4OCGA

Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase f161a mutant
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
565
structure length
565
Chain Sequence
MKKILIIGGVAGGASAAARARRLSETAEIIMFERGEYVSFANCGLPYHISGEIAQRSALVLQTPESFKARFNVEVRVKHEVVAIDRAAKLVTVRRLLDGSEYQESYDTLLLSPGAAPIVPPIPGVDNPLTHSLRNIPDMDRILQTIQMNNVEHATVVGGGAIGLEMMESLHHLGIKTTLLELADQVMTPVDREMAGFAHQAIRDQGVDLRLGTALSEVSYQVQTHVASDAAGEDTAHQHIKGHLSLTLSNGELLETDLLIMAIGVRPETQLARDAGLAIGELGGIKVNAMMQTSDPAIYAVGDAVEEQDFVTGQACLVPLAGPANRQGRMAADNMFGREERYQGTQGTAICKVFDLAVGATGKNEKQLKQAGIAFEKVYVHTASHASYYPGAEVVSFKLLFDPVKGTIFGAQAVGKDGIDKRIDVMAVAQRAGMTVEQLQHLELSYAPPYGSAKDVINQAAFVASNIIKGDATPIHFDQIDNLSEDQLLLDVRNPGELQNGGLEGAVNIPVDELRDRMHELPKDKEIIIFCQVGLRGNVAYRQLVNNGYRARNLIGGYRTYKFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FAD-dependent pyridine nucleotide-disulphide oxidoreductase
publication title Characterization of the mechanism of the NADH-dependent polysulfide reductase (Npsr) from Shewanella loihica PV-4: Formation of a productive NADH-enzyme complex and its role in the general mechanism of NADH and FAD-dependent enzymes.
pubmed doi rcsb
source organism Shewanella loihica
molecule tags Oxidoreductase
total genus 185
structure length 565
sequence length 565
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 4ocgA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ocgA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ocgA01
4WH9A 1L9CA 4USQA 3AB1A 3KPFA 2JTRA 2R0PA 5GRTA 3UKKA 3I3LA 3QSSA 1E1NA 4Z24A 2XLPA 2KL3A 1PBDA 1S2QA 3FS5A 3DMEA 1IUXA 1ZMDA 2EQ7A 4WX1A 4H4RA 1F8SA 2O9ZA 3UOXA 5FMHA 4EMJA 2RGJA 2ZBWA 1PBCA 2FSXA 1P2EA 2J3NA 4B65A 2BK5A 3G5RA 1H7WA 1KNRA 2B7SA 2BCPA 3GYIA 3VRAA 2WHDA 3ALLA 2UZZA 1RSGA 2CULA 4JNQA 2YLZA 4AOSA 2WU2A 2WBAA 4AP1A 2Y6RA 4AP3A 1P2HA 1GETA 1H6VA 3H4KA 2E5VA 4JN9A 2OLNA 3H8IA 1GMXA 4OCGA 2BACA 3LB8A 2V3BA 3LZXA 1WV9A 4RSLA 4H2PA 1YM9A 4UP3A 3R9UA 3LZWA 1NEKA 2YVGA 2YG4A 2B76A 1DOEA 2VRMA 4PAAA 1CC6A 3DGZA 2Z5YA 3C4AA 3IHGA 2MOIA 3HZLA 1BWCA 4I59A 4K5RA 1IUUA 2WOVA 4K8DA 2GB0A 4UDQA 5GSNA 1CJCA 2R45A 3NGCX 2JK6A 2EG3A 2C66A 3OZ2A 3NHOX 4Y4MA 1NG4A 4JGTA 3BI2A 2NVKX 4Z43A 4U8LA 3NH3X 2XCGA 1TYTA 3DJJA 2OALA 4YKGA 3NTAA 1CWTA 3SFEA 1EBDA 1CWSA 2BS3A 3AECA 1RYIA 3II4A 2Y6QA 4H2QA 1HYUA 4U8NA 1NPXA 3TG1B 3AE7A 1LTXR 4H4XA 3DA1A 3CNDA 4EQSA 2I0ZA 1ELIA 4YTMA 5IQ4A 5FS6A 5L46A 3E1TA 2C7GA 4WCTA 1VEEA 3PVCA 1DOBA 2BK4A 4LIIA 4O5QA 2GR0A 2X8CA 1LVLA 4A6NB 4NZHA 4CBQA 4J33A 5BUKA 3HIXA 4TM1A 4NTDA 4X4JA 4I58A 1WHBA 2YG6A 2IVEA 3I3UA 2UZQA 1PS9A 2YLWA 3GMCA 1D7LA 5JCLA 2WETA 2XFOA 3DH9A 3R2UA 3LXDA 2BS2A 4B63A 2ZZCA 5HHFA 3UKHA 4B64A 2YM2A 2VQBA 1ONFA 1JNZA 2WPEA 2YLXA 3DJEA 2GQFA 4EM4A 4NEWA 4XXGA 1BGJA 4C5OA 4FDCB 1E39A 2JAEA 2XVIA 1DJQA 1K0LA 4RG4A 2C70A 2C64A 1CBOA 3ATQA 4H4QA 4H4TA 4YSYA 4PABA 2XFUA 3UOVA 4J57A 5LAMA 3IPOA 1Q1RA 2YG3A 3CTYA 4YKFA 3EPTA 3K9RA 3REDA 3KA7A 1JEHA 2CVJA 2FBWA 2XFNA 4OPUA 3O3WA 2EG4A 1GTHA 2TPRA 3CGDA 5M0ZA 5U1OA 3CNTA 2JB1A 3CPHG 1Q9IA 4HA6A 4B67A 3K7TA 2GAGB 4H7UA 2PYXA 2YQUA 5EB4A 1GTEA 4HB9A 3MZZA 3P9UA 3UKFA 4JY3A 4H2RA 4BK1A 3AEAA 1E1MA 4CY6A 3CNSA 4O5UA 3GRTA 1TDNA 3CN8A 5JCNA 4GDPA 1YQ4A 3NG7X 2C3CA 3NK2X 1NHSA 2R46A 3KD9A 3FNJA 2OA1A 3IHMA 3EF6A 1GERA 1FEAA 4A5LA 3ADAB 1E7PA 1DODA 3PO7A 2ZZBA 1MOKA 1RHDA 3UP4A 2R0CA 4ICYA 2BC0A 2Q7VA 3NN0X 1PXAA 4MJWA 1DXLA 1KSSA 1DNCA 3KU9A 1EL5A 2ACZA 2OUCA 3T37A 1GALA 5HY5A 3EAOA 4K7ZA 1GT8A 3RP8A 3O0HA 4UDPA 3FMWA 1COYA 2XDOA 3JSKA 4TM0A 1F3PA 4LA1A 4DNAA 1CJ3A 3V3OA 3SGLA 3NTDA 2CFYA 3S5WA 3IWHA 5HBOA 1IUTA 2YM1A 2YR4A 2XVEA 1TDFA 2WDVA 1AOGA 1KNPA 3BNUA 3K7MX 3NK1X 1PXBA 4TLXA 3V76A 2JTSA 2FJEA 4YT0A 2BS4A 3QSEA 2WU5A 3AE6A 3CPJG 1YS0A 2R4JA 2V3AA 4X9MA 3H8LA 5DBJA 4CCRA 3V3NA 1VG9A 3P3AA 2BA9A 3BI4A 3KLJA 3M13A 3AXBA 4GUVA 4C3XA 1PJ5A 3CGBA 1EL8A 1S3BA 1GRAA 1H7XA 3IC9A 3URHA 2XVHA 3QFAA 4OPTA 3AEDA 3ITJA 2A89A 1L0VA 1W4XA 4BJYA 3ALJA 4IA5A 2YVFA 5KOXA 3GDPA 2X50A 2BYBA 1O5WA 1ZK7A 2VOUA 2YG5A 2QCUA 2RGOA 4EMIA 3AE3A 4Z26A 3UKPA 4B69A 3D1PA 2H89A 1L9EA 3CIRA 3PS9A 2VZ2A 4K22A 4K5SA 1S2YA 1KSUA 1SEZA 1S3EA 2H88A 4TLZA 3S61A 2C73A 4J31A 1BZLA 3ILMA 2ZZ0A 4BK3A 1E0CA 5JCIA 1MXTA 2WLXA 1CHUA 4EQRA 4GCMA 2VVMA 2IVDA 1OKGA 1YY5A 1GNDA 4ZCDA 3OC4A 2EQ8A 3EANA 3F4AA 2ARDA 2OAMA 3NLCA 2QA2A 5HPAA 2BCGG 4IV9A 1FCDA 2V5ZA 4P9SA 3UOYA 4ECHA 2FJAA 2XVJA 2WPFA 3ICRA 4E0VA 5HYMA 1ZX9A 2EQ9A 3NNEA 1GV4A 1GOSA 2XLUA 2JB3A 1M6IA 1JU2A 1YMDA 1N1PA 4D03A 2E1MA 5IPYA 1QO8A 3K7QX 1TRBA 1RP0A 1OJTA 3B6DA 3NIXA 1LQTA 1IUSA 3Q9TA 2GWFA 2E4GA 2WPCA 3QVRA 3G5JA 1JOAA 3M0OA 5LV9A 3SM8A 1TYPA 4YTPA 1DOCA 3AYIA 3NYFA 2GV8A 2WOWA 2C67A 1PBFA 2B7RA 1MO9A 3TP9A 1EL9A 3ISHA 1VRQB 1LPFA 3AE9A 1F8RA 2C75A 3VR9A 5EB5A 2AQJA 3P4PA 1E1LA 2Q6UA 3AE5A 4JQ9A 2VRLA 2WOIA 4CY8A 3RP6A 3UKLA 2YAUA 3AAXA 2YLRA 2JKCA 5KOWA 2A2KA 3I2VA 4JNAA 3CGEA 1H4MX 4U2SA 1D7YA 1PBEA 1X31B 2XLTA 4U2LA 4EM3A 1EL7A 4IA6A 3AEGA 4DSGA 3AEFA 1JRYA 1FECA 1NG3A 3ZDNA 1GREA 1OJDA 1ZMCA 3DK4A 2BXSA 2GR2A 4IVMB 2DCQA 4OPIA 4A9WA 3VRBA 1ZY8A 3FPZA 4U8OA 3SFDA 2RABA 4X9NA 1H81A 1KF6A 2AR8A 2CDUA 4GRTA 4H4YA 5U25A 3C96A 3VR8A 2GR3A 1JRXA 1V59A 2FJDA 2FJBA 2YR5A 1PJ7A 3Q6JA 4C77A 4YSXA 3BHFA 3K30A 3DGHA 3QSMA 2C65A 3OLHA 2APGA 4AT2A 4KPRA 4J36A 1BOHA 1YMLA 3KVEA 1K0JA 2C76A 5U63A 2WQYA 1K4QA 1TDOA 4YSZA 1Z6LA 4Z25A 2XVFA 2Z5XA 4A6NA 1LJ1A 4NTEA 5BRTA 2GQWA 2VVLA 4RG3A 1GRGA 4A99A 5BVAA 3D1CA 4J2WA 1JRZA 1BKWA 2VQ7A 3NT6A 1F8WA 1FL2A 2GH5A 2V6OA 1H82A 5EBKA 4Z44A 1PDHA 1GESA 1TQ1A 2B9WA 2C72A 4N9XA 2X3NA 4ADWA 4APNA 4BJZA 5HXIA 2V61A 3WE0A 3CGCA 1FEBA 4WH7A 4A65A 1ORBA 1BOIA 3AE8A 4XWRA 1RHSA 5J7XA 1L9DA 2WLRA 1QB0A 3ALMA 1LQUA 1CL0A 4U8KA 3AE4A 4Z2UA 1QJDA 3GYJA 1D5TA 3AD8B 3ABVA 1D4DA 1N4UA 1XHCA 4AOXA 2ORAA 1D4CA 4CNJA 4D04A 3NRNA 1CF3A 3UTFA 4F67A 1GRFA 3TG3A 4J34A 2B9XA 1YQZA 1ZOVA 3M12A 3HZUA 2GRTA 1YMKA 3NYCA 4A79A 2GF3A 4EQXA 3QFBA 2WEUA 1BF3A 2IFVA 1GXFA 3CPIG 1VG0A 5C3JA 3UKQA 3UTNX 1NDAA 4TM3A 1M64A 3FIMB 3P4SA 1NHQA 3RHAA 1ZKQA 4ZCCA 5KXJA 5FS7A 2A87A 2V60A 5CKUA 3GK5A 5C2TA 2OLOA 5KRQA 1GPEA 4C3YA 3BNMA 3GDNA 4H4ZA 1B8SA 4H4WA 1Y56A 4Y4NA 5FS9A 1TDKA 1GSNA 3AYJA 1QLBA 2BC1A 2A8XA 3C4NA 4REKA 2C3DA 1E1KA 1REOA 3GD3A 4LU6A 5M10A 4U8IA 2W0HA 3GMBA 3AEEA 2WP9A 1PJ6A 1PXCA 1H4KX 2HHGA 2IFDA 3QJ4A 3CNPA 2XYOA 5IQ1A 4H2NA 4FK1A 1O94A 3AD7B 2JB2A 4YXDA 1XANA 1GN0A 3LJPA 2XLRA 4Z2TA 1JNRA 3ZYXA 1ZP0A 2BABA 3L8KA 4H4SA 4FK1C 4H4VA 4IVOB 2QA1A 4BV6A 5LAOA 2GAHB 4U8JA 2DKHA 3AE1A 3G5QA 1YT8A 4JY2A 