  4AOS A;  3NN0 X;  4FK1 A;  3R9U A;  2WU5 A;  3AD7 B;  2J6P A;  2BS2 A;  2YG3 A;  3LB8 A;  1E7P A;  1OJD A;  1RP0 A;  3SX6 A;  1NAA A;  4U8N A;  4II3 A;  2BC0 A;  2DKI A;  3SZF A;  3KKJ A;  1ZOV A;  3HYW A;  3OZ2 A;  2W0H A;  5KMR A;  2DCQ A;  2Q0L A;  1JRZ A;  1PBD A;  2IID A;  3G5J A;  1IUV A;  3DK9 A;  3CGB A;  4WH9 A;  1CBO A;  2BCG G;  1X31 B;  3ISH A;  2C65 A;  3GWF A;  2UZQ A;  4Z44 A;  2VSW A;  3UKA A;  1GAL A;  2Z5Y A;  1D5T A;  4EQW A;  3DK8 A;  4D03 A;  5CQF A;  1H84 A;  3RP7 A;  4X4J A;  3ABV A;  1D4E A;  3NHO X;  4N9X A;  4AT2 A;  1H4K X;  2XLT A;  1BF3 A;  4PAA A;  4CBQ A;  4Y4L A;  2HQM A;  3UTE A;  1F3P A;  2XVJ A;  3C96 A;  4JY2 A;  4EM4 A;  4ZN0 A;  4X9M A;  4Z26 A;  2MOI A;  1CC2 A;  2MRM A;  3LXD A;  3CPH G;  3LAD A;  4Z25 A;  2JTS A;  1NG4 A;  3AE3 A;  4DSH A;  3PO7 A;  5KXJ A;  4A6N A;  3L1R A;  4GF7 A;  2B9X A;  4H4S A;  1K0I A;  4OPL A;  2H89 A;  2WP5 A;  2E4G A;  1LV0 A;  4Z2R A;  3FS5 A;  4WH7 A;  1D4C A;  4AP1 A;  1V59 A;  2RGJ A;  1JEH A;  3HZL A;  1TDO A;  1NHS A;  2WDV A;  1JNZ A;  3IHM A;  2XLS A;  4Z2T A;  2JBV A;  3KLJ A;  4P9S A;  3UKK A;  1VG9 A;  1DP2 A;  1MO9 A;  1OJ9 A;  2R0C A;  3UKP A;  1FEC A;  3LJP A;  4J33 A;  4H2P A;  4H4Y A;  4H4T A;  2VRM A;  2EG3 A;  3Q9T A;  1EL8 A;  4I59 A;  4NNJ A;  3SY4 A;  1UAR A;  5KMQ A;  4U2L A;  1IUS A;  3UKH A;  3GD4 A;  3NK1 X;  3SFD A;  1W4X A;  2BA9 A;  2C76 A;  4GR1 A;  3C4N A;  3UKL A;  2TMD A;  2FJE A;  1N4U A;  2JAE A;  1DOB A;  3NG7 X;  2WS3 A;  3BI5 A;  3PVC A;  1GSN A;  1Q1W A;  4DNA A;  3NTA A;  1ELI A;  1MOK A;  2MOL A;  1O5W A;  2XFO A;  3G5S A;  2Z5X A;  1COY A;  2CUL A;  4XWZ A;  2BRA A;  3CND A;  4APN A;  3L8K A;  2AR8 A;  4GAP A;  1VG0 A;  2XFU A;  4U8P A;  5IQ4 A;  3BI4 A;  4AP3 A;  1PBB A;  3BNM A;  4H4R A;  1H86 A;  3ADA B;  1XHC A;  2FJA A;  3T37 A;  1LJ1 A;  3IHG A;  1UKV G;  2GB0 A;  3AEA A;  1KFY A;  4OPG A;  4CY6 A;  2IVD A;  1TYP A;  1URH A;  4ZCC A;  3R2U A;  3SFE A;  4Z43 A;  3RP6 A;  1LTX R;  1WV9 A;  2X8C A;  5BRT A;  3B6D A;  3NH3 X;  1IUT A;  1GRH A;  4DSG A;  3GDN A;  4B64 A;  1GND A;  3VRA A;  2HHG A;  1OJA A;  1OJT A;  3VRB A;  1Y56 A;  3SZC A;  2QA2 A;  3CMM A;  3AE2 A;  1TDF A;  4IVO B;  3ICR A;  2IFV A;  4NZH A;  3AWI A;  2AAQ A;  2GMJ A;  3UP4 A;  2XFQ A;  2GR1 A;  3AYJ A;  4H4U A;  3CN8 A;  5C3J A;  1T3K A;  1CWT A;  1PJ5 A;  3NHV A;  3KVE A;  3AE9 A;  3AAX A;  3TG3 A;  3D1P A;  1IUW A;  2FJB A;  3AE7 A;  2Q6U A;  4ICY A;  4X9N A;  3UP5 A;  3AD8 B;  3IWA A;  3AE4 A;  3LZX A;  4YSH A;  4U8O A;  4AT0 A;  4EQR A;  1YML A;  2APG A;  3NYE A;  1EL9 A;  2YLS A;  2B9Y A;  5HBQ A;  3AE8 A;  5ER0 A;  3GK5 A;  1IUU A;  3D8X A;  3QJ4 A;  1F8W A;  4UDP A;  5FS7 A;  4YTM A;  2WDR A;  2OAM A;  1S2Q A;  3UOX A;  5IQ1 A;  4FDC B;  1GRF A;  2YR5 A;  3SYI A;  1PJ7 A;  2XLU A;  3FLH A;  1GT8 A;  2EQ9 A;  4WX1 A;  3KPK A;  4G6G A;  4C5O A;  3QSS A;  4LA1 A;  3DGZ A;  4IV9 A;  3SZW A;  5C2T A;  4ECH A;  4YKG A;  4A79 A;  2R0P A;  2YR6 A;  1PBC A;  1Y56 B;  2IVE A;  3T2Z A;  1N4V A;  3M13 A;  1H7W A;  1BGJ A;  2WEU A;  3URH A;  2KL3 A;  2NVK X;  4CCR A;  3UTN X;  2GQF A;  3GRS A;  1B8S A;  1GET A;  1H81 A;  4H2R A;  1XAN A;  1L9D A;  4H4P A;  4U8I A;  2R0G A;  1NHR A;  1VRQ B;  5HXI A;  1GRB A;  5KMS A;  3CIR A;  3P4S A;  3GYX A;  2R4J A;  4NWZ A;  3S61 A;  3SM8 A;  2VRL A;  4H4Q A;  5JCK A;  4J31 A;  2FBW A;  2BAB A;  5KMP A;  4M52 A;  3OP3 A;  4RG4 A;  4EMJ A;  3VQR A;  4A5L A;  1H82 A;  3KU9 A;  4IA6 A;  4U8J A;  3NLC A;  4NTC A;  1GMX A;  1N4W A;  3EAN A;  5U63 A;  1AOG A;  3UOV A;  1KNR A;  2I0Z A;  4J34 A;  4BUR A;  1FEA A;  2ZBW A;  4GAV A;  1DNC A;  1PXA A;  2C3C A;  5EBK A;  4EQS A;  2C64 A;  3QSM A;  5J60 A;  3DGH A;  3NK0 X;  3F8R A;  1F8S A;  3IC9 A;  1GRE A;  5HPA A;  3CNJ A;  1ZX9 A;  2GF3 A;  2J3N A;  4NTD A;  2WOV A;  1Y0P A;  2BC1 A;  5IPY A;  3AE1 A;  4II2 A;  4B65 A;  4EMW A;  3FBS A;  2B7S A;  1DOC A;  4J2W A;  1KNP A;  1TDE A;  4RSL A;  3GYJ A;  4TM4 A;  3QFB A;  2WOI A;  1DJN A;  4B69 A;  5FS6 A;  1EL5 A;  2XFP A;  5JCL A;  1JRX A;  3NT6 A;  4AOX A;  2QAE A;  2GEW A;  2XVE A;  3P4Q A;  4H4W A;  1PJ6 A;  1B5Q A;  4E0V A;  2B9W A;  3BNU A;  1KDG A;  1H4M X;  2B76 A;  2YLR A;  4GDP A;  4ZCD A;  1B37 A;  2BK3 A;  1Q1R A;  2PHH A;  4G74 A;  3TP9 A;  1YM9 A;  1ZMD A;  5DBJ A;  4A6N B;  4NEV A;  2WET A;  2IFD A;  2V3B A;  1PN0 A;  3AEB A;  2AQJ A;  3O0H A;  2K0Z A;  1ZKQ A;  3AAY A;  2YVJ A;  1GXF A;  2C73 A;  1VQW A;  2VQ7 A;  3AE5 A;  1GPE A;  5HBL A;  2VVM A;  2O9Z A;  2GRT A;  2BYB A;  3FNJ A;  3GMB A;  4C3X A;  