4OCGA

Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase f161a mutant
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
565
structure length
565
Chain Sequence
MKKILIIGGVAGGASAAARARRLSETAEIIMFERGEYVSFANCGLPYHISGEIAQRSALVLQTPESFKARFNVEVRVKHEVVAIDRAAKLVTVRRLLDGSEYQESYDTLLLSPGAAPIVPPIPGVDNPLTHSLRNIPDMDRILQTIQMNNVEHATVVGGGAIGLEMMESLHHLGIKTTLLELADQVMTPVDREMAGFAHQAIRDQGVDLRLGTALSEVSYQVQTHVASDAAGEDTAHQHIKGHLSLTLSNGELLETDLLIMAIGVRPETQLARDAGLAIGELGGIKVNAMMQTSDPAIYAVGDAVEEQDFVTGQACLVPLAGPANRQGRMAADNMFGREERYQGTQGTAICKVFDLAVGATGKNEKQLKQAGIAFEKVYVHTASHASYYPGAEVVSFKLLFDPVKGTIFGAQAVGKDGIDKRIDVMAVAQRAGMTVEQLQHLELSYAPPYGSAKDVINQAAFVASNIIKGDATPIHFDQIDNLSEDQLLLDVRNPGELQNGGLEGAVNIPVDELRDRMHELPKDKEIIIFCQVGLRGNVAYRQLVNNGYRARNLIGGYRTYKFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords FAD-dependent pyridine nucleotide-disulphide oxidoreductase
publication title Characterization of the mechanism of the NADH-dependent polysulfide reductase (Npsr) from Shewanella loihica PV-4: Formation of a productive NADH-enzyme complex and its role in the general mechanism of NADH and FAD-dependent enzymes.
pubmed doi rcsb
source organism Shewanella loihica
total genus 185
structure length 565
sequence length 565
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 4ocgA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ocgA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ocgA01
5DBJA 3GYIA 3AYLA 4YKGA 1DP2A 1ZKQA 1NENA 1PBBA 4EMWA 2C3CA 2V61A 3NHVA 3FLHA 1GRBA 2VVLA 4B69A 4GRTA 4YWOA 2FJDA 4U8PA 3I2VA 1RHDA 4NZHA 1YS0A 4YXDA 2EQ6A 1JRXA 3R2UA 3UP4A 4YT0A 5HY5A 3MZZA 2WOVA 1GSNA 1GV4A 3DK8A 3DJJA 4RG3A 2Y6RA 3UTHA 2JKCA 3TG3A 2YM1A 2YVJA 4APNA 1ZP0A 2ZBWA 1GOSA 1VRQB 3BI5A 3NRNA 3UKHA 4A99A 2OAMA 2GQWA 1ZOVA 1FL2A 5J7XA 1KSSA 4OCGA 3S61A 4TLXA 2YG5A 3NNEA 1YT8A 1BKWA 1SEZA 4H4YA 3UKFA 1ZDLA 3DK4A 2VOUA 3AWIA 1QXNA 2YWLA 3QSSA 