2PHHA 1QXNA 3FOJA 2NPXA 4CNKA 3DJDA 3ICTA 1B37A 3G5SA 4Y4LA 2VSWA 3SQPA 1URHA 3KKJA 4USRA 5CQFA 1PBBA 3UP5A 3I6DA 5KVHA 2HQMA 3FBSA 1T3KA 4J56A 1DJNA 1GRTA 1LV0A 4OPGA 2WP5A 3UTGA 1OJCA 2B9YA 2X99A 2EG4B 3DJGX 3GRSA 1UARA 4GR1A 4H4PA 3L1RA 3NHVA 1GRBA 2Q0KA 4OPCA 1PHHA 2GMHA 4OPDA 3P1WA 2GVCA 4AT0A 3DK9A 4DGKA 2AAQA 4CRTA 4B66A 3UKAA 3F8PA 3ATRA 4OPLA 1KFYA 1DP2A 3AWIA 1H83A 3GD4A 4U8MA 3RNMA 4EQWA 3COXA 1FOHA 3FLHA 3P4RA 3UTEA 2DKIA 2IIDA 2EQ6A 2RGHA 2YVJA 1B5QA 2TMDA 3GWDA 1N4WA 1VQWA 4K2XA 4BK2A 4Z2RA 2BXRA 4H4UA 1H86A 1OJ9A 1IUWA 3BHKA 1OJAA 5HBQA 2WDRA 2GR1A 4NEVA 2XLSA 2X8HA 3UTHA 5HBPA 1BGNA 3UOZA 1VDCA 4YTNA 1F6MA 1E6EA 4FX9A 2JTQA 1Y0PA 5HBLA 1GRHA 4BURA 4CCQA 2BK3A 1KDGA 1CWRA 3DK8A 2WP6A 1XDIA 2MRMA 2VVLG 3VRDB 1IUVA 1TDEA 1O95A 3AEBA 1H84A 2Q0LA 3IWAA 4UDRA 5JCMA 3HWIA 2R4EA 1IJHA 1UKVG 1YKJA 2GEWA 3F8DA 3NN6X 1ZOYA 4YSHA 1D4EA 4JDRA 4DSHA 4KX6A 3GSIA 1B4VA 4U2TA 1K0IA 4EMWA 3UCLA 2R0GA 5TR3A 3FG2P 3IPPA 4H50A 1NHRA 1YQ3A 1HZMA 5FS8A 2YWLA 3NK0X 3BI5A 3GWFA 1PN0A 2R9ZA 3NKSA 3LOVA 4NTCA 2K0ZA 4B68A 2F5ZA 2MOLA 4GF7A 4OVIA 2J6PA 1CJ2A 1XPQA 4GDEA 5EOWA 3F8RA 1Q1WA 5J60A 5BULA 3AD9B 3RP7A 4ZN0A 2XFPA 3ICSA 1CC2A 2GMJA 5ER0A 1GEUA 2YR6A 1NENA 1C25A 1Y56B 2YG7A 1CJ4A 3LADA 4TM4A 4B1BA 2WESA 4A7AA 4EIQA 1NHPA 2JBVA 3AYLA 2YLTA 5JCKA 3NYEA 3P4QA 3OP3A 3D8XA 3B3RA 3CNJA 2WS3A 4M52A 4EIPA 2QAEA 4YWOA 3IF9A 2WDQA 1N4VA 4U8PA 4XWZA 1NAAA 3AE2A 3QVPA 1ZDLA 3VQRA 4C74A 5KWFA 2X8GA 3AAYA 2XFQA 5KVIA 1CC4A 2YLSA
chains in the Genus database with same CATH superfamily
4WH9A 1L9CA 4USQA 3AB1A 3KPFA 2JTRA 2R0PA 5GRTA 3UKKA 3I3LA 3QSSA 1E1NA 4Z24A 2XLPA 2KL3A 1PBDA 1S2QA 3FS5A 3DMEA 1IUXA 1ZMDA 2EQ7A 4WX1A 4H4RA 1F8SA 2O9ZA 3UOXA 5FMHA 4EMJA 2RGJA 2ZBWA 1PBCA 2FSXA 1P2EA 2J3NA 4B65A 2BK5A 3G5RA 1H7WA 1KNRA 2B7SA 2BCPA 3GYIA 3VRAA 2WHDA 3ALLA 2UZZA 1RSGA 2CULA 4JNQA 2YLZA 4G74A 4AOSA 2WU2A 2WBAA 4AP1A 2Y6RA 4AP3A 1P2HA 1GETA 1H6VA 3H4KA 2E5VA 4JN9A 2OLNA 3H8IA 1GMXA 4OCGA 2BACA 3LB8A 2V3BA 3LZXA 1WV9A 4RSLA 4H2PA 1YM9A 4UP3A 3R9UA 3LZWA 1NEKA 2YVGA 2YG4A 2B76A 1DOEA 2VRMA 4PAAA 3SZ0A 1CC6A 3DGZA 2Z5YA 3C4AA 3IHGA 2MOIA 3HZLA 1BWCA 4I59A 4K5RA 1IUUA 2WOVA 4K8DA 2GB0A 4UDQA 5GSNA 1CJCA 2R45A 3NGCX 2JK6A 2EG3A 2C66A 3OZ2A 3NHOX 2BRYA 4Y4MA 1NG4A 4JGTA 3BI2A 2NVKX 4Z43A 4U8LA 3NH3X 2XCGA 4II2A 1TYTA 3DJJA 2OALA 4YKGA 3NTAA 1CWTA 4G6GA 3SFEA 1EBDA 1CWSA 2BS3A 3AECA 1RYIA 3II4A 2Y6QA 4H2QA 1HYUA 4U8NA 1NPXA 3TG1B 3AE7A 1LTXR 4H4XA 3DA1A 3CNDA 4EQSA 2I0ZA 1ELIA 4YTMA 5IQ4A 5FS6A 5L46A 3E1TA 2C7GA 4WCTA 1VEEA 3PVCA 1DOBA 2BK4A 4LIIA 4O5QA 2GR0A 2X8CA 1LVLA 4A6NB 4NZHA 4CBQA 4J33A 5BUKA 3HIXA 4TM1A 4NTDA 4X4JA 4I58A 1WHBA 2YG6A 2IVEA 3I3UA 2UZQA 1PS9A 2YLWA 3GMCA 1D7LA 5JCLA 2WETA 2XFOA 3DH9A 3R2UA 3LXDA 2BS2A 4B63A 2ZZCA 5HHFA 3UKHA 4B64A 2YM2A 2VQBA 1ONFA 1JNZA 2WPEA 2YLXA 3DJEA 2GQFA 4EM4A 3SZFA 4NEWA 4XXGA 1BGJA 4C5OA 4FDCB 1E39A 2JAEA 2XVIA 1DJQA 1K0LA 4RG4A 2C70A 2C64A 1CBOA 3ATQA 4H4QA 4H4TA 4YSYA 4PABA 2XFUA 3UOVA 4J57A 5LAMA 3IPOA 1Q1RA 2YG3A 3CTYA 4YKFA 3EPTA 3K9RA 3REDA 3KA7A 1JEHA 2CVJA 2FBWA 2XFNA 4OPUA 3O3WA 2EG4A 1GTHA 2TPRA 3CGDA 5M0ZA 5U1OA 3CNTA 2JB1A 3CPHG 1Q9IA 4HA6A 4B67A 3K7TA 2GAGB 4NNJA 4H7UA 2PYXA 2YQUA 5EB4A 1GTEA 4HB9A 3MZZA 3P9UA 3UKFA 4JY3A 4H2RA 3T2ZA 4BK1A 3AEAA 1E1MA 4CY6A 3CNSA 4O5UA 3GRTA 1TDNA 3CN8A 5JCNA 4GAPA 1YQ4A 2C4CA 3NG7X 4GDPA 2C3CA 3NK2X 1NHSA 2R46A 3KD9A 3FNJA 2OA1A 3IHMA 3EF6A 1GERA 1FEAA 4A5LA 3ADAB 1E7PA 1DODA 3PO7A 2ZZBA 1MOKA 1RHDA 3UP4A 2R0CA 4ICYA 2BC0A 2Q7VA 3NN0X 1PXAA 4MJWA 5KMSA 1DXLA 1KSSA 1DNCA 3KU9A 1EL5A 2ACZA 2OUCA 3T37A 1GALA 5HY5A 3EAOA 4K7ZA 1GT8A 3RP8A 3O0HA 4UDPA 3FMWA 1COYA 2XDOA 3JSKA 4TM0A 1F3PA 4LA1A 4DNAA 1CJ3A 3V3OA 3SGLA 3NTDA 2CFYA 3S5WA 3IWHA 5HBOA 1IUTA 2YM1A 2YR4A 2XVEA 1TDFA 2WDVA 1AOGA 1KNPA 3BNUA 3K7MX 3NK1X 1PXBA 4TLXA 3V76A 2JTSA 2FJEA 4YT0A 2BS4A 3QSEA 2WU5A 3AE6A 3CPJG 1YS0A 2R4JA 2V3AA 4X9MA 3H8LA 5DBJA 4CCRA 3V3NA 1VG9A 3P3AA 2BA9A 3BI4A 3KLJA 3M13A 3AXBA 4GUVA 4C3XA 1PJ5A 3CGBA 1EL8A 1S3BA 1GRAA 1H7XA 3IC9A 3URHA 2XVHA 3QFAA 4OPTA 3AEDA 3ITJA 2A89A 1L0VA 1W4XA 4BJYA 3ALJA 4IA5A 2YVFA 5KOXA 3GDPA 2X50A 2BYBA 1O5WA 1ZK7A 2VOUA 2YG5A 2QCUA 2RGOA 4EMIA 3AE3A 4Z26A 3UKPA 4B69A 3D1PA 2H89A 1L9EA 3CIRA 3PS9A 2VZ2A 4K22A 4K5SA 1S2YA 1KSUA 1SEZA 1S3EA 2H88A 4TLZA 3S61A 2C73A 4J31A 1BZLA 3ILMA 2ZZ0A 4BK3A 1E0CA 5JCIA 1MXTA 2WLXA 1CHUA 3T2KA 4EQRA 4GCMA 2VVMA 2IVDA 1OKGA 3HYXA 1YY5A 1GNDA 4ZCDA 3OC4A 5KMPA 2EQ8A 3EANA 3F4AA 2ARDA 2OAMA 3NLCA 2QA2A 5HPAA 2BCGG 4IV9A 1FCDA 2V5ZA 4P9SA 4NWZA 3UOYA 4ECHA 2FJAA 2XVJA 2WPFA 3ICRA 4E0VA 5HYMA 1ZX9A 2EQ9A 3NNEA 1GV4A 1GOSA 2XLUA 2JB3A 1M6IA 1JU2A 1YMDA 1N1PA 3SXIA 2E1MA 4D03A 5IPYA 1QO8A 3K7QX 1TRBA 1RP0A 1OJTA 3B6DA 3NIXA 1LQTA 1IUSA 3Q9TA 2GWFA 2E4GA 2WPCA 3QVRA 3G5JA 1JOAA 3M0OA 5LV9A 3SM8A 1TYPA 4YTPA 1DOCA 3AYIA 4GAVA 3NYFA 2GV8A 2WOWA 2C67A 1PBFA 2B7RA 1MO9A 3TP9A 1EL9A 3ISHA 1VRQB 1LPFA 3AE9A 1F8RA 2C75A 4G73A 3T2YA 3VR9A 5EB5A 2AQJA 3P4PA 1E1LA 2Q6UA 3AE5A 4JQ9A 2VRLA 2WOIA 4CY8A 3RP6A 3UKLA 2YAUA 3AAXA 2YLRA 2JKCA 5KOWA 2A2KA 3I2VA 4JNAA 3CGEA 1H4MX 4U2SA 1D7YA 1PBEA 1X31B 2XLTA 4U2LA 4EM3A 1EL7A 4IA6A 3AEGA 4DSGA 3AEFA 1JRYA 1FECA 1NG3A 3ZDNA 1GREA 1OJDA 1ZMCA 3DK4A 2BXSA 2GR2A 4IVMB 2DCQA 4OPIA 4A9WA 3VRBA 1ZY8A 3FPZA 4U8OA 3SFDA 2RABA 4X9NA 1H81A 1KF6A 2AR8A 2CDUA 4GRTA 4H4YA 5U25A 3C96A 3VR8A 2GR3A 1JRXA 1V59A 2Q82A 2FJDA 2FJBA 1PJ7A 2YR5A 3Q6JA 4C77A 3BHFA 3K30A 3DGHA 3QSMA 2C65A 3OLHA 2APGA 4II3A 4AT2A 4KPRA 4J36A 1BOHA 1YMLA 3KVEA 3GYXA 1K0JA 2C76A 5U63A 3KPKA 2WQYA 1K4QA 1TDOA 4YSZA 1Z6LA 4Z25A 2XVFA 2Z5XA 4A6NA 1LJ1A 4NTEA 5BRTA 2GQWA 2VVLA 4RG3A 1GRGA 4A99A 5BVAA 3D1CA 4J2WA 1JRZA 1BKWA 2VQ7A 3NT6A 1F8WA 1FL2A 2GH5A 2V6OA 1H82A 5EBKA 4Z44A 1PDHA 5KMRA 1GESA 1TQ1A 2B9WA 2C72A 4N9XA 2X3NA 4ADWA 4APNA 4BJZA 5HXIA 2V61A 3WE0A 3CGCA 1FEBA 4WH7A 4A65A 1ORBA 1BOIA 3AE8A 4XWRA 1RHSA 5J7XA 4YSXA 1L9DA 2WLRA 1QB0A 3ALMA 1LQUA 1CL0A 4U8KA 3AE4A 4Z2UA 1QJDA 3GYJA 1D5TA 3AD8B 3ABVA 1D4DA 1N4UA 1XHCA 4AOXA 2ORAA 1D4CA 4CNJA 4D04A 3NRNA 1CF3A 3UTFA 4F67A 1GRFA 3TG3A 4J34A 2B9XA 1YQZA 1ZOVA 3M12A 3HZUA 2GRTA 1YMKA 3NYCA 4A79A 2GF3A 4EQXA 3QFBA 2WEUA 1BF3A 2IFVA 1GXFA 3CPIG 1VG0A 5C3JA 3UKQA 3UTNX 1NDAA 4TM3A 1M64A 3FIMB 3P4SA 1NHQA 3RHAA 1ZKQA 4ZCCA 5KXJA 5FS7A 2A87A 2V60A 5CKUA 3GK5A 5C2TA 2OLOA 5KRQA 1GPEA 4C3YA 3BNMA 3GDNA 4H4ZA 1B8SA 3HYWA 1Y56A 4H4WA 4Y4NA 5FS9A 1TDKA 4G9KA 1GSNA 3AYJA 1QLBA 2BC1A 2A8XA 3C4NA 4REKA 2C3DA 1E1KA 1REOA 3GD3A 4LU6A 5KMQA 4U8IA 2W0HA 3GMBA 3AEEA 2WP9A 1PJ6A 1PXCA 1H4KX 3SY4A 2HHGA 2IFDA 3QJ4A 3CNPA 2XYOA 5IQ1A 3SX6A 4H2NA 4FK1A 1O94A 3AD7B 2JB2A 4YXDA 1XANA 1GN0A 3LJPA 2XLRA 4Z2TA 1JNRA 3ZYXA 3T14A 1ZP0A 2BABA 3L8KA 4H4SA 5KNLA 3T0KA 4FK1C 4H4VA 4IVOB 2QA1A 4BV6A 5LAOA 2GAHB 4U8JA 2DKHA 3AE1A 3G5QA 1YT8A 4JY2A 2PHHA 1QXNA 3FOJA 2NPXA 3CMMA 3DJDA 3ICTA 1B37A 4G6HA 4CNKA 3G5SA 4Y4LA 3T31A 2VSWA 3SQPA 1URHA 3KKJA 4USRA 5CQFA 1PBBA 3UP5A 3I6DA 5KVHA 2HQMA 3FBSA 1T3KA 4J56A 1DJNA 1GRTA 5M10A 1LV0A 4OPGA 2WP5A 3UTGA 1OJCA 2B9YA 2X99A 2EG4B 3DJGX 3GRSA 1UARA 4GR1A 4H4PA 3HYVA 3L1RA 3NHVA 1GRBA 2Q0KA 4OPCA 1PHHA 2GMHA 4OPDA 3P1WA 2GVCA 4AT0A 3DK9A 4DGKA 2AAQA 4CRTA 4B66A 3UKAA 3F8PA 3ATRA 4OPLA 1KFYA 1DP2A 3AWIA 1H83A 3GD4A 4U8MA 3RNMA 4EQWA 3COXA 1FOHA 3FLHA 3P4RA 3UTEA 2DKIA 2IIDA 2EQ6A 2RGHA 2BRAA 1B5QA 2TMDA 2YVJA 1N4WA 1VQWA 3GWDA 4K2XA 4BK2A 4Z2RA 2BXRA 4H4UA 1H86A 1OJ9A 1IUWA 3BHKA 1OJAA 5HBQA 2WDRA 2GR1A 4NEVA 2XLSA 2X8HA 3UTHA 5HBPA 1BGNA 3UOZA 1VDCA 4YTNA 1F6MA 1E6EA 4FX9A 2JTQA 1Y0PA 5HBLA 1GRHA 4BURA 4CCQA 2BK3A 1KDGA 1CWRA 3DK8A 2WP6A 1XDIA 2MRMA 2VVLG 3VRDB 1IUVA 1TDEA 1O95A 3AEBA 1H84A 2Q0LA 3IWAA 4UDRA 3SYIA 3HWIA 5JCMA 2R4EA 1IJHA 1UKVG 1YKJA 2GEWA 3F8DA 3NN6X 1ZOYA 4YSHA 1D4EA 4JDRA 4DSHA 4KX6A 3GSIA 1B4VA 4U2TA 1K0IA 4EMWA 3UCLA 2R0GA 5TR3A 3FG2P 3IPPA 4H50A 1NHRA 1YQ3A 1HZMA 5FS8A 2YWLA 3NK0X 3BI5A 3GWFA 1PN0A 2R9ZA 3NKSA 3LOVA 4NTCA 2K0ZA 4B68A 2F5ZA 2MOLA 4GF7A 4OVIA 2J6PA 1CJ2A 1XPQA 4GDEA 5EOWA 3F8RA 1Q1WA 5J60A 5BULA 3AD9B 3RP7A 4ZN0A 2XFPA 3ICSA 1CC2A 2GMJA 5ER0A 1GEUA 2YR6A 1NENA 1C25A 1Y56B 2YG7A 1CJ4A 3LADA 4TM4A 4B1BA 2WESA 4A7AA 4EIQA 1NHPA 2JBVA 3AYLA 2YLTA 5JCKA 3NYEA 3P4QA 3OP3A 3D8XA 3B3RA 3CNJA 2WS3A 4M52A 4EIPA 2QAEA 4YWOA 3IF9A 2WDQA 1N4VA 4U8PA 4XWZA 1NAAA 3AE2A 3QVPA 3SZWA 1ZDLA 3VQRA 4C74A 5KWFA 2X8GA 3AAYA 2XFQA 5KVIA 1CC4A 3SZCA 2YLSA
chains in the Genus database with same CATH topology
4WH9A 1L9CA 4USQA 3AB1A 3KPFA 2JTRA 2R0PA 5GRTA 3UKKA 3I3LA 3QSSA 1E1NA 4Z24A 2XLPA 2KL3A 1PBDA 1S2QA 3FS5A 3DMEA 1IUXA 1ZMDA 2EQ7A 4WX1A 4H4RA 1F8SA 2O9ZA 3UOXA 5FMHA 4EMJA 2RGJA 2ZBWA 1PBCA 2FSXA 1P2EA 2J3NA 4B65A 2BK5A 3G5RA 1H7WA 1KNRA 2B7SA 2BCPA 3GYIA 3VRAA 2WHDA 3ALLA 2UZZA 1RSGA 2CULA 4JNQA 2YLZA 4G74A 4AOSA 2WU2A 2WBAA 4AP1A 2Y6RA 4AP3A 1P2HA 1GETA 1H6VA 3H4KA 2E5VA 4JN9A 2OLNA 3H8IA 1GMXA 4OCGA 2BACA 3LB8A 2V3BA 3LZXA 1WV9A 4RSLA 4H2PA 1YM9A 4UP3A 3R9UA 3LZWA 1NEKA 2YVGA 2YG4A 2B76A 1DOEA 2VRMA 4PAAA 3SZ0A 1CC6A 3DGZA 2Z5YA 3C4AA 3IHGA 2MOIA 3HZLA 1BWCA 4I59A 4K5RA 1IUUA 2WOVA 4K8DA 2GB0A 4UDQA 5GSNA 1CJCA 2R45A 3NGCX 2JK6A 2EG3A 2C66A 3OZ2A 3NHOX 2BRYA 4Y4MA 1NG4A 4JGTA 3BI2A 2NVKX 4Z43A 4U8LA 3NH3X 2XCGA 4II2A 1TYTA 3DJJA 2OALA 4YKGA 3NTAA 1CWTA 4G6GA 3SFEA 1EBDA 1CWSA 2BS3A 3AECA 1RYIA 3II4A 2Y6QA 4H2QA 1HYUA 4U8NA 1NPXA 3TG1B 3AE7A 1LTXR 4H4XA 3DA1A 3CNDA 4EQSA 2I0ZA 1ELIA 4YTMA 5IQ4A 5FS6A 5L46A 3E1TA 2C7GA 4WCTA 1VEEA 3PVCA 1DOBA 2BK4A 4LIIA 4O5QA 2GR0A 2X8CA 1LVLA 4A6NB 4NZHA 4CBQA 4J33A 5BUKA 3HIXA 4TM1A 4NTDA 4X4JA 4I58A 1WHBA 2YG6A 2IVEA 3I3UA 2UZQA 1PS9A 2YLWA 3GMCA 1D7LA 5JCLA 2WETA 2XFOA 3DH9A 3R2UA 3LXDA 2BS2A 4B63A 2ZZCA 5HHFA 3UKHA 4B64A 2YM2A 2VQBA 1ONFA 1JNZA 2WPEA 2YLXA 3DJEA 2GQFA 4EM4A 3SZFA 4NEWA 4XXGA 1BGJA 4C5OA 4FDCB 1E39A 2JAEA 2XVIA 1DJQA 1K0LA 4RG4A 2C70A 2C64A 1CBOA 3ATQA 4H4QA 4H4TA 4YSYA 4PABA 2XFUA 3UOVA 4J57A 5LAMA 3IPOA 1Q1RA 2YG3A 3CTYA 4YKFA 3EPTA 3K9RA 3REDA 3KA7A 1JEHA 2CVJA 2FBWA 2XFNA 4OPUA 3O3WA 2EG4A 1GTHA 2TPRA 3CGDA 5M0ZA 5U1OA 3CNTA 2JB1A 3CPHG 1Q9IA 4HA6A 4B67A 3K7TA 2GAGB 4NNJA 4H7UA 2PYXA 2YQUA 5EB4A 1GTEA 4HB9A 3MZZA 3P9UA 3UKFA 4JY3A 4H2RA 3T2ZA 4BK1A 3AEAA 1E1MA 4CY6A 3CNSA 4O5UA 3GRTA 1TDNA 3CN8A 5JCNA 4GAPA 1YQ4A 2C4CA 3NG7X 4GDPA 2C3CA 3NK2X 1NHSA 2R46A 3KD9A 3FNJA 2OA1A 3IHMA 3EF6A 1GERA 1FEAA 4A5LA 3ADAB 1E7PA 1DODA 3PO7A 2ZZBA 1MOKA 1RHDA 3UP4A 2R0CA 4ICYA 2BC0A 2Q7VA 3NN0X 1PXAA 4MJWA 5KMSA 1DXLA 1KSSA 1DNCA 3KU9A 1EL5A 2ACZA 2OUCA 3T37A 1GALA 5HY5A 3EAOA 4K7ZA 1GT8A 3RP8A 3O0HA 4UDPA 3FMWA 1COYA 2XDOA 3JSKA 4TM0A 1F3PA 4LA1A 4DNAA 1CJ3A 3V3OA 3SGLA 3NTDA 2CFYA 3S5WA 3IWHA 5HBOA 1IUTA 2YM1A 2YR4A 2XVEA 1TDFA 2WDVA 1AOGA 1KNPA 3BNUA 3K7MX 3NK1X 1PXBA 4TLXA 3V76A 2JTSA 2FJEA 4YT0A 2BS4A 3QSEA 2WU5A 3AE6A 3CPJG 1YS0A 2R4JA 2V3AA 4X9MA 3H8LA 5DBJA 4CCRA 3V3NA 1VG9A 3P3AA 2BA9A 3BI4A 3KLJA 3M13A 3AXBA 4GUVA 4C3XA 1PJ5A 3CGBA 1EL8A 1S3BA 1GRAA 1H7XA 3IC9A 3URHA 2XVHA 3QFAA 4OPTA 3AEDA 3ITJA 2A89A 1L0VA 1W4XA 4BJYA 3ALJA 4IA5A 2YVFA 5KOXA 3GDPA 2X50A 2BYBA 1O5WA 1ZK7A 2VOUA 2YG5A 2QCUA 2RGOA 4EMIA 3AE3A 4Z26A 3UKPA 4B69A 3D1PA 2H89A 1L9EA 3CIRA 3PS9A 2VZ2A 4K22A 4K5SA 1S2YA 1KSUA 1SEZA 1S3EA 2H88A 4TLZA 3S61A 2C73A 4J31A 1BZLA 3ILMA 2ZZ0A 4BK3A 1E0CA 5JCIA 1MXTA 2WLXA 1CHUA 3T2KA 4EQRA 4GCMA 2VVMA 2IVDA 1OKGA 3HYXA 1YY5A 1GNDA 4ZCDA 3OC4A 5KMPA 2EQ8A 3EANA 3F4AA 2ARDA 2OAMA 3NLCA 2QA2A 5HPAA 2BCGG 4IV9A 1FCDA 2V5ZA 4P9SA 4NWZA 3UOYA 4ECHA 2FJAA 2XVJA 2WPFA 3ICRA 4E0VA 5HYMA 1ZX9A 2EQ9A 3NNEA 1GV4A 1GOSA 2XLUA 2JB3A 1M6IA 1JU2A 1YMDA 1N1PA 3SXIA 2E1MA 4D03A 5IPYA 1QO8A 3K7QX 1TRBA 1RP0A 1OJTA 3B6DA 3NIXA 1LQTA 1IUSA 3Q9TA 2GWFA 2E4GA 2WPCA 3QVRA 3G5JA 1JOAA 3M0OA 5LV9A 3SM8A 1TYPA 4YTPA 1DOCA 3AYIA 4GAVA 3NYFA 2GV8A 2WOWA 2C67A 1PBFA 2B7RA 1MO9A 3TP9A 1EL9A 3ISHA 1VRQB 1LPFA 3AE9A 1F8RA 2C75A 4G73A 3T2YA 3VR9A 5EB5A 2AQJA 3P4PA 1E1LA 2Q6UA 3AE5A 4JQ9A 2VRLA 2WOIA 4CY8A 3RP6A 3UKLA 2YAUA 3AAXA 2YLRA 2JKCA 5KOWA 2A2KA 3I2VA 4JNAA 3CGEA 1H4MX 4U2SA 1D7YA 1PBEA 1X31B 2XLTA 4U2LA 4EM3A 1EL7A 4IA6A 3AEGA 4DSGA 3AEFA 1JRYA 1FECA 1NG3A 3ZDNA 1GREA 1OJDA 1ZMCA 3DK4A 2BXSA 2GR2A 4IVMB 2DCQA 4OPIA 4A9WA 3VRBA 1ZY8A 3FPZA 4U8OA 3SFDA 2RABA 4X9NA 1H81A 1KF6A 2AR8A 2CDUA 4GRTA 4H4YA 5U25A 3C96A 3VR8A 2GR3A 1JRXA 1V59A 2FJDA 2FJBA 2YR5A 1PJ7A 3Q6JA 4C77A 4YSXA 3BHFA 3K30A 3DGHA 3QSMA 2C65A 3OLHA 2APGA 4II3A 4AT2A 4KPRA 4J36A 1BOHA 1YMLA 3KVEA 3GYXA 1K0JA 2C76A 5U63A 3KPKA 2WQYA 1K4QA 1TDOA 4YSZA 1Z6LA 4Z25A 2XVFA 2Z5XA 4A6NA 1LJ1A 4NTEA 5BRTA 2GQWA 2VVLA 4RG3A 1GRGA 4A99A 5BVAA 3D1CA 4J2WA 1JRZA 1BKWA 2VQ7A 3NT6A 1F8WA 1FL2A 2GH5A 2V6OA 1H82A 5EBKA 4Z44A 1PDHA 5KMRA 1GESA 1TQ1A 2B9WA 2C72A 4N9XA 2X3NA 4ADWA 4APNA 4BJZA 5HXIA 2V61A 3WE0A 3CGCA 1FEBA 4WH7A 4A65A 1ORBA 1BOIA 3AE8A 4XWRA 1RHSA 5J7XA 1L9DA 2WLRA 1QB0A 3ALMA 1LQUA 1CL0A 4U8KA 3AE4A 4Z2UA 1QJDA 3GYJA 1D5TA 3AD8B 3ABVA 1D4DA 1N4UA 1XHCA 4AOXA 2ORAA 1D4CA 4CNJA 4D04A 3NRNA 1CF3A 3UTFA 4F67A 1GRFA 3TG3A 4J34A 2B9XA 1YQZA 1ZOVA 3M12A 3HZUA 2GRTA 1YMKA 3NYCA 4A79A 2GF3A 4EQXA 3QFBA 2WEUA 1BF3A 2IFVA 1GXFA 3CPIG 