4YSY A;  3CPJ G;  3B3R A;  2XLP A;  3GWD A;  5KOX A;  1GRG A;  2QA1 A;  5FS8 A;  3AD9 B;  2XDO A;  1LQT A;  4TM3 A;  4BV6 A;  4C77 A;  3ATR A;  5HBO A;  5FMH A;  1IUX A;  3TG1 B;  1JRY A;  3K30 A;  4USQ A;  1KF6 A;  4I58 A;  2BS3 A;  2WU2 A;  3T31 A;  1REO A;  1FEB A;  1PDH A;  1DXL A;  3T2Y A;  3QSE A;  3RHA A;  1S3E A;  3F8P A;  3GD3 A;  2X50 A;  4YTN A;  3AEE A;  2GR3 A;  3ALJ A;  3H8L A;  4G6H A;  4OPC A;  1ZDL A;  3FG2 P;  4ADW A;  4RG3 A;  1JOA A;  2X3N A;  3T0K A;  1NEK A;  2JTQ A;  1YS0 A;  4BK3 A;  2ZZC A;  5TR3 A;  4JY3 A;  1RYI A;  1YQZ A;  2ACZ A;  2GWF A;  1NEN A;  4H2N A;  4OPI A;  1S3B A;  4Y4M A;  3KA7 A;  4U8M A;  5HY5 A;  2F5Z A;  5KOW A;  2X8G A;  1MXT A;  2YAU A;  1BKW A;  5GSN A;  1RSG A;  1IJH A;  1LQU A;  1RHD A;  4J57 A;  2C67 A;  2BXS A;  2C7G A;  3ICT A;  2VVL A;  1NHQ A;  1ZP0 A;  5EB5 A;  3ITJ A;  2WPF A;  1BOH A;  4H4X A;  4EIP A;  1D7Y A;  3P3A A;  4JNA A;  4UDR A;  4FK1 C;  3BI2 A;  5BVA A;  2WES A;  4USR A;  3P4P A;  2YR4 A;  1CC4 A;  1O94 A;  3ALL A;  1H6V A;  4B63 A;  3AYL A;  2YQU A;  3DK4 A;  1ZOY A;  4UP3 A;  3HZU A;  1GER A;  1JU2 A;  3OC4 A;  3GSI A;  3SGL A;  3UOY A;  4EQX A;  1ZY8 A;  2GV8 A;  3ILM A;  2VZ2 A;  3NGC X;  1YMD A;  2Y6Q A;  1M6I A;  2GQW A;  5HYM A;  3AYI A;  1OKG A;  2A87 A;  3CNT A;  3DJJ A;  1H7X A;  3AED A;  4PAB A;  3NIX A;  4HA6 A;  5JCM A;  1P2E A;  3E1T A;  5JCN A;  2CFY A;  5LV9 A;  1YMK A;  2OLN A;  3S5W A;  1GES A;  2GR2 A;  3NYF A;  2RAB A;  1YQ4 A;  2WQY A;  5LAO A;  1TRB A;  2BK4 A;  4FX9 A;  1GRA A;  4LU6 A;  4WCT A;  4BK2 A;  5KWF A;  4A99 A;  3NNE A;  5U25 A;  3GRT A;  3G5Q A;  1QO8 A;  3JSK A;  4TM1 A;  2WPC A;  5U1O A;  4K5R A;  1CC6 A;  4O5U A;  3IPP A;  5BUK A;  3Q6J A;  5HHF A;  5KRQ A;  2C4C A;  1CJ3 A;  4EM3 A;  1OJC A;  2VQB A;  4IA5 A;  3M12 A;  3UTH A;  2OLO A;  3SZ0 A;  4YWO A;  2JTR A;  3I2V A;  3DA1 A;  2WDQ A;  4OCG A;  3GMC A;  1O95 A;  3UTG A;  3P1W A;  2OA1 A;  2YVF A;  2BK5 A;  3I6D A;  4OPU A;  3IF9 A;  1NHP A;  4JN9 A;  2UZZ A;  1F8R A;  3DH9 A;  3IWH A;  3D1C A;  1ORB A;  3M0O A;  3P4R A;  3V3N A;  1CJ4 A;  3CGD A;  3H4K A;  2A2K A;  1QLB A;  2V5Z A;  1KSU A;  3QVR A;  2JB3 A;  3AEF A;  3NRN A;  4CRT A;  1BOI A;  5JCI A;  2DKH A;  2ORA A;  1GRT A;  1HYU A;  5HBP A;  1TDK A;  