2JTQA 5U25A 4D04A 3SFDA 1GRGA 2Q0LA 2WDVA 1GERA 1KDGA 1YQZA 3AYJA 4YSYA 4TM3A 1UARA 4IVOB 1ZMCA 1RHSA 1S3EA 3C4AA 2BC1A 2JBVA 5J60A 1BGJA 4GCMA 4U8IA 2YG6A 3ICRA 2GMJA 1YQ3A 3ALMA 1OJAA 2YR5A 2MOIA 1N4UA 1PJ5A 5LAOA 1MOKA 3AE7A 1GETA 4Z2UA 3AAXA 4U8NA 4BK2A 4EIQA 1GRHA 1Y56A 4OPGA 1CJ4A 1GMXA 3CNTA 2GR2A 5BVAA 1GTEA 4CY6A 3AE2A 3SM8A 1TYPA 2A8XA 1YMDA 4TM1A 3CGCA 4DGKA 1H4MX 2GEWA 5EB4A 2VZ2A 3AEGA 3DK9A 4NTEA 1OKGA 3UOYA 1XHCA 3FNJA 3ALLA 2C75A 3OP3A 1P2EA 2BXRA 2MRMA 2DKHA 1CHUA 3CTYA 1CC4A 1BOHA 1BZLA 2ZZ0A 3ZYXA 1CJ2A 1S2QA 4U2TA 1EL5A 1GREA 4YSZA 3VR9A 1FEAA 3DMEA 3NYFA 4IVMB 2UZQA 4IV9A 2UZZA 1Y56B 1B37A 3NTAA 2XVHA 1XANA 2EG3A 5IQ4A 3D1CA 2WPEA 2WHDA 1YM9A 1JRYA 1F8RA 4USQA 4Y4NA 3IWAA 1VG0A 1ZY8A 4N9XA 4GUVA 3NGCX 4A6NA 1Y0PA 3UOZA 3QSEA 4DNAA 4NEWA 4JY2A 2WEUA 1H81A 1L9CA 2GB0A 2XCGA 2YG3A 2Z5XA 4YKFA 4Z24A 2VQ7A 4RG4A 1ZK7A 2TPRA 1P2HA 3I6DA 1EL8A 4M52A 3M12A 4EMJA 1L0VA 1DODA 4OVIA 4D03A 2R0GA 1PS9A 1E1MA 2OLOA 4WCTA 3VRDB 2XYOA 4LA1A 1O94A 5U1OA 2C66A 1CL0A 3IPOA 1ZOYA 4I59A 4A6NB 4CCRA 1EL7A 3AEFA 1D4EA 3QVPA 4B63A 3BHFA 2ARDA 1M64A 3G5JA 1ONFA 3GYJA 3G5RA 4I58A 2WLXA 1E1LA 1TDOA 3G5QA 3H4KA 4FK1A 4JNAA 1M6IA 3NT6A 3AXBA 3NK1X 4H4VA 4BK1A 3UKAA 2BA9A 1DOCA 3AE3A 4B68A 5LV9A 3K9RA 4F67A 2IIDA 3QFBA 2OUCA 4A79A 2GMHA 2BCGG 2C65A 2OA1A 3NYCA 2C76A 4LIIA 4CCQA 1PBDA 4BV6A 5M10A 2YG4A 3C4NA 5EBKA 4FX9A 2XFPA 1PXBA 1PXCA 3UTEA 3LXDA 2K0ZA 2YR6A 1S2YA 4Y4LA 3HZUA 2GAHB 2X8HA 1E6EA 3CNDA 3OZ2A 5JCKA 1HZMA 2X99A 2FSXA 2IFVA 3AE8A 4YTNA 1KSUA 2BS2A 3AEDA 1H82A 3NKSA 5KVIA 2XFNA 5ER0A 1KNPA 3B6DA 4U8JA 4A7AA 2RABA 3LADA 3O3WA 1B8SA 2QCUA 5EOWA 1TDNA 1IUVA 1GPEA 2R45A 1GT8A 2XLRA 1GNDA 3ABVA 3GD3A 4LU6A 1TYTA 3DJDA 2I0ZA 4Z25A 4A5LA 4H4ZA 1NPXA 4UDQA 3LZXA 3PS9A 2QA1A 4GDPA 3KD9A 1WV9A 2RGJA 4J34A 3VR8A 1NHQA 5IQ1A 2B9YA 2JB1A 2VQBA 1RYIA 5HHFA 2E1MA 3FPZA 5KXJA 3QSMA 3NYEA 4TLZA 1OJ9A 1O95A 4AP3A 4X4JA 4GR1A 4YSXA 