1VG0A 5C3JA 3UKQA 3UTNX 1NDAA 4TM3A 1M64A 3FIMB 3P4SA 1NHQA 3RHAA 1ZKQA 4ZCCA 5KXJA 5FS7A 2A87A 2V60A 5CKUA 3GK5A 5C2TA 2OLOA 5KRQA 1GPEA 4C3YA 3BNMA 3GDNA 4H4ZA 1B8SA 3HYWA 1Y56A 4H4WA 4Y4NA 5FS9A 1TDKA 4G9KA 1GSNA 3AYJA 1QLBA 2BC1A 2A8XA 3C4NA 4REKA 2C3DA 1E1KA 1REOA 3GD3A 4LU6A 5KMQA 4U8IA 2W0HA 3GMBA 3AEEA 2WP9A 1PJ6A 1PXCA 1H4KX 3SY4A 2HHGA 2IFDA 3QJ4A 3CNPA 2XYOA 5IQ1A 3SX6A 4H2NA 4FK1A 1O94A 3AD7B 2JB2A 4YXDA 1XANA 1GN0A 3LJPA 2XLRA 4Z2TA 1JNRA 3ZYXA 3T14A 1ZP0A 2BABA 3L8KA 4H4SA 5KNLA 3T0KA 4FK1C 4H4VA 4IVOB 2QA1A 4BV6A 5LAOA 2GAHB 4U8JA 2DKHA 3AE1A 3G5QA 1YT8A 4JY2A 2PHHA 1QXNA 3FOJA 2NPXA 3CMMA 3DJDA 3ICTA 1B37A 4G6HA 4CNKA 3G5SA 4Y4LA 3T31A 2VSWA 3SQPA 1URHA 3KKJA 4USRA 5CQFA 1PBBA 3UP5A 3I6DA 5KVHA 2HQMA 3FBSA 1T3KA 4J56A 1DJNA 1GRTA 5M10A 1LV0A 4OPGA 2WP5A 3UTGA 1OJCA 2B9YA 2X99A 2EG4B 3DJGX 3GRSA 1UARA 4GR1A 4H4PA 3HYVA 3L1RA 3NHVA 1GRBA 2Q0KA 4OPCA 1PHHA 2GMHA 4OPDA 3P1WA 2GVCA 4AT0A 3DK9A 4DGKA 2AAQA 4CRTA 4B66A 3UKAA 3F8PA 3ATRA 4OPLA 1KFYA 1DP2A 3AWIA 1H83A 3GD4A 4U8MA 3RNMA 4EQWA 3COXA 1FOHA 3FLHA 3P4RA 3UTEA 2DKIA 2IIDA 2EQ6A 2RGHA 2BRAA 1B5QA 2TMDA 2YVJA 1N4WA 1VQWA 3GWDA 4K2XA 4BK2A 4Z2RA 2BXRA 4H4UA 1H86A 1OJ9A 1IUWA 3BHKA 1OJAA 5HBQA 2WDRA 2GR1A 4NEVA 2XLSA 2X8HA 3UTHA 5HBPA 1BGNA 3UOZA 1VDCA 4YTNA 1F6MA 1E6EA 4FX9A 2JTQA 1Y0PA 5HBLA 1GRHA 4BURA 4CCQA 2BK3A 1KDGA 1CWRA 3DK8A 2WP6A 1XDIA 2MRMA 2VVLG 3VRDB 1IUVA 1TDEA 1O95A 3AEBA 1H84A 2Q0LA 3IWAA 4UDRA 3SYIA 3HWIA 5JCMA 2R4EA 1IJHA 1UKVG 1YKJA 2GEWA 3F8DA 3NN6X 1ZOYA 4YSHA 1D4EA 4JDRA 4DSHA 4KX6A 3GSIA 1B4VA 4U2TA 1K0IA 4EMWA 3UCLA 2R0GA 5TR3A 3FG2P 3IPPA 4H50A 1NHRA 1YQ3A 1HZMA 5FS8A 2YWLA 3NK0X 3BI5A 3GWFA 1PN0A 2R9ZA 3NKSA 3LOVA 4NTCA 2K0ZA 4B68A 2F5ZA 2MOLA 4GF7A 4OVIA 2J6PA 1CJ2A 1XPQA 4GDEA 5EOWA 3F8RA 1Q1WA 5J60A 5BULA 3AD9B 3RP7A 4ZN0A 2XFPA 3ICSA 1CC2A 2GMJA 5ER0A 1GEUA 2YR6A 1NENA 1C25A 1Y56B 2YG7A 1CJ4A 3LADA 4TM4A 4B1BA 2WESA 4A7AA 4EIQA 1NHPA 2JBVA 3AYLA 2YLTA 5JCKA 3NYEA 3P4QA 3OP3A 3D8XA 3B3RA 3CNJA 2WS3A 4M52A 4EIPA 2QAEA 4YWOA 3IF9A 2WDQA 1N4VA 4U8PA 4XWZA 1NAAA 3AE2A 3QVPA 3SZWA 1ZDLA 3VQRA 4C74A 5KWFA 2X8GA 3AAYA 2XFQA 5KVIA 1CC4A 3SZCA 2YLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WH9 A;  1L9C A;  4USQ A;  3AB1 A;  3KPF A;  2JTR A;  2R0P A;  5GRT A;  3UKK A;  3I3L A;  3QSS A;  1E1N A;  4Z24 A;  2XLP A;  2KL3 A;  1PBD A;  1S2Q A;  3FS5 A;  3DME A;  1IUX A;  1ZMD A;  2EQ7 A;  4WX1 A;  4H4R A;  1F8S A;  2O9Z A;  3UOX A;  5FMH A;  4EMJ A;  2RGJ A;  2ZBW A;  1PBC A;  2FSX A;  1P2E A;  2J3N A;  4B65 A;  2BK5 A;  3G5R A;  1H7W A;  1KNR A;  2B7S A;  2BCP A;  3GYI A;  3VRA A;  2WHD A;  3ALL A;  2UZZ A;  1RSG A;  2CUL A;  4JNQ A;  2YLZ A;  4AOS A;  2WU2 A;  2WBA A;  4AP1 A;  2Y6R A;  4AP3 A;  1P2H A;  1GET A;  1H6V A;  3H4K A;  2E5V A;  4JN9 A;  2OLN A;  3H8I A;  1GMX A;  4OCG A;  2BAC A;  3LB8 A;  2V3B A;  3LZX A;  1WV9 A;  4RSL A;  4H2P A;  1YM9 A;  4UP3 A;  3R9U A;  3LZW A;  1NEK A;  2YVG A;  2YG4 A;  2B76 A;  1DOE A;  2VRM A;  4PAA A;  1CC6 A;  3DGZ A;  2Z5Y A;  3C4A A;  3IHG A;  2MOI A;  3HZL A;  1BWC A;  4I59 A;  4K5R A;  1IUU A;  2WOV A;  4K8D A;  2GB0 A;  4UDQ A;  5GSN A;  1CJC A;  2R45 A;  3NGC X;  2JK6 A;  2EG3 A;  2C66 A;  3OZ2 A;  3NHO X;  4Y4M A;  1NG4 A;  4JGT A;  3BI2 A;  2NVK X;  4Z43 A;  4U8L A;  3NH3 X;  2XCG A;  1TYT A;  3DJJ A;  2OAL A;  4YKG A;  3NTA A;  1CWT A;  3SFE A;  1EBD A;  1CWS A;  2BS3 A;  3AEC A;  1RYI A;  3II4 A;  2Y6Q A;  4H2Q A;  1HYU A;  4U8N A;  1NPX A;  3TG1 B;  3AE7 A;  1LTX R;  4H4X A;  3DA1 A;  3CND A;  4EQS A;  2I0Z A;  1ELI A;  4YTM A;  5IQ4 A;  5FS6 A;  5L46 A;  3E1T A;  2C7G A;  4WCT A;  1VEE A;  3PVC A;  1DOB A;  2BK4 A;  4LII A;  4O5Q A;  2GR0 A;  2X8C A;  1LVL A;  4A6N B;  4NZH A;  4CBQ A;  4J33 A;  5BUK A;  3HIX A;  4TM1 A;  4NTD A;  4X4J A;  4I58 A;  1WHB A;  2YG6 A;  2IVE A;  3I3U A;  2UZQ A;  1PS9 A;  2YLW A;  3GMC A;  1D7L A;  5JCL A;  2WET A;  2XFO A;  3DH9 A;  3R2U A;  3LXD A;  2BS2 A;  4B63 A;  2ZZC A;  5HHF A;  3UKH A;  4B64 A;  2YM2 A;  2VQB A;  1ONF A;  1JNZ A;  2WPE A;  2YLX A;  3DJE A;  2GQF A;  4EM4 A;  4NEW A;  4XXG A;  1BGJ A;  4C5O A;  4FDC B;  1E39 A;  2JAE A;  2XVI A;  1DJQ A;  1K0L A;  4RG4 A;  2C70 A;  2C64 A;  1CBO A;  3ATQ A;  4H4Q A;  4H4T A;  4YSY A;  4PAB A;  2XFU A;  3UOV A;  4J57 A;  5LAM A;  3IPO A;  1Q1R A;  2YG3 A;  3CTY A;  4YKF A;  3EPT A;  3K9R A;  3RED A;  3KA7 A;  1JEH A;  2CVJ A;  2FBW A;  2XFN A;  4OPU A;  3O3W A;  2EG4 A;  1GTH A;  2TPR A;  3CGD A;  5M0Z A;  5U1O A;  3CNT A;  2JB1 A;  3CPH G;  1Q9I A;  4HA6 A;  4B67 A;  3K7T A;  2GAG B;  4H7U A;  2PYX A;  2YQU A;  5EB4 A;  1GTE A;  4HB9 A;  3MZZ A;  3P9U A;  3UKF A;  4JY3 A;  4H2R A;  4BK1 A;  3AEA A;  1E1M A;  4CY6 A;  3CNS A;  4O5U A;  3GRT A;  1TDN A;  3CN8 A;  5JCN A;  4GDP A;  1YQ4 A;  3NG7 X;  2C3C A;  3NK2 X;  1NHS A;  2R46 A;  3KD9 A;  3FNJ A;  2OA1 A;  3IHM A;  3EF6 A;  1GER A;  1FEA A;  4A5L A;  3ADA B;  1E7P A;  1DOD A;  3PO7 A;  2ZZB A;  1MOK A;  1RHD A;  3UP4 A;  2R0C A;  4ICY A;  2BC0 A;  2Q7V A;  3NN0 X;  1PXA A;  4MJW A;  1DXL A;  1KSS A;  1DNC A;  3KU9 A;  1EL5 A;  2ACZ A;  2OUC A;  3T37 A;  1GAL A;  5HY5 A;  3EAO A;  4K7Z A;  1GT8 A;  3RP8 A;  3O0H A;  4UDP A;  3FMW A;  1COY A;  2XDO A;  3JSK A;  4TM0 A;  1F3P A;  4LA1 A;  4DNA A;  1CJ3 A;  3V3O A;  3SGL A;  3NTD A;  2CFY A;  3S5W A;  3IWH A;  5HBO A;  1IUT A;  2YM1 A;  2YR4 A;  2XVE A;  1TDF A;  2WDV A;  1AOG A;  1KNP A;  3BNU A;  3K7M X;  3NK1 X;  1PXB A;  4TLX A;  3V76 A;  2JTS A;  2FJE A;  4YT0 A;  2BS4 A;  3QSE A;  2WU5 A;  3AE6 A;  3CPJ G;  1YS0 A;  2R4J A;  2V3A A;  4X9M A;  3H8L A;  5DBJ A;  4CCR A;  3V3N A;  1VG9 A;  3P3A A;  2BA9 A;  3BI4 A;  3KLJ A;  3M13 A;  3AXB A;  4GUV A;  4C3X A;  1PJ5 A;  3CGB A;  1EL8 A;  1S3B A;  1GRA A;  1H7X A;  3IC9 A;  3URH A;  2XVH A;  3QFA A;  4OPT A;  3AED A;  3ITJ A;  2A89 A;  1L0V A;  1W4X A;  4BJY A;  3ALJ A;  4IA5 A;  2YVF A;  5KOX A;  3GDP A;  2X50 A;  2BYB A;  1O5W A;  1ZK7 A;  2VOU A;  2YG5 A;  2QCU A;  2RGO A;  4EMI A;  3AE3 A;  4Z26 A;  3UKP A;  4B69 A;  3D1P A;  2H89 A;  1L9E A;  3CIR A;  3PS9 A;  2VZ2 A;  4K22 A;  4K5S A;  1S2Y A;  1KSU A;  1SEZ A;  1S3E A;  2H88 A;  4TLZ A;  3S61 A;  2C73 A;  4J31 A;  1BZL A;  3ILM A;  2ZZ0 A;  4BK3 A;  1E0C A;  5JCI A;  1MXT A;  2WLX A;  1CHU A;  4EQR A;  4GCM A;  2VVM A;  2IVD A;  1OKG A;  1YY5 A;  1GND A;  4ZCD A;  3OC4 A;  2EQ8 A;  3EAN A;  3F4A A;  2ARD A;  2OAM A;  3NLC A;  2QA2 A;  5HPA A;  2BCG G;  