3UKF A;  2WHD A;  5KNL A;  4K5S A;  1Z6L A;  2R46 A;  1QB0 A;  4JGT A;  1SEZ A;  3NYC A;  4JQ9 A;  4CY8 A;  3DJG X;  1F6M A;  3CGC A;  1LVL A;  3NK2 X;  1HZM A;  1ZMC A;  3FPZ A;  3SXI A;  4MJW A;  3UTF A;  4BJZ A;  2Y6R A;  3K9R A;  4XXG A;  1CF3 A;  1BWC A;  4UDQ A;  3HYX A;  3BHK A;  4BK1 A;  4OPD A;  3CPI G;  1E1K A;  4CNJ A;  3H8I A;  4U8L A;  1VEE A;  2BXR A;  2FJD A;  2RGH A;  4XWR A;  2XFN A;  2BCP A;  3CGE A;  4F67 A;  1XPQ A;  4D04 A;  4H4V A;  2BS4 A;  2WBA A;  3VRD B;  3UCL A;  3ZDN A;  2CVJ A;  3AEC A;  3DME A;  1EL7 A;  2TPR A;  4JDR A;  3AB1 A;  4OVI A;  4REK A;  1C25 A;  4G73 A;  4O5Q A;  3EF6 A;  1B4V A;  2A89 A;  2E5V A;  4JNQ A;  4GCM A;  2EG4 A;  1LPF A;  1WHB A;  1PBE A;  2V61 A;  3F4A A;  3EAO A;  4YSZ A;  2GR0 A;  2GAG B;  3PS9 A;  2YWL A;  4C3Y A;  3MZZ A;  2BAC A;  1K4Q A;  1QJD A;  3EPT A;  3NKS A;  4A65 A;  2V3A A;  4DGK A;  2B7R A;  4YKF A;  1GTE A;  2V6O A;  3CTY A;  4K22 A;  2R4E A;  1DOD A;  3II4 A;  1RHS A;  1S2Y A;  2E1M A;  2YLT A;  3FIM B;  4YSX A;  4C74 A;  1H83 A;  2FSX A;  2GMH A;  1FL2 A;  4GRT A;  2JKC A;  2QCU A;  2VOU A;  3G5R A;  2OAL A;  4BJY A;  1ONF A;  4YT0 A;  5M10 A;  1NPX A;  2X99 A;  2XCG A;  3FMW A;  1CHU A;  2EQ8 A;  4B67 A;  2WOW A;  4NEW A;  4NTE A;  3V76 A;  3ATQ A;  3AE6 A;  2WP9 A;  2YLW A;  1P2H A;  3QFA A;  5CKU A;  1XDI A;  5EB4 A;  2Q0K A;  4U8K A;  2A8X A;  2WP6 A;  5FS9 A;  4TLZ A;  3K7M X;  4TLX A;  2JB1 A;  4B66 A;  1PBF A;  1M64 A;  3KPF A;  3F8D A;  1QXN A;  3GYI A;  3QVP A;  4TM0 A;  2C75 A;  3BHF A;  2R45 A;  5KVH A;  3ALM A;  1ZK7 A;  2YVG A;  3SQP A;  4HB9 A;  2EG4 B;  1JNR A;  1E0C A;  4YXD A;  1PHH A;  1TQ1 A;  2JK6 A;  2YLX A;  3FOJ A;  4U2S A;  1GOS A;  2NPX A;  3AXB A;  4J36 A;  1CL0 A;  1D7L A;  2C3D A;  4CCQ A;  3VR8 A;  2PYX A;  5L46 A;  4CNK A;  3O3W A;  1K0L A;  2ARD A;  3CNS A;  4IVM B;  5LAM A;  5EOW A;  3I3L A;  3DJD A;  2YM2 A;  4KPR A;  2ZZB A;  3CNP A;  2H88 A;  4J56 A;  2R9Z A;  1CJ2 A;  3LZW A;  1VDC A;  2WLX A;  3RED A;  3COX A;  3K7T A;  3WE0 A;  4EMI A;  2JB2 A;  3LOV A;  1KSS A;  2C70 A;  3K7Q X;  4KX6 A;  1PS9 A;  5BUL A;  1CWS A;  4H7U A;  2WLR A;  3I3U A;  4EIQ A;  4YTP A;  3V3O A;  1BZL A;  3HWI A;  3T14 A;  1YY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...