3DGZA 2X8GA 1LPFA 4UP3A 4EM4A 4ECHA 5KVHA 4K8DA 4K5RA 4C74A 3F8PA 2WPCA 3KA7A 1N4VA 2DKIA 2C7GA 4WH9A 4XXGA 4E0VA 2XDOA 1GRFA 4H7UA 4BJZA 1OJDA 5BRTA 2YLRA 4J31A 4FK1C 2FJBA 2R46A 3AE5A 3ICTA 1VEEA 3RHAA 3OC4A 3SGLA 2B76A 4FDCB 3P4SA 1PDHA 3AD9B 2JTSA 4BURA 4ZN0A 1N4WA 4DSGA 3D1PA 1T3KA 2WS3A 3LZWA 3L8KA 3AB1A 3UCLA 4H4TA 4AT0A 1CF3A 1TDEA 2H88A 1H6VA 4CNJA 4CBQA 4B67A 2C3DA 2V3BA 4H2PA 5HXIA 1D4CA 2OLNA 2JB2A 4P9SA 1NG4A 2AAQA 1H7WA 2WOWA 3QVRA 3P9UA 3NTDA 1PJ7A 2XFOA 1QLBA 2YVFA 4H4PA 3BI4A 2GVCA 2GRTA 1H86A 2BS3A 1B5QA 2KL3A 1E7PA 4NTCA 3COXA 3FIMB 5KWFA 1D7YA 3CIRA 1GXFA 1LVLA 4RSLA 1JEHA 3IHMA 3GWDA 1GRAA 3CPHG 4X9NA 2GR1A 3VRBA 1E0CA 4UDPA 1FOHA 3CGEA 4AP1A 3P4RA 4MJWA 2A89A 2WDRA 2ORAA 1PJ6A 1HYUA 3NIXA 4GF7A 4JQ9A 3M13A 4JDRA 2GF3A 1GN0A 4XWZA 4B1BA 2XVIA 5BULA 2R0PA 2EQ9A 1OJCA 3TP9A 2BK5A 3ATRA 3ALJA 3GRSA 3UKPA 4EQWA 2VVMA 4K2XA 2APGA 4O5QA 5L46A 4K22A 2V60A 2VVLG 4H50A 5CKUA 2DCQA 2VRLA 5FS9A 4C3YA 4EQSA 2BK3A 3G5SA 3CGBA 3PO7A 2Y6QA 3V3NA 3CPJG 1MXTA 5U63A 2XFUA 3RP6A 3RP8A 2X50A 1RSGA 1VQWA 4A9WA 4AOSA 3O0HA 1AOGA 3SQPA 1Q9IA 1DXLA 3GMCA 5HBLA 3UTNX 1CC2A 3NK0X 3AEAA 1IUXA 3BNMA 1GRTA 4K5SA 1DNCA 3DH9A 2YAUA 3FG2P 2XLTA 3UTGA 1IJHA 4J36A 2YLXA 2GR0A 1O5WA 1DOBA 1H83A 2FJEA 2GH5A 4A65A 3UP5A 1TQ1A 1H84A 2BABA 2XFQA 4U8MA 2F5ZA 4HA6A 3D8XA 3UKQA 4YTPA 1EBDA 1XPQA 1NEKA 1X31B 1ZX9A 2NPXA 4JY3A 2GV8A 4XWRA 4OPTA 2BCPA 1YKJA 3BHKA 4JNQA 3DJEA 3VQRA 1YMLA 4NEVA 3SFEA 1DJQA 2BS4A 1NHSA 4O5UA 2J6PA 4U8LA 2WESA 2EG4B 1K4QA 1L9EA 3NH3X 3T37A 3ICSA 2YR4A 1PBFA 2ACZA 3AYIA 2JK6A 4Z43A 1CC6A 1DJNA 1ORBA 1CWTA 4ICYA 1PXAA 3VRAA 2Q7VA 1Q1RA 2BYBA 1PN0A 2BXSA 2C67A 2XLPA 3S5WA 5HYMA 3NN0X 3P4QA 2V5ZA 2ZZBA 2A2KA 2PHHA 3ATQA 2EQ8A 4U8KA 2CDUA 2O9ZA 3OLHA 3HZLA 4C77A 2FBWA 3ADAB 4B66A 1REOA 3RNMA 2CVJA 1KFYA 4C3XA 1URHA 2FJAA 2WLRA 2QAEA 3I3UA 1BWCA 1B4VA 4UDRA 2Q6UA 2WU5A 4OPIA 2XVEA 1GTHA 3FMWA 4JN9A 4J2WA 3REDA 