4IV9 A;  1FCD A;  2V5Z A;  4P9S A;  3UOY A;  4ECH A;  2FJA A;  2XVJ A;  2WPF A;  3ICR A;  4E0V A;  5HYM A;  1ZX9 A;  2EQ9 A;  3NNE A;  1GV4 A;  1GOS A;  2XLU A;  2JB3 A;  1M6I A;  1JU2 A;  1YMD A;  1N1P A;  4D03 A;  2E1M A;  5IPY A;  1QO8 A;  3K7Q X;  1TRB A;  1RP0 A;  1OJT A;  3B6D A;  3NIX A;  1LQT A;  1IUS A;  3Q9T A;  2GWF A;  2E4G A;  2WPC A;  3QVR A;  3G5J A;  1JOA A;  3M0O A;  5LV9 A;  3SM8 A;  1TYP A;  4YTP A;  1DOC A;  3AYI A;  3NYF A;  2GV8 A;  2WOW A;  2C67 A;  1PBF A;  2B7R A;  1MO9 A;  3TP9 A;  1EL9 A;  3ISH A;  1VRQ B;  1LPF A;  3AE9 A;  1F8R A;  2C75 A;  3VR9 A;  5EB5 A;  2AQJ A;  3P4P A;  1E1L A;  2Q6U A;  3AE5 A;  4JQ9 A;  2VRL A;  2WOI A;  4CY8 A;  3RP6 A;  3UKL A;  2YAU A;  3AAX A;  2YLR A;  2JKC A;  5KOW A;  2A2K A;  3I2V A;  4JNA A;  3CGE A;  1H4M X;  4U2S A;  1D7Y A;  1PBE A;  1X31 B;  2XLT A;  4U2L A;  4EM3 A;  1EL7 A;  4IA6 A;  3AEG A;  4DSG A;  3AEF A;  1JRY A;  1FEC A;  1NG3 A;  3ZDN A;  1GRE A;  1OJD A;  1ZMC A;  3DK4 A;  2BXS A;  2GR2 A;  4IVM B;  2DCQ A;  4OPI A;  4A9W A;  3VRB A;  1ZY8 A;  3FPZ A;  4U8O A;  3SFD A;  2RAB A;  4X9N A;  1H81 A;  1KF6 A;  2AR8 A;  2CDU A;  4GRT A;  4H4Y A;  5U25 A;  3C96 A;  3VR8 A;  2GR3 A;  1JRX A;  1V59 A;  2FJD A;  2FJB A;  2YR5 A;  1PJ7 A;  3Q6J A;  4C77 A;  4YSX A;  3BHF A;  3K30 A;  3DGH A;  3QSM A;  2C65 A;  3OLH A;  2APG A;  4AT2 A;  4KPR A;  4J36 A;  1BOH A;  1YML A;  3KVE A;  1K0J A;  2C76 A;  5U63 A;  2WQY A;  1K4Q A;  1TDO A;  4YSZ A;  1Z6L A;  4Z25 A;  2XVF A;  2Z5X A;  4A6N A;  1LJ1 A;  4NTE A;  5BRT A;  2GQW A;  2VVL A;  4RG3 A;  1GRG A;  4A99 A;  5BVA A;  3D1C A;  4J2W A;  1JRZ A;  1BKW A;  2VQ7 A;  3NT6 A;  1F8W A;  1FL2 A;  2GH5 A;  2V6O A;  1H82 A;  5EBK A;  4Z44 A;  1PDH A;  1GES A;  1TQ1 A;  2B9W A;  2C72 A;  4N9X A;  2X3N A;  4ADW A;  4APN A;  4BJZ A;  5HXI A;  2V61 A;  3WE0 A;  3CGC A;  1FEB A;  4WH7 A;  4A65 A;  1ORB A;  1BOI A;  3AE8 A;  4XWR A;  1RHS A;  5J7X A;  1L9D A;  2WLR A;  1QB0 A;  3ALM A;  1LQU A;  1CL0 A;  4U8K A;  3AE4 A;  4Z2U A;  1QJD A;  3GYJ A;  1D5T A;  3AD8 B;  3ABV A;  1D4D A;  1N4U A;  1XHC A;  4AOX A;  2ORA A;  1D4C A;  4CNJ A;  4D04 A;  3NRN A;  1CF3 A;  3UTF A;  4F67 A;  1GRF A;  3TG3 A;  4J34 A;  2B9X A;  1YQZ A;  1ZOV A;  3M12 A;  3HZU A;  2GRT A;  1YMK A;  3NYC A;  4A79 A;  2GF3 A;  4EQX A;  3QFB A;  2WEU A;  1BF3 A;  2IFV A;  1GXF A;  3CPI G;  1VG0 A;  5C3J A;  3UKQ A;  3UTN X;  1NDA A;  4TM3 A;  1M64 A;  3FIM B;  3P4S A;  1NHQ A;  3RHA A;  1ZKQ A;  4ZCC A;  5KXJ A;  5FS7 A;  2A87 A;  2V60 A;  5CKU A;  3GK5 A;  5C2T A;  2OLO A;  5KRQ A;  1GPE A;  4C3Y A;  3BNM A;  3GDN A;  4H4Z A;  1B8S A;  4H4W A;  1Y56 A;  4Y4N A;  5FS9 A;  1TDK A;  1GSN A;  3AYJ A;  1QLB A;  2BC1 A;  2A8X A;  3C4N A;  4REK A;  2C3D A;  1E1K A;  1REO A;  3GD3 A;  4LU6 A;  5M10 A;  4U8I A;  2W0H A;  3GMB A;  3AEE A;  2WP9 A;  1PJ6 A;  1PXC A;  1H4K X;  2HHG A;  2IFD A;  3QJ4 A;  3CNP A;  2XYO A;  5IQ1 A;  4H2N A;  4FK1 A;  1O94 A;  3AD7 B;  2JB2 A;  4YXD A;  1XAN A;  1GN0 A;  3LJP A;  2XLR A;  4Z2T A;  1JNR A;  3ZYX A;  1ZP0 A;  2BAB A;  3L8K A;  4H4S A;  4FK1 C;  4H4V A;  4IVO B;  2QA1 A;  4BV6 A;  5LAO A;  2GAH B;  4U8J A;  2DKH A;  3AE1 A;  3G5Q A;  1YT8 A;  4JY2 A;  2PHH A;  1QXN A;  3FOJ A;  2NPX A;  4CNK A;  3DJD A;  3ICT A;  1B37 A;  3G5S A;  4Y4L A;  2VSW A;  3SQP A;  1URH A;  3KKJ A;  4USR A;  5CQF A;  1PBB A;  3UP5 A;  3I6D A;  5KVH A;  2HQM A;  3FBS A;  1T3K A;  4J56 A;  1DJN A;  1GRT A;  1LV0 A;  4OPG A;  2WP5 A;  3UTG A;  1OJC A;  2B9Y A;  2X99 A;  2EG4 B;  3DJG X;  3GRS A;  1UAR A;  4GR1 A;  4H4P A;  3L1R A;  3NHV A;  1GRB A;  2Q0K A;  4OPC A;  1PHH A;  2GMH A;  4OPD A;  3P1W A;  2GVC A;  4AT0 A;  3DK9 A;  4DGK A;  2AAQ A;  4CRT A;  4B66 A;  3UKA A;  3F8P A;  3ATR A;  4OPL A;  1KFY A;  1DP2 A;  3AWI A;  1H83 A;  3GD4 A;  4U8M A;  3RNM A;  4EQW A;  3COX A;  1FOH A;  3FLH A;  3P4R A;  3UTE A;  2DKI A;  2IID A;  2EQ6 A;  2RGH A;  2YVJ A;  1B5Q A;  2TMD A;  3GWD A;  1N4W A;  1VQW A;  4K2X A;  4BK2 A;  4Z2R A;  2BXR A;  4H4U A;  1H86 A;  1OJ9 A;  1IUW A;  3BHK A;  1OJA A;  5HBQ A;  2WDR A;  2GR1 A;  4NEV A;  2XLS A;  2X8H A;  3UTH A;  5HBP A;  1BGN A;  3UOZ A;  1VDC A;  4YTN A;  1F6M A;  1E6E A;  4FX9 A;  2JTQ A;  1Y0P A;  5HBL A;  1GRH A;  4BUR A;  4CCQ A;  2BK3 A;  1KDG A;  1CWR A;  3DK8 A;  2WP6 A;  1XDI A;  2MRM A;  2VVL G;  3VRD B;  1IUV A;  1TDE A;  1O95 A;  3AEB A;  1H84 A;  2Q0L A;  3IWA A;  4UDR A;  5JCM A;  3HWI A;  2R4E A;  1IJH A;  1UKV G;  1YKJ A;  2GEW A;  3F8D A;  3NN6 X;  1ZOY A;  4YSH A;  1D4E A;  4JDR A;  4DSH A;  4KX6 A;  3GSI A;  1B4V A;  4U2T A;  1K0I A;  4EMW A;  3UCL A;  2R0G A;  5TR3 A;  3FG2 P;  3IPP A;  4H50 A;  1NHR A;  1YQ3 A;  1HZM A;  5FS8 A;  2YWL A;  3NK0 X;  3BI5 A;  3GWF A;  1PN0 A;  2R9Z A;  3NKS A;  3LOV A;  4NTC A;  2K0Z A;  4B68 A;  2F5Z A;  2MOL A;  4GF7 A;  4OVI A;  2J6P A;  1CJ2 A;  1XPQ A;  4GDE A;  5EOW A;  3F8R A;  1Q1W A;  5J60 A;  5BUL A;  3AD9 B;  3RP7 A;  4ZN0 A;  2XFP A;  3ICS A;  1CC2 A;  2GMJ A;  5ER0 A;  1GEU A;  2YR6 A;  1NEN A;  1C25 A;  1Y56 B;  2YG7 A;  1CJ4 A;  3LAD A;  4TM4 A;  4B1B A;  2WES A;  4A7A A;  4EIQ A;  1NHP A;  2JBV A;  3AYL A;  2YLT A;  5JCK A;  3NYE A;  3P4Q A;  3OP3 A;  3D8X A;  3B3R A;  3CNJ A;  2WS3 A;  4M52 A;  4EIP A;  2QAE A;  4YWO A;  3IF9 A;  2WDQ A;  1N4V A;  4U8P A;  4XWZ A;  1NAA A;  3AE2 A;  3QVP A;  1ZDL A;  3VQR A;  4C74 A;  5KWF A;  2X8G A;  3AAY A;  2XFQ A;  5KVI A;  1CC4 A;  2YLS A; 
#chains in the Genus database with same CATH topology
