1URHA

The "rhodanese" fold and catalytic mechanism of 3-mercaptopyruvate sulfotransferases: crystal structure of ssea from escherichia coli
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
266
structure length
261
Chain Sequence
TTWFVGADWLAEHIDDPEIQIIDARMASPGQEDRNVAQEYLNGHIPGAVFFDIEALSDHTSPLPHMLPRPETFAVAMRELGVNQDKHLIVYDEGNLFSAPRAWWMLRTFGVEKVSILGGGLAGWQRDDLLLEEGAVELPEGEFNAAFNPEAVVKVTDVLLASHENTAQIIDARPAARFNAEVDELRRGHIPGALNVPWTELVREGELKTTDELDAIFFGRGVSYDKPIIVSGSGVTAAVVLLALATLDVPNVKLYDGAWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-MERCAPTOPYRUVATE SULFURTRANSFERASE
publication title The "Rhodanese" Fold and Catalytic Mechanism of 3-Mercaptopyruvate Sulfurtransferases: Crystal Structure of Ssea from Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
total genus 70
structure length 261
sequence length 266
chains with identical sequence B
ec nomenclature ec 2.8.1.2: 3-mercaptopyruvate sulfurtransferase.
pdb deposition date 2003-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 1urhA01
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 1urhA02
1QB0A 3I3UA 3OP3A 3D1PA 3ICSA 3TP9A 2IFDA 1H4KX 1HZMA 2ORAA 2EG4B 2EG4A 3ICTA 1YMLA 5LAMA 2DCQA 3FNJA 3I2VA 3NTDA 1CWTA 1RHSA 1CWRA 3HIXA 1E0CA 2UZQA 2MRMA 1YT8A 1GMXA 3G5JA 5HBPA 2JTQA 4WH7A 3TG1B 2IFVA 5HPAA 2FSXA 1GN0A 1DP2A 4JGTA 3IWHA 5HBLA 1YMKA 2KL3A 2K0ZA 3F4AA 1WHBA 3OLHA 1TQ1A 2A2KA 1OKGA 2JTRA 1T3KA 1YMDA 1H4MX 3GK5A 3AAYA 1BOHA 2GWFA 2WLRA 1URHA 2EG3A 3IPPA 3FOJA 2JTSA 4OCGA 3HWIA 1WV9A 1UARA 3NT6A 2HHGA 3IPOA 4F67A 3NHVA 3TG3A 3FLHA 2MOIA 5LAOA 2VSWA 3UTNX 3FS5A 3NTAA 3AAXA 2J6PA 3R2UA 3ILMA 5HBQA 2OUCA 3K9RA 2WLXA 1YS0A 1VEEA 1CWSA 3P3AA 3ICRA 1YM9A 1QXNA 1BOIA 1C25A 3MZZA 5HBOA 2MOLA 3O3WA 3HZUA 1RHDA 1ORBA 4WH9A
chains in the Genus database with same CATH superfamily