3LOVA 4OPDA 3GSIA 4AOXA 4GDEA 1IUWA 3P1WA 3FOJA 4PAAA 5HBPA 2CULA 2R0CA 5JCLA 2OALA 4KX6A 4Z44A 3HIXA 3P3AA 1PHHA 3K7MX 1QO8A 4U2SA 3LJPA 3JSKA 1D5TA 2WP5A 5C2TA 3GMBA 1K0LA 1S3BA 3DGHA 3DJGX 1LQUA 3AE9A 2WPFA 3P4PA 4H2QA 3IF9A 2BC0A 5KOXA 2JTRA 1QJDA 2Q0KA 3H8IA 4TM4A 3AEBA 4Z2TA 2WOIA 3HWIA 1N1PA 1C25A 4CY8A 1IUSA 3AE6A 1NAAA 3FS5A 1F8SA 4PABA 4ZCDA 1NHRA 3KVEA 3EAOA 2TMDA 5FS8A 3ILMA 3GDPA 1TRBA 1YQ4A 2WU2A 3GDNA 1RP0A 2J3NA 3KPFA 3AD7B 4Y4MA 3AECA 3CGDA 4U8OA 4B65A 4H4QA 2E5VA 5HPAA 5C3JA 1FCDA 1YY5A 1CBOA 1E1NA 4BK3A 1NDAA 1K0JA 1BGNA 3GD4A 1D7LA 4C5OA 1DOEA 1TDKA 3CPIG 2BACA 5HBQA 5HBOA 1JU2A 2NVKX 2VSWA 2YM2A 3EANA 2YLSA 2ZZCA 2WDQA 1F3PA 1QB0A 3ITJA 3K7QX 2WP9A 3L1RA 4H4XA 4TM0A 4EIPA 3UOVA 3EPTA 4EM3A 3K7TA 1ELIA 1LQTA 2R4EA 4J57A 2GWFA 2VRMA 4EQXA 4REKA 3UTFA 1JNRA 3F8RA 2WQYA 1TDFA 3PVCA 1YMKA 4IA5A 4U2LA 5GSNA 4H4WA 1MO9A 4WX1A 3WE0A 2HHGA 2W0HA 2YLTA 4CRTA 2XVJA 5JCNA 2B9XA 2XVFA 1GESA 2IFDA 5FS7A 3TG1B 1BF3A 3ZDNA 2WBAA 5KOWA 2GQFA 2X8CA 1IUTA 5FMHA 4Z2RA 3CNSA 1PBEA 4WH7A 2H89A 2X3NA 3BNUA 1L9DA 3NLCA 3F8DA 5TR3A 4K7ZA 5BUKA 2MOLA 1W4XA 2E4GA 2EQ7A 3IC9A 4H4RA 3ISHA 1F8WA 1LJ1A 1Z6LA 3KKJA 2EG4A 5FS6A 4IA6A 3RP7A 2YVGA 4OPLA 4J33A 2B9WA 4EQRA 4Z26A 1IUUA 4YTMA 2CFYA 5JCMA 2JB3A 2V6OA 3M0OA 4JGTA 3FBSA 1EL9A 3NG7X 3NHOX 3QJ4A 4ZCCA 5GRTA 2AR8A 3LB8A 1XDIA 3UKLA 3GWFA 1COYA 2C64A 2QA2A 3V3OA 2AQJA 1FECA 3CN8A 3CNPA 1UKVG 3V76A 2V3AA 4DSHA 4OPCA 1D4DA 1ZMDA 2C72A 2YLZA 4EMIA 1NG3A 4B64A 5JCIA 5M0ZA 3UKKA 4YSHA 1H4KX 1V59A 4ADWA 2WETA 3DA1A 5EB5A 4AT2A 2B7RA 3C96A 1CJCA 1JNZA 1CJ3A 3AE1A 2IVEA 3QFAA 4H4UA 5KRQA 1KNRA 3AAYA 1LV0A 2GR3A 4OPUA 2A87A 4X9MA 5IPYA 3AD8B 3F4AA 5LAMA 2RGHA 1OJTA 1Q1WA 2WP6A 1VDCA 4H4SA 1JOAA 1GALA 2C73A 2R4JA 2YG7A 3K30A 3IPPA 2C70A 3R9UA 2XLSA 4NTDA 3GK5A 1KF6A 2YQUA 1WHBA 3H8LA 3Q9TA 4CNKA 2GAGB 3B3RA 3KLJA 3AEEA 2XLUA 2Z5YA 3BI2A 1GEUA 5CQFA 2HQMA 2BK4A 3NK2X 1K0IA 3AE4A 3UOXA 2PYXA 1BOIA 3IWHA 1F6MA 2R9ZA 3GRTA 3I3LA 1VG9A 3E1TA 3NN6X 1NHPA 4H2NA 1FEBA 3EF6A 1E1KA 3URHA 1E39A 1H7XA 2B7SA 2JAEA 4H2RA 3IHGA 1JRZA 2YLWA 3Q6JA 4HB9A 2RGOA 1CWSA 3KU9A 4J56A 4BJYA 4USRA 4KPRA 3II4A 1PBCA 1CWRA 2IVDA 1LTXR 3CNJA