 4WH9 A;  1L9C A;  4USQ A;  3AB1 A;  3KPF A;  2JTR A;  2R0P A;  5GRT A;  3UKK A;  3I3L A;  3QSS A;  1E1N A;  4Z24 A;  2XLP A;  2KL3 A;  1PBD A;  1S2Q A;  3FS5 A;  3DME A;  1IUX A;  1ZMD A;  2EQ7 A;  4WX1 A;  4H4R A;  1F8S A;  2O9Z A;  3UOX A;  5FMH A;  4EMJ A;  2RGJ A;  2ZBW A;  1PBC A;  2FSX A;  1P2E A;  2J3N A;  4B65 A;  2BK5 A;  3G5R A;  1H7W A;  1KNR A;  2B7S A;  2BCP A;  3GYI A;  3VRA A;  2WHD A;  3ALL A;  2UZZ A;  1RSG A;  2CUL A;  4JNQ A;  2YLZ A;  4G74 A;  4AOS A;  2WU2 A;  2WBA A;  4AP1 A;  2Y6R A;  4AP3 A;  1P2H A;  1GET A;  1H6V A;  3H4K A;  2E5V A;  4JN9 A;  2OLN A;  3H8I A;  1GMX A;  4OCG A;  2BAC A;  3LB8 A;  2V3B A;  3LZX A;  1WV9 A;  4RSL A;  4H2P A;  1YM9 A;  4UP3 A;  3R9U A;  3LZW A;  1NEK A;  2YVG A;  2YG4 A;  2B76 A;  1DOE A;  2VRM A;  4PAA A;  3SZ0 A;  1CC6 A;  3DGZ A;  2Z5Y A;  3C4A A;  3IHG A;  2MOI A;  3HZL A;  1BWC A;  4I59 A;  4K5R A;  1IUU A;  2WOV A;  4K8D A;  2GB0 A;  4UDQ A;  5GSN A;  1CJC A;  2R45 A;  3NGC X;  2JK6 A;  2EG3 A;  2C66 A;  3OZ2 A;  3NHO X;  2BRY A;  4Y4M A;  1NG4 A;  4JGT A;  3BI2 A;  2NVK X;  4Z43 A;  4U8L A;  3NH3 X;  2XCG A;  4II2 A;  1TYT A;  3DJJ A;  2OAL A;  4YKG A;  3NTA A;  1CWT A;  4G6G A;  3SFE A;  1EBD A;  1CWS A;  2BS3 A;  3AEC A;  1RYI A;  3II4 A;  2Y6Q A;  4H2Q A;  1HYU A;  4U8N A;  1NPX A;  3TG1 B;  3AE7 A;  1LTX R;  4H4X A;  3DA1 A;  3CND A;  4EQS A;  2I0Z A;  1ELI A;  4YTM A;  5IQ4 A;  5FS6 A;  5L46 A;  3E1T A;  2C7G A;  4WCT A;  1VEE A;  3PVC A;  1DOB A;  2BK4 A;  4LII A;  4O5Q A;  2GR0 A;  2X8C A;  1LVL A;  4A6N B;  4NZH A;  4CBQ A;  4J33 A;  5BUK A;  3HIX A;  4TM1 A;  4NTD A;  4X4J A;  4I58 A;  1WHB A;  2YG6 A;  2IVE A;  3I3U A;  2UZQ A;  1PS9 A;  2YLW A;  3GMC A;  1D7L A;  5JCL A;  2WET A;  2XFO A;  3DH9 A;  3R2U A;  3LXD A;  2BS2 A;  4B63 A;  2ZZC A;  5HHF A;  3UKH A;  4B64 A;  2YM2 A;  2VQB A;  1ONF A;  1JNZ A;  2WPE A;  2YLX A;  3DJE A;  2GQF A;  4EM4 A;  3SZF A;  4NEW A;  4XXG A;  1BGJ A;  4C5O A;  4FDC B;  1E39 A;  2JAE A;  2XVI A;  1DJQ A;  1K0L A;  4RG4 A;  2C70 A;  2C64 A;  1CBO A;  3ATQ A;  4H4Q A;  4H4T A;  4YSY A;  4PAB A;  2XFU A;  3UOV A;  4J57 A;  5LAM A;  3IPO A;  1Q1R A;  2YG3 A;  3CTY A;  4YKF A;  3EPT A;  3K9R A;  3RED A;  3KA7 A;  1JEH A;  2CVJ A;  2FBW A;  2XFN A;  4OPU A;  3O3W A;  2EG4 A;  1GTH A;  2TPR A;  3CGD A;  5M0Z A;  5U1O A;  3CNT A;  2JB1 A;  3CPH G;  1Q9I A;  4HA6 A;  4B67 A;  3K7T A;  2GAG B;  4NNJ A;  4H7U A;  2PYX A;  2YQU A;  5EB4 A;  1GTE A;  4HB9 A;  3MZZ A;  3P9U A;  3UKF A;  4JY3 A;  4H2R A;  3T2Z A;  4BK1 A;  3AEA A;  1E1M A;  4CY6 A;  3CNS A;  4O5U A;  3GRT A;  1TDN A;  3CN8 A;  5JCN A;  4GAP A;  1YQ4 A;  2C4C A;  3NG7 X;  4GDP A;  2C3C A;  3NK2 X;  1NHS A;  2R46 A;  3KD9 A;  3FNJ A;  2OA1 A;  3IHM A;  3EF6 A;  1GER A;  1FEA A;  4A5L A;  3ADA B;  1E7P A;  1DOD A;  3PO7 A;  2ZZB A;  1MOK A;  1RHD A;  3UP4 A;  2R0C A;  4ICY A;  2BC0 A;  2Q7V A;  3NN0 X;  1PXA A;  4MJW A;  5KMS A;  1DXL A;  1KSS A;  1DNC A;  3KU9 A;  1EL5 A;  2ACZ A;  2OUC A;  3T37 A;  1GAL A;  5HY5 A;  3EAO A;  4K7Z A;  1GT8 A;  3RP8 A;  3O0H A;  4UDP A;  3FMW A;  1COY A;  2XDO A;  3JSK A;  4TM0 A;  1F3P A;  4LA1 A;  4DNA A;  1CJ3 A;  3V3O A;  3SGL A;  3NTD A;  2CFY A;  3S5W A;  3IWH A;  5HBO A;  1IUT A;  2YM1 A;  2YR4 A;  2XVE A;  1TDF A;  2WDV A;  1AOG A;  1KNP A;  3BNU A;  3K7M X;  3NK1 X;  1PXB A;  4TLX A;  3V76 A;  2JTS A;  2FJE A;  4YT0 A;  2BS4 A;  3QSE A;  2WU5 A;  3AE6 A;  3CPJ G;  1YS0 A;  2R4J A;  2V3A A;  4X9M A;  3H8L A;  5DBJ A;  4CCR A;  3V3N A;  1VG9 A;  3P3A A;  2BA9 A;  3BI4 A;  3KLJ A;  3M13 A;  3AXB A;  4GUV A;  4C3X A;  1PJ5 A;  3CGB A;  1EL8 A;  1S3B A;  1GRA A;  1H7X A;  3IC9 A;  3URH A;  2XVH A;  3QFA A;  4OPT A;  3AED A;  3ITJ A;  2A89 A;  1L0V A;  1W4X A;  4BJY A;  3ALJ A;  4IA5 A;  2YVF A;  5KOX A;  3GDP A;  2X50 A;  2BYB A;  1O5W A;  1ZK7 A;  2VOU A;  2YG5 A;  2QCU A;  2RGO A;  4EMI A;  3AE3 A;  4Z26 A;  3UKP A;  4B69 A;  3D1P A;  2H89 A;  1L9E A;  3CIR A;  3PS9 A;  2VZ2 A;  4K22 A;  4K5S A;  1S2Y A;  1KSU A;  1SEZ A;  1S3E A;  2H88 A;  4TLZ A;  3S61 A;  2C73 A;  4J31 A;  1BZL A;  3ILM A;  2ZZ0 A;  4BK3 A;  1E0C A;  5JCI A;  1MXT A;  2WLX A;  1CHU A;  3T2K A;  4EQR A;  4GCM A;  2VVM A;  2IVD A;  1OKG A;  3HYX A;  1YY5 A;  1GND A;  4ZCD A;  3OC4 A;  5KMP A;  2EQ8 A;  3EAN A;  3F4A A;  2ARD A;  2OAM A;  3NLC A;  2QA2 A;  5HPA A;  2BCG G;  4IV9 A;  1FCD A;  2V5Z A;  4P9S A;  4NWZ A;  3UOY A;  4ECH A;  2FJA A;  2XVJ A;  2WPF A;  3ICR A;  4E0V A;  5HYM A;  1ZX9 A;  2EQ9 A;  3NNE A;  1GV4 A;  1GOS A;  2XLU A;  2JB3 A;  1M6I A;  1JU2 A;  1YMD A;  1N1P A;  3SXI A;  2E1M A;  4D03 A;  5IPY A;  1QO8 A;  3K7Q X;  1TRB A;  1RP0 A;  1OJT A;  3B6D A;  3NIX A;  1LQT A;  1IUS A;  3Q9T A;  2GWF A;  2E4G A;  2WPC A;  3QVR A;  3G5J A;  1JOA A;  3M0O A;  5LV9 A;  3SM8 A;  1TYP A;  4YTP A;  1DOC A;  3AYI A;  4GAV A;  3NYF A;  2GV8 A;  2WOW A;  2C67 A;  1PBF A;  2B7R A;  1MO9 A;  3TP9 A;  1EL9 A;  3ISH A;  1VRQ B;  1LPF A;  3AE9 A;  1F8R A;  2C75 A;  4G73 A;  3T2Y A;  3VR9 A;  5EB5 A;  2AQJ A;  3P4P A;  1E1L A;  2Q6U A;  3AE5 A;  4JQ9 A;  2VRL A;  2WOI A;  4CY8 A;  3RP6 A;  3UKL A;  2YAU A;  3AAX A;  2YLR A;  2JKC A;  5KOW A;  2A2K A;  3I2V A;  4JNA A;  3CGE A;  1H4M X;  4U2S A;  1D7Y A;  1PBE A;  1X31 B;  2XLT A;  4U2L A;  4EM3 A;  1EL7 A;  4IA6 A;  3AEG A;  4DSG A;  3AEF A;  1JRY A;  1FEC A;  1NG3 A;  3ZDN A;  1GRE A;  1OJD A;  1ZMC A;  3DK4 A;  2BXS A;  2GR2 A;  4IVM B;  2DCQ A;  4OPI A;  4A9W A;  3VRB A;  1ZY8 A;  3FPZ A;  4U8O A;  3SFD A;  2RAB A;  4X9N A;  1H81 A;  1KF6 A;  2AR8 A;  2CDU A;  4GRT A;  4H4Y A;  5U25 A;  3C96 A;  3VR8 A;  2GR3 A;  1JRX A;  1V59 A;  2Q82 A;  2FJD A;  2FJB A;  1PJ7 A;  2YR5 A;  3Q6J A;  4C77 A;  3BHF A;  3K30 A;  3DGH A;  3QSM A;  2C65 A;  3OLH A;  2APG A;  4II3 A;  4AT2 A;  4KPR A;  4J36 A;  1BOH A;  1YML A;  3KVE A;  3GYX A;  1K0J A;  2C76 A;  5U63 A;  3KPK A;  2WQY A;  1K4Q A;  1TDO A;  4YSZ A;  1Z6L A;  4Z25 A;  2XVF A;  2Z5X A;  4A6N A;  1LJ1 A;  4NTE A;  5BRT A;  2GQW A;  2VVL A;  4RG3 A;  1GRG A;  4A99 A;  5BVA A;  3D1C A;  4J2W A;  1JRZ A;  1BKW A;  2VQ7 A;  3NT6 A;  1F8W A;  1FL2 A;  2GH5 A;  2V6O A;  1H82 A;  5EBK A;  4Z44 A;  1PDH A;  5KMR A;  1GES A;  1TQ1 A;  2B9W A;  2C72 A;  4N9X A;  2X3N A;  4ADW A;  4APN A;  4BJZ A;  5HXI A;  2V61 A;  3WE0 A;  3CGC A;  1FEB A;  4WH7 A;  4A65 A;  1ORB A;  1BOI A;  3AE8 A;  4XWR A;  1RHS A;  5J7X A;  4YSX A;  1L9D A;  2WLR A;  1QB0 A;  3ALM A;  1LQU A;  1CL0 A;  4U8K A;  3AE4 A;  4Z2U A;  1QJD A;  3GYJ A;  1D5T A;  3AD8 B;  3ABV A;  1D4D A;  1N4U A;  1XHC A;  4AOX A;  2ORA A;  1D4C A;  4CNJ A;  4D04 A;  3NRN A;  1CF3 A;  3UTF A;  4F67 A;  1GRF A;  3TG3 A;  4J34 A;  2B9X A;  1YQZ A;  1ZOV A;  3M12 A;  3HZU A;  2GRT A;  1YMK A;  3NYC A;  4A79 A;  2GF3 A;  4EQX A;  3QFB A;  2WEU A;  1BF3 A;  2IFV A;  1GXF A;  3CPI G;  1VG0 A;  5C3J A;  3UKQ A;  3UTN X;  1NDA A;  4TM3 A;  1M64 A;  3FIM B;  3P4S A;  1NHQ A;  3RHA A;  1ZKQ A;  4ZCC A;  5KXJ A;  5FS7 A;  2A87 A;  2V60 A;  5CKU A;  3GK5 A;  5C2T A;  2OLO A;  5KRQ A;  1GPE A;  4C3Y A;  3BNM A;  3GDN A;  4H4Z A;  1B8S A;  3HYW A;  1Y56 A;  4H4W A;  4Y4N A;  5FS9 A;  1TDK A;  4G9K A;  1GSN A;  3AYJ A;  1QLB A;  2BC1 A;  2A8X A;  3C4N A;  4REK A;  2C3D A;  1E1K A;  1REO A;  3GD3 A;  4LU6 A;  5KMQ A;  4U8I A;  2W0H A;  3GMB A;  3AEE A;  2WP9 A;  1PJ6 A;  1PXC A;  