1QB0A 3I3UA 3OP3A 3D1PA 3ICSA 3TP9A 2IFDA 1H4KX 1HZMA 2ORAA 2EG4B 2EG4A 3ICTA 1YMLA 5LAMA 2DCQA 3FNJA 3I2VA 3NTDA 1CWTA 1RHSA 1CWRA 3HIXA 1E0CA 2UZQA 2MRMA 1YT8A 1GMXA 3G5JA 5HBPA 2JTQA 4WH7A 3TG1B 2IFVA 5HPAA 2FSXA 1GN0A 1DP2A 4JGTA 3IWHA 5HBLA 1YMKA 2KL3A 2K0ZA 3F4AA 1WHBA 3OLHA 1TQ1A 2A2KA 1OKGA 2JTRA 1T3KA 1YMDA 1H4MX 3GK5A 3AAYA 1BOHA 2GWFA 2WLRA 1URHA 2EG3A 3IPPA 3FOJA 2JTSA 4OCGA 3HWIA 1WV9A 1UARA 3NT6A 2HHGA 3IPOA 4F67A 3NHVA 3TG3A 3FLHA 2MOIA 5LAOA 2VSWA 3UTNX 3FS5A 3NTAA 3AAXA 2J6PA 3R2UA 3ILMA 5HBQA 2Q82A 2OUCA 3K9RA 2WLXA 1YS0A 1VEEA 1CWSA 3P3AA 3ICRA 1YM9A 1QXNA 1BOIA 1C25A 3MZZA 5HBOA 2MOLA 3O3WA 3HZUA 1RHDA 1ORBA 4WH9A
chains in the Genus database with same CATH topology
1QB0A 3I3UA 3OP3A 3D1PA 3ICSA 3TP9A 2IFDA 1H4KX 1HZMA 2ORAA 2EG4B 2EG4A 3ICTA 1YMLA 5LAMA 2DCQA 3FNJA 3I2VA 3NTDA 1CWTA 1RHSA 1CWRA 3HIXA 1E0CA 2UZQA 2MRMA 1YT8A 1GMXA 3G5JA 5HBPA 2JTQA 4WH7A 3TG1B 2IFVA 5HPAA 2FSXA 1GN0A 1DP2A 4JGTA 3IWHA 5HBLA 1YMKA 2KL3A 2K0ZA 3F4AA 1WHBA 3OLHA 1TQ1A 2A2KA 1OKGA 2JTRA 1T3KA 1YMDA 1H4MX 3GK5A 3AAYA 1BOHA 2GWFA 2WLRA 1URHA 2EG3A 3IPPA 3FOJA 2JTSA 4OCGA 3HWIA 1WV9A 1UARA 3NT6A 2HHGA 3IPOA 4F67A 3NHVA 3TG3A 3FLHA 2MOIA 5LAOA 2VSWA 3UTNX 3FS5A 3NTAA 3AAXA 2J6PA 3R2UA 3ILMA 5HBQA 2OUCA 3K9RA 2WLXA 1YS0A 1VEEA 1CWSA 3P3AA 3ICRA 1YM9A 1QXNA 1BOIA 1C25A 3MZZA 5HBOA 2MOLA 3O3WA 3HZUA 1RHDA 1ORBA 4WH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QB0 A;  3I3U A;  3OP3 A;  3D1P A;  3ICS A;  3TP9 A;  2IFD A;  1H4K X;  1HZM A;  2ORA A;  2EG4 B;  2EG4 A;  3ICT A;  1YML A;  5LAM A;  2DCQ A;  3FNJ A;  3I2V A;  3NTD A;  1CWT A;  1RHS A;  1CWR A;  3HIX A;  1E0C A;  2UZQ A;  2MRM A;  1YT8 A;  1GMX A;  3G5J A;  5HBP A;  2JTQ A;  4WH7 A;  3TG1 B;  2IFV A;  5HPA A;  2FSX A;  1GN0 A;  1DP2 A;  4JGT A;  3IWH A;  5HBL A;  1YMK A;  2KL3 A;  2K0Z A;  3F4A A;  1WHB A;  3OLH A;  1TQ1 A;  2A2K A;  1OKG A;  2JTR A;  1T3K A;  1YMD A;  1H4M X;  3GK5 A;  3AAY A;  1BOH A;  2GWF A;  2WLR A;  1URH A;  2EG3 A;  3IPP A;  3FOJ A;  2JTS A;  4OCG A;  3HWI A;  1WV9 A;  1UAR A;  3NT6 A;  2HHG A;  3IPO A;  4F67 A;  3NHV A;  3TG3 A;  3FLH A;  2MOI A;  5LAO A;  2VSW A;  3UTN X;  3FS5 A;  3NTA A;  3AAX A;  2J6P A;  3R2U A;  3ILM A;  5HBQ A;  2OUC A;  3K9R A;  2WLX A;  1YS0 A;  1VEE A;  1CWS A;  3P3A A;  3ICR A;  1YM9 A;  1QXN A;  1BOI A;  1C25 A;  3MZZ A;  5HBO A;  2MOL A;  3O3W A;  3HZU A;  1RHD A;  1ORB A;  4WH9 A; 