chains in the Genus database with same CATH superfamily
5DBJA 3GYIA 3AYLA 4YKGA 1DP2A 1ZKQA 1NENA 1PBBA 4EMWA 2C3CA 2V61A 3NHVA 3FLHA 1GRBA 2VVLA 4B69A 4GRTA 4YWOA 2FJDA 4U8PA 3I2VA 1RHDA 4NZHA 1YS0A 4YXDA 2EQ6A 1JRXA 3R2UA 3UP4A 4YT0A 5HY5A 3MZZA 2WOVA 1GSNA 1GV4A 3DK8A 3DJJA 4RG3A 2Y6RA 3UTHA 2JKCA 3TG3A 2YM1A 2YVJA 4APNA 1ZP0A 2ZBWA 1GOSA 1VRQB 3BI5A 3NRNA 3UKHA 4A99A 2OAMA 2GQWA 1ZOVA 1FL2A 5J7XA 1KSSA 4OCGA 3S61A 4TLXA 2YG5A 3NNEA 1YT8A 1BKWA 1SEZA 4H4YA 3UKFA 1ZDLA 3DK4A 2VOUA 3AWIA 1QXNA 2YWLA 3QSSA 2JTQA 5U25A 4D04A 3SFDA 1GRGA 2Q0LA 2WDVA 1GERA 1KDGA 1YQZA 3AYJA 4YSYA 4TM3A 1UARA 4IVOB 1ZMCA 1RHSA 1S3EA 3C4AA 2BC1A 2JBVA 5J60A 1BGJA 4GCMA 4U8IA 2YG6A 3ICRA 2GMJA 1YQ3A 3ALMA 1OJAA 2YR5A 2MOIA 1N4UA 1PJ5A 5LAOA 1MOKA 3AE7A 1GETA 4Z2UA 3AAXA 4U8NA 4BK2A 4EIQA 1GRHA 1Y56A 4OPGA 1CJ4A 3SZCA 1GMXA 3CNTA 2GR2A 5BVAA 1GTEA 4CY6A 3AE2A 3SM8A 1TYPA 2A8XA 1YMDA 4TM1A 3CGCA 4DGKA 1H4MX 2GEWA 5EB4A 2VZ2A 3AEGA 3DK9A 4NTEA 1OKGA 3UOYA 1XHCA 3FNJA 3ALLA 2C75A 3OP3A 1P2EA 2BXRA 2MRMA 2DKHA 1CHUA 3CTYA 1CC4A 1BOHA 1BZLA 2ZZ0A 3ZYXA 1CJ2A 1S2QA 4U2TA 1EL5A 1GREA 4YSZA 3SY4A 3VR9A 1FEAA 3DMEA 3NYFA 4IVMB 2UZQA 4IV9A 2UZZA 1Y56B 1B37A 3NTAA 2XVHA 1XANA 2EG3A 5IQ4A 3D1CA 4NWZA 2WPEA 2WHDA 1YM9A 1JRYA 1F8RA 3SXIA 4USQA 4Y4NA 3IWAA 1VG0A 1ZY8A 4N9XA 4GUVA 3NGCX 4A6NA 1Y0PA 3UOZA 3QSEA 4DNAA 4NEWA 4JY2A 2WEUA 1H81A 1L9CA 2GB0A 2XCGA 2YG3A 2Z5XA 4YKFA 4Z24A 2VQ7A 4RG4A 1ZK7A 2TPRA 1P2HA 3I6DA 2C4CA 1EL8A 4M52A 3M12A 4EMJA 1L0VA 1DODA 4OVIA 4D03A 2R0GA 1PS9A 1E1MA 2OLOA 4WCTA 3VRDB 2XYOA 4LA1A 1O94A 5U1OA 2C66A 1CL0A 3IPOA 1ZOYA 4I59A 4A6NB 4CCRA 1EL7A 3AEFA 1D4EA 3QVPA 4B63A 3BHFA 2ARDA 1M64A 3G5JA 