1H4K X;  3SY4 A;  2HHG A;  2IFD A;  3QJ4 A;  3CNP A;  2XYO A;  5IQ1 A;  3SX6 A;  4H2N A;  4FK1 A;  1O94 A;  3AD7 B;  2JB2 A;  4YXD A;  1XAN A;  1GN0 A;  3LJP A;  2XLR A;  4Z2T A;  1JNR A;  3ZYX A;  3T14 A;  1ZP0 A;  2BAB A;  3L8K A;  4H4S A;  5KNL A;  3T0K A;  4FK1 C;  4H4V A;  4IVO B;  2QA1 A;  4BV6 A;  5LAO A;  2GAH B;  4U8J A;  2DKH A;  3AE1 A;  3G5Q A;  1YT8 A;  4JY2 A;  2PHH A;  1QXN A;  3FOJ A;  2NPX A;  3CMM A;  3DJD A;  3ICT A;  1B37 A;  4G6H A;  4CNK A;  3G5S A;  4Y4L A;  3T31 A;  2VSW A;  3SQP A;  1URH A;  3KKJ A;  4USR A;  5CQF A;  1PBB A;  3UP5 A;  3I6D A;  5KVH A;  2HQM A;  3FBS A;  1T3K A;  4J56 A;  1DJN A;  1GRT A;  5M10 A;  1LV0 A;  4OPG A;  2WP5 A;  3UTG A;  1OJC A;  2B9Y A;  2X99 A;  2EG4 B;  3DJG X;  3GRS A;  1UAR A;  4GR1 A;  4H4P A;  3HYV A;  3L1R A;  3NHV A;  1GRB A;  2Q0K A;  4OPC A;  1PHH A;  2GMH A;  4OPD A;  3P1W A;  2GVC A;  4AT0 A;  3DK9 A;  4DGK A;  2AAQ A;  4CRT A;  4B66 A;  3UKA A;  3F8P A;  3ATR A;  4OPL A;  1KFY A;  1DP2 A;  3AWI A;  1H83 A;  3GD4 A;  4U8M A;  3RNM A;  4EQW A;  3COX A;  1FOH A;  3FLH A;  3P4R A;  3UTE A;  2DKI A;  2IID A;  2EQ6 A;  2RGH A;  2BRA A;  1B5Q A;  2TMD A;  2YVJ A;  1N4W A;  1VQW A;  3GWD A;  4K2X A;  4BK2 A;  4Z2R A;  2BXR A;  4H4U A;  1H86 A;  1OJ9 A;  1IUW A;  3BHK A;  1OJA A;  5HBQ A;  2WDR A;  2GR1 A;  4NEV A;  2XLS A;  2X8H A;  3UTH A;  5HBP A;  1BGN A;  3UOZ A;  1VDC A;  4YTN A;  1F6M A;  1E6E A;  4FX9 A;  2JTQ A;  1Y0P A;  5HBL A;  1GRH A;  4BUR A;  4CCQ A;  2BK3 A;  1KDG A;  1CWR A;  3DK8 A;  2WP6 A;  1XDI A;  2MRM A;  2VVL G;  3VRD B;  1IUV A;  1TDE A;  1O95 A;  3AEB A;  1H84 A;  2Q0L A;  3IWA A;  4UDR A;  3SYI A;  3HWI A;  5JCM A;  2R4E A;  1IJH A;  1UKV G;  1YKJ A;  2GEW A;  3F8D A;  3NN6 X;  1ZOY A;  4YSH A;  1D4E A;  4JDR A;  4DSH A;  4KX6 A;  3GSI A;  1B4V A;  4U2T A;  1K0I A;  4EMW A;  3UCL A;  2R0G A;  5TR3 A;  3FG2 P;  3IPP A;  4H50 A;  1NHR A;  1YQ3 A;  1HZM A;  5FS8 A;  2YWL A;  3NK0 X;  3BI5 A;  3GWF A;  1PN0 A;  2R9Z A;  3NKS A;  3LOV A;  4NTC A;  2K0Z A;  4B68 A;  2F5Z A;  2MOL A;  4GF7 A;  4OVI A;  2J6P A;  1CJ2 A;  1XPQ A;  4GDE A;  5EOW A;  3F8R A;  1Q1W A;  5J60 A;  5BUL A;  3AD9 B;  3RP7 A;  4ZN0 A;  2XFP A;  3ICS A;  1CC2 A;  2GMJ A;  5ER0 A;  1GEU A;  2YR6 A;  1NEN A;  1C25 A;  1Y56 B;  2YG7 A;  1CJ4 A;  3LAD A;  4TM4 A;  4B1B A;  2WES A;  4A7A A;  4EIQ A;  1NHP A;  2JBV A;  3AYL A;  2YLT A;  5JCK A;  3NYE A;  3P4Q A;  3OP3 A;  3D8X A;  3B3R A;  3CNJ A;  2WS3 A;  4M52 A;  4EIP A;  2QAE A;  4YWO A;  3IF9 A;  2WDQ A;  1N4V A;  4U8P A;  4XWZ A;  1NAA A;  3AE2 A;  3QVP A;  3SZW A;  1ZDL A;  3VQR A;  4C74 A;  5KWF A;  2X8G A;  3AAY A;  2XFQ A;  5KVI A;  1CC4 A;  3SZC A;  2YLS A; 
#chains in the Genus database with same CATH homology
 4WH9 A;  1L9C A;  4USQ A;  3AB1 A;  3KPF A;  2JTR A;  2R0P A;  5GRT A;  3UKK A;  3I3L A;  3QSS A;  1E1N A;  4Z24 A;  2XLP A;  2KL3 A;  1PBD A;  1S2Q A;  3FS5 A;  3DME A;  1IUX A;  1ZMD A;  2EQ7 A;  4WX1 A;  4H4R A;  1F8S A;  2O9Z A;  3UOX A;  5FMH A;  4EMJ A;  2RGJ A;  2ZBW A;  1PBC A;  2FSX A;  1P2E A;  2J3N A;  4B65 A;  2BK5 A;  3G5R A;  1H7W A;  1KNR A;  2B7S A;  2BCP A;  3GYI A;  3VRA A;  2WHD A;  3ALL A;  2UZZ A;  1RSG A;  2CUL A;  4JNQ A;  2YLZ A;  4G74 A;  4AOS A;  2WU2 A;  2WBA A;  4AP1 A;  2Y6R A;  4AP3 A;  1P2H A;  1GET A;  1H6V A;  3H4K A;  2E5V A;  4JN9 A;  2OLN A;  3H8I A;  1GMX A;  4OCG A;  2BAC A;  3LB8 A;  2V3B A;  3LZX A;  1WV9 A;  4RSL A;  4H2P A;  1YM9 A;  4UP3 A;  3R9U A;  3LZW A;  1NEK A;  2YVG A;  2YG4 A;  2B76 A;  1DOE A;  2VRM A;  4PAA A;  3SZ0 A;  1CC6 A;  3DGZ A;  2Z5Y A;  3C4A A;  3IHG A;  2MOI A;  3HZL A;  1BWC A;  4I59 A;  4K5R A;  1IUU A;  2WOV A;  4K8D A;  2GB0 A;  4UDQ A;  5GSN A;  1CJC A;  2R45 A;  3NGC X;  2JK6 A;  2EG3 A;  2C66 A;  3OZ2 A;  3NHO X;  2BRY A;  4Y4M A;  1NG4 A;  4JGT A;  3BI2 A;  2NVK X;  4Z43 A;  4U8L A;  3NH3 X;  2XCG A;  4II2 A;  1TYT A;  3DJJ A;  2OAL A;  4YKG A;  3NTA A;  1CWT A;  4G6G A;  3SFE A;  1EBD A;  1CWS A;  2BS3 A;  3AEC A;  1RYI A;  3II4 A;  2Y6Q A;  4H2Q A;  1HYU A;  4U8N A;  1NPX A;  3TG1 B;  3AE7 A;  1LTX R;  4H4X A;  3DA1 A;  3CND A;  4EQS A;  2I0Z A;  1ELI A;  4YTM A;  5IQ4 A;  5FS6 A;  5L46 A;  3E1T A;  2C7G A;  4WCT A;  1VEE A;  3PVC A;  1DOB A;  2BK4 A;  4LII A;  4O5Q A;  2GR0 A;  2X8C A;  1LVL A;  4A6N B;  4NZH A;  4CBQ A;  4J33 A;  5BUK A;  3HIX A;  4TM1 A;  4NTD A;  4X4J A;  4I58 A;  1WHB A;  2YG6 A;  2IVE A;  3I3U A;  2UZQ A;  1PS9 A;  2YLW A;  3GMC A;  1D7L A;  5JCL A;  2WET A;  2XFO A;  3DH9 A;  3R2U A;  3LXD A;  2BS2 A;  4B63 A;  2ZZC A;  5HHF A;  3UKH A;  4B64 A;  2YM2 A;  2VQB A;  1ONF A;  1JNZ A;  2WPE A;  2YLX A;  3DJE A;  2GQF A;  4EM4 A;  3SZF A;  4NEW A;  4XXG A;  1BGJ A;  4C5O A;  4FDC B;  1E39 A;  2JAE A;  2XVI A;  1DJQ A;  1K0L A;  4RG4 A;  2C70 A;  2C64 A;  1CBO A;  3ATQ A;  4H4Q A;  4H4T A;  4YSY A;  4PAB A;  2XFU A;  3UOV A;  4J57 A;  5LAM A;  3IPO A;  1Q1R A;  2YG3 A;  3CTY A;  4YKF A;  3EPT A;  3K9R A;  3RED A;  3KA7 A;  1JEH A;  2CVJ A;  2FBW A;  2XFN A;  4OPU A;  3O3W A;  2EG4 A;  1GTH A;  2TPR A;  3CGD A;  5M0Z A;  5U1O A;  3CNT A;  2JB1 A;  3CPH G;  1Q9I A;  4HA6 A;  4B67 A;  3K7T A;  2GAG B;  4NNJ A;  4H7U A;  2PYX A;  2YQU A;  5EB4 A;  1GTE A;  4HB9 A;  3MZZ A;  3P9U A;  3UKF A;  4JY3 A;  4H2R A;  3T2Z A;  4BK1 A;  3AEA A;  1E1M A;  4CY6 A;  3CNS A;  4O5U A;  3GRT A;  1TDN A;  3CN8 A;  5JCN A;  4GAP A;  1YQ4 A;  2C4C A;  3NG7 X;  4GDP A;  2C3C A;  3NK2 X;  1NHS A;  2R46 A;  3KD9 A;  3FNJ A;  2OA1 A;  3IHM A;  3EF6 A;  1GER A;  1FEA A;  4A5L A;  3ADA B;  1E7P A;  1DOD A;  3PO7 A;  2ZZB A;  1MOK A;  1RHD A;  3UP4 A;  2R0C A;  4ICY A;  2BC0 A;  2Q7V A;  3NN0 X;  1PXA A;  4MJW A;  5KMS A;  1DXL A;  1KSS A;  1DNC A;  3KU9 A;  1EL5 A;  2ACZ A;  2OUC A;  3T37 A;  1GAL A;  5HY5 A;  3EAO A;  4K7Z A;  1GT8 A;  3RP8 A;  3O0H A;  4UDP A;  3FMW A;  1COY A;  2XDO A;  3JSK A;  4TM0 A;  1F3P A;  4LA1 A;  4DNA A;  1CJ3 A;  3V3O A;  3SGL A;  3NTD A;  2CFY A;  3S5W A;  3IWH A;  5HBO A;  1IUT A;  2YM1 A;  2YR4 A;  2XVE A;  1TDF A;  2WDV A;  1AOG A;  1KNP A;  3BNU A;  3K7M X;  3NK1 X;  1PXB A;  4TLX A;  3V76 A;  2JTS A;  2FJE A;  4YT0 A;  2BS4 A;  3QSE A;  2WU5 A;  3AE6 A;  3CPJ G;  1YS0 A;  2R4J A;  2V3A A;  4X9M A;  3H8L A;  5DBJ A;  4CCR A;  3V3N A;  1VG9 A;  3P3A A;  2BA9 A;  3BI4 A;  3KLJ A;  3M13 A;  3AXB A;  4GUV A;  4C3X A;  1PJ5 A;  3CGB A;  1EL8 A;  1S3B A;  1GRA A;  1H7X A;  3IC9 A;  3URH