#chains in the Genus database with same CATH topology
 1QB0 A;  3I3U A;  3OP3 A;  3D1P A;  3ICS A;  3TP9 A;  2IFD A;  1H4K X;  1HZM A;  2ORA A;  2EG4 B;  2EG4 A;  3ICT A;  1YML A;  5LAM A;  2DCQ A;  3FNJ A;  3I2V A;  3NTD A;  1CWT A;  1RHS A;  1CWR A;  3HIX A;  1E0C A;  2UZQ A;  2MRM A;  1YT8 A;  1GMX A;  3G5J A;  5HBP A;  2JTQ A;  4WH7 A;  3TG1 B;  2IFV A;  5HPA A;  2FSX A;  1GN0 A;  1DP2 A;  4JGT A;  3IWH A;  5HBL A;  1YMK A;  2KL3 A;  2K0Z A;  3F4A A;  1WHB A;  3OLH A;  1TQ1 A;  2A2K A;  1OKG A;  2JTR A;  1T3K A;  1YMD A;  1H4M X;  3GK5 A;  3AAY A;  1BOH A;  2GWF A;  2WLR A;  1URH A;  2EG3 A;  3IPP A;  3FOJ A;  2JTS A;  4OCG A;  3HWI A;  1WV9 A;  1UAR A;  3NT6 A;  2HHG A;  3IPO A;  4F67 A;  3NHV A;  3TG3 A;  3FLH A;  2MOI A;  5LAO A;  2VSW A;  3UTN X;  3FS5 A;  3NTA A;  3AAX A;  2J6P A;  3R2U A;  3ILM A;  5HBQ A;  2Q82 A;  2OUC A;  3K9R A;  2WLX A;  1YS0 A;  1VEE A;  1CWS A;  3P3A A;  3ICR A;  1YM9 A;  1QXN A;  1BOI A;  1C25 A;  3MZZ A;  5HBO A;  2MOL A;  3O3W A;  3HZU A;  1RHD A;  1ORB A;  4WH9 A; 
#chains in the Genus database with same CATH homology
 1QB0 A;  3I3U A;  3OP3 A;  3D1P A;  3ICS A;  3TP9 A;  2IFD A;  1H4K X;  1HZM A;  2ORA A;  2EG4 B;  2EG4 A;  3ICT A;  1YML A;  5LAM A;  2DCQ A;  3FNJ A;  3I2V A;  3NTD A;  1CWT A;  1RHS A;  1CWR A;  3HIX A;  1E0C A;  2UZQ A;  2MRM A;  1YT8 A;  1GMX A;  3G5J A;  5HBP A;  2JTQ A;  4WH7 A;  3TG1 B;  2IFV A;  5HPA A;  2FSX A;  1GN0 A;  1DP2 A;  4JGT A;  3IWH A;  5HBL A;  1YMK A;  2KL3 A;  2K0Z A;  3F4A A;  1WHB A;  3OLH A;  1TQ1 A;  2A2K A;  1OKG A;  2JTR A;  1T3K A;  1YMD A;  1H4M X;  3GK5 A;  3AAY A;  1BOH A;  2GWF A;  2WLR A;  1URH A;  2EG3 A;  3IPP A;  3FOJ A;  2JTS A;  4OCG A;  3HWI A;  1WV9 A;  1UAR A;  3NT6 A;  2HHG A;  3IPO A;  4F67 A;  3NHV A;  3TG3 A;  3FLH A;  2MOI A;  5LAO A;  2VSW A;  3UTN X;  3FS5 A;  3NTA A;  3AAX A;  2J6P A;  3R2U A;  3ILM A;  5HBQ A;  2OUC A;  3K9R A;  2WLX A;  1YS0 A;  1VEE A;  1CWS A;  3P3A A;  3ICR A;  1YM9 A;  1QXN A;  1BOI A;  1C25 A;  3MZZ A;  5HBO A;  2MOL A;  3O3W A;  3HZU A;  1RHD A;  1ORB A;  4WH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...