A;  2XVH A;  3QFA A;  4OPT A;  3AED A;  3ITJ A;  2A89 A;  1L0V A;  1W4X A;  4BJY A;  3ALJ A;  4IA5 A;  2YVF A;  5KOX A;  3GDP A;  2X50 A;  2BYB A;  1O5W A;  1ZK7 A;  2VOU A;  2YG5 A;  2QCU A;  2RGO A;  4EMI A;  3AE3 A;  4Z26 A;  3UKP A;  4B69 A;  3D1P A;  2H89 A;  1L9E A;  3CIR A;  3PS9 A;  2VZ2 A;  4K22 A;  4K5S A;  1S2Y A;  1KSU A;  1SEZ A;  1S3E A;  2H88 A;  4TLZ A;  3S61 A;  2C73 A;  4J31 A;  1BZL A;  3ILM A;  2ZZ0 A;  4BK3 A;  1E0C A;  5JCI A;  1MXT A;  2WLX A;  1CHU A;  3T2K A;  4EQR A;  4GCM A;  2VVM A;  2IVD A;  1OKG A;  3HYX A;  1YY5 A;  1GND A;  4ZCD A;  3OC4 A;  5KMP A;  2EQ8 A;  3EAN A;  3F4A A;  2ARD A;  2OAM A;  3NLC A;  2QA2 A;  5HPA A;  2BCG G;  4IV9 A;  1FCD A;  2V5Z A;  4P9S A;  4NWZ A;  3UOY A;  4ECH A;  2FJA A;  2XVJ A;  2WPF A;  3ICR A;  4E0V A;  5HYM A;  1ZX9 A;  2EQ9 A;  3NNE A;  1GV4 A;  1GOS A;  2XLU A;  2JB3 A;  1M6I A;  1JU2 A;  1YMD A;  1N1P A;  3SXI A;  2E1M A;  4D03 A;  5IPY A;  1QO8 A;  3K7Q X;  1TRB A;  1RP0 A;  1OJT A;  3B6D A;  3NIX A;  1LQT A;  1IUS A;  3Q9T A;  2GWF A;  2E4G A;  2WPC A;  3QVR A;  3G5J A;  1JOA A;  3M0O A;  5LV9 A;  3SM8 A;  1TYP A;  4YTP A;  1DOC A;  3AYI A;  4GAV A;  3NYF A;  2GV8 A;  2WOW A;  2C67 A;  1PBF A;  2B7R A;  1MO9 A;  3TP9 A;  1EL9 A;  3ISH A;  1VRQ B;  1LPF A;  3AE9 A;  1F8R A;  2C75 A;  4G73 A;  3T2Y A;  3VR9 A;  5EB5 A;  2AQJ A;  3P4P A;  1E1L A;  2Q6U A;  3AE5 A;  4JQ9 A;  2VRL A;  2WOI A;  4CY8 A;  3RP6 A;  3UKL A;  2YAU A;  3AAX A;  2YLR A;  2JKC A;  5KOW A;  2A2K A;  3I2V A;  4JNA A;  3CGE A;  1H4M X;  4U2S A;  1D7Y A;  1PBE A;  1X31 B;  2XLT A;  4U2L A;  4EM3 A;  1EL7 A;  4IA6 A;  3AEG A;  4DSG A;  3AEF A;  1JRY A;  1FEC A;  1NG3 A;  3ZDN A;  1GRE A;  1OJD A;  1ZMC A;  3DK4 A;  2BXS A;  2GR2 A;  4IVM B;  2DCQ A;  4OPI A;  4A9W A;  3VRB A;  1ZY8 A;  3FPZ A;  4U8O A;  3SFD A;  2RAB A;  4X9N A;  1H81 A;  1KF6 A;  2AR8 A;  2CDU A;  4GRT A;  4H4Y A;  5U25 A;  3C96 A;  3VR8 A;  2GR3 A;  1JRX A;  1V59 A;  2FJD A;  2FJB A;  2YR5 A;  1PJ7 A;  3Q6J A;  4C77 A;  4YSX A;  3BHF A;  3K30 A;  3DGH A;  3QSM A;  2C65 A;  3OLH A;  2APG A;  4II3 A;  4AT2 A;  4KPR A;  4J36 A;  1BOH A;  1YML A;  3KVE A;  3GYX A;  1K0J A;  2C76 A;  5U63 A;  3KPK A;  2WQY A;  1K4Q A;  1TDO A;  4YSZ A;  1Z6L A;  4Z25 A;  2XVF A;  2Z5X A;  4A6N A;  1LJ1 A;  4NTE A;  5BRT A;  2GQW A;  2VVL A;  4RG3 A;  1GRG A;  4A99 A;  5BVA A;  3D1C A;  4J2W A;  1JRZ A;  1BKW A;  2VQ7 A;  3NT6 A;  1F8W A;  1FL2 A;  2GH5 A;  2V6O A;  1H82 A;  5EBK A;  4Z44 A;  1PDH A;  5KMR A;  1GES A;  1TQ1 A;  2B9W A;  2C72 A;  4N9X A;  2X3N A;  4ADW A;  4APN A;  4BJZ A;  5HXI A;  2V61 A;  3WE0 A;  3CGC A;  1FEB A;  4WH7 A;  4A65 A;  1ORB A;  1BOI A;  3AE8 A;  4XWR A;  1RHS A;  5J7X A;  1L9D A;  2WLR A;  1QB0 A;  3ALM A;  1LQU A;  1CL0 A;  4U8K A;  3AE4 A;  4Z2U A;  1QJD A;  3GYJ A;  1D5T A;  3AD8 B;  3ABV A;  1D4D A;  1N4U A;  1XHC A;  4AOX A;  2ORA A;  1D4C A;  4CNJ A;  4D04 A;  3NRN A;  1CF3 A;  3UTF A;  4F67 A;  1GRF A;  3TG3 A;  4J34 A;  2B9X A;  1YQZ A;  1ZOV A;  3M12 A;  3HZU A;  2GRT A;  1YMK A;  3NYC A;  4A79 A;  2GF3 A;  4EQX A;  3QFB A;  2WEU A;  1BF3 A;  2IFV A;  1GXF A;  3CPI G;  1VG0 A;  5C3J A;  3UKQ A;  3UTN X;  1NDA A;  4TM3 A;  1M64 A;  3FIM B;  3P4S A;  1NHQ A;  3RHA A;  1ZKQ A;  4ZCC A;  5KXJ A;  5FS7 A;  2A87 A;  2V60 A;  5CKU A;  3GK5 A;  5C2T A;  2OLO A;  5KRQ A;  1GPE A;  4C3Y A;  3BNM A;  3GDN A;  4H4Z A;  1B8S A;  3HYW A;  1Y56 A;  4H4W A;  4Y4N A;  5FS9 A;  1TDK A;  4G9K A;  1GSN A;  3AYJ A;  1QLB A;  2BC1 A;  2A8X A;  3C4N A;  4REK A;  2C3D A;  1E1K A;  1REO A;  3GD3 A;  4LU6 A;  5KMQ A;  4U8I A;  2W0H A;  3GMB A;  3AEE A;  2WP9 A;  1PJ6 A;  1PXC A;  1H4K X;  3SY4 A;  2HHG A;  2IFD A;  3QJ4 A;  3CNP A;  2XYO A;  5IQ1 A;  3SX6 A;  4H2N A;  4FK1 A;  1O94 A;  3AD7 B;  2JB2 A;  4YXD A;  1XAN A;  1GN0 A;  3LJP A;  2XLR A;  4Z2T A;  1JNR A;  3ZYX A;  3T14 A;  1ZP0 A;  2BAB A;  3L8K A;  4H4S A;  5KNL A;  3T0K A;  4FK1 C;  4H4V A;  4IVO B;  2QA1 A;  4BV6 A;  5LAO A;  2GAH B;  4U8J A;  2DKH A;  3AE1 A;  3G5Q A;  1YT8 A;  4JY2 A;  2PHH A;  1QXN A;  3FOJ A;  2NPX A;  3CMM A;  3DJD A;  3ICT A;  1B37 A;  4G6H A;  4CNK A;  3G5S A;  4Y4L A;  3T31 A;  2VSW A;  3SQP A;  1URH A;  3KKJ A;  4USR A;  5CQF A;  1PBB A;  3UP5 A;  3I6D A;  5KVH A;  2HQM A;  3FBS A;  1T3K A;  4J56 A;  1DJN A;  1GRT A;  5M10 A;  1LV0 A;  4OPG A;  2WP5 A;  3UTG A;  1OJC A;  2B9Y A;  2X99 A;  2EG4 B;  3DJG X;  3GRS A;  1UAR A;  4GR1 A;  4H4P A;  3HYV A;  3L1R A;  3NHV A;  1GRB A;  2Q0K A;  4OPC A;  1PHH A;  2GMH A;  4OPD A;  3P1W A;  2GVC A;  4AT0 A;  3DK9 A;  4DGK A;  2AAQ A;  4CRT A;  4B66 A;  3UKA A;  3F8P A;  3ATR A;  4OPL A;  1KFY A;  1DP2 A;  3AWI A;  1H83 A;  3GD4 A;  4U8M A;  3RNM A;  4EQW A;  3COX A;  1FOH A;  3FLH A;  3P4R A;  3UTE A;  2DKI A;  2IID A;  2EQ6 A;  2RGH A;  2BRA A;  1B5Q A;  2TMD A;  2YVJ A;  1N4W A;  1VQW A;  3GWD A;  4K2X A;  4BK2 A;  4Z2R A;  2BXR A;  4H4U A;  1H86 A;  1OJ9 A;  1IUW A;  3BHK A;  1OJA A;  5HBQ A;  2WDR A;  2GR1 A;  4NEV A;  2XLS A;  2X8H A;  3UTH A;  5HBP A;  1BGN A;  3UOZ A;  1VDC A;  4YTN A;  1F6M A;  1E6E A;  4FX9 A;  2JTQ A;  1Y0P A;  5HBL A;  1GRH A;  4BUR A;  4CCQ A;  2BK3 A;  1KDG A;  1CWR A;  3DK8 A;  2WP6 A;  1XDI A;  2MRM A;  2VVL G;  3VRD B;  1IUV A;  1TDE A;  1O95 A;  3AEB A;  1H84 A;  2Q0L A;  3IWA A;  4UDR A;  3SYI A;  3HWI A;  5JCM A;  2R4E A;  1IJH A;  1UKV G;  1YKJ A;  2GEW A;  3F8D A;  3NN6 X;  1ZOY A;  4YSH A;  1D4E A;  4JDR A;  4DSH A;  4KX6 A;  3GSI A;  1B4V A;  4U2T A;  1K0I A;  4EMW A;  3UCL A;  2R0G A;  5TR3 A;  3FG2 P;  3IPP A;  4H50 A;  1NHR A;  1YQ3 A;  1HZM A;  5FS8 A;  2YWL A;  3NK0 X;  3BI5 A;  3GWF A;  1PN0 A;  2R9Z A;  3NKS A;  3LOV A;  4NTC A;  2K0Z A;  4B68 A;  2F5Z A;  2MOL A;  4GF7 A;  4OVI A;  2J6P A;  1CJ2 A;  1XPQ A;  4GDE A;  5EOW A;  3F8R A;  1Q1W A;  5J60 A;  5BUL A;  3AD9 B;  3RP7 A;  4ZN0 A;  2XFP A;  3ICS A;  1CC2 A;  2GMJ A;  5ER0 A;  1GEU A;  2YR6 A;  1NEN A;  1C25 A;  1Y56 B;  2YG7 A;  1CJ4 A;  3LAD A;  4TM4 A;  4B1B A;  2WES A;  4A7A A;  4EIQ A;  1NHP A;  2JBV A;  3AYL A;  2YLT A;  5JCK A;  3NYE A;  3P4Q A;  3OP3 A;  3D8X A;  3B3R A;  3CNJ A;  2WS3 A;  4M52 A;  4EIP A;  2QAE A;  4YWO A;  3IF9 A;  2WDQ A;  1N4V A;  4U8P A;  4XWZ A;  1NAA A;  3AE2 A;  3QVP A;  3SZW A;  1ZDL A;  3VQR A;  4C74 A;  5KWF A;  2X8G A;  3AAY A;  2XFQ A;  5KVI A;  1CC4 A;  3SZC A;  2YLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...