1ONFA 3GYJA 3G5RA 4I58A 2WLXA 1E1LA 1TDOA 3G5QA 3H4KA 4FK1A 4JNAA 1M6IA 3NT6A 3AXBA 3NK1X 4H4VA 4BK1A 3UKAA 2BA9A 1DOCA 3AE3A 4B68A 3T2YA 3K9RA 4F67A 2IIDA 5LV9A 3QFBA 2OUCA 4A79A 2GMHA 2BCGG 2C65A 2OA1A 3NYCA 2C76A 4G6HA 4LIIA 1PBDA 4CCQA 4BV6A 5M10A 2YG4A 3C4NA 5EBKA 4FX9A 2XFPA 1PXBA 1PXCA 3UTEA 3LXDA 2K0ZA 3T0KA 2YR6A 1S2YA 4Y4LA 3HZUA 2GAHB 2X8HA 1E6EA 3CNDA 3OZ2A 5JCKA 1HZMA 2X99A 2FSXA 2IFVA 3AE8A 4YTNA 1KSUA 2BS2A 3VR8A 3AEDA 1H82A 3NKSA 5KVIA 2XFNA 5ER0A 1KNPA 3B6DA 4U8JA 4A7AA 2Q82A 2RABA 3LADA 3O3WA 1B8SA 2QCUA 5EOWA 5KMRA 1TDNA 1IUVA 1GPEA 2R45A 1GT8A 2XLRA 1GNDA 3ABVA 3GD3A 4LU6A 1TYTA 3DJDA 2I0ZA 4Z25A 4A5LA 4H4ZA 1NPXA 4UDQA 3LZXA 3PS9A 2QA1A 4GAPA 3KD9A 1WV9A 2RGJA 4GDPA 4J34A 1NHQA 5IQ1A 2B9YA 2JB1A 2VQBA 1RYIA 5HHFA 2E1MA 3FPZA 5KXJA 3QSMA 4G73A 3NYEA 4TLZA 1OJ9A 1O95A 4AP3A 4X4JA 4GR1A 4YSXA 3DGZA 2X8GA 1LPFA 4UP3A 4EM4A 4ECHA 5KVHA 4K8DA 4K5RA 3SYIA 4C74A 3F8PA 2WPCA 3KA7A 1N4VA 2DKIA 2C7GA 4WH9A 5KMSA 4XXGA 4GAVA 4E0VA 2XDOA 1GRFA 4H7UA 4BJZA 1OJDA 5BRTA 2YLRA 4J31A 4FK1C 2FJBA 2R46A 3AE5A 3ICTA 1VEEA 3RHAA 3OC4A 3SGLA 2B76A 4FDCB 3P4SA 1PDHA 3AD9B 2JTSA 4BURA 4ZN0A 1N4WA 4DSGA 3D1PA 1T3KA 2WS3A 3LZWA 3L8KA 3AB1A 3SX6A 3UCLA 4H4TA 4AT0A 1CF3A 1TDEA 2H88A 1H6VA 4CNJA 4G74A 4CBQA 4B67A 2C3DA 2V3BA 4H2PA 5HXIA 1D4CA 2OLNA 2JB2A 4P9SA 1NG4A 2AAQA 1H7WA 2WOWA 3QVRA 3P9UA 3NTDA 1PJ7A 2XFOA 1QLBA 2YVFA 4H4PA 3BI4A 2GVCA 2GRTA 1H86A 2BS3A 1B5QA 2KL3A 1E7PA 4NTCA 3HYWA 3COXA 3FIMB 5KWFA 1D7YA 3CIRA 1GXFA 1LVLA 4RSLA 1JEHA 3IHMA 3GWDA 1GRAA 3CPHG 4X9NA 2GR1A 3VRBA 1E0CA 4UDPA 1FOHA 3CGEA 4AP1A 3P4RA 4MJWA 2A89A 4II3A 2WDRA 2ORAA 1PJ6A 1HYUA 3NIXA 4GF7A 4JQ9A 3M13A 4JDRA 2GF3A 1GN0A 4XWZA 4B1BA 2XVIA 5BULA 2R0PA 2EQ9A 1OJCA 3TP9A 2BK5A 3ATRA 3ALJA 3GRSA 3UKPA 4EQWA 2VVMA 4K2XA 2APGA 4O5QA 5L46A 3HYXA 4K22A 2V60A 2VVLG 4H50A 5CKUA 2DCQA 2VRLA 5FS9A 4C3YA 4EQSA 2BK3A 3G5SA 3CGBA 3PO7A 2Y6QA 3V3NA 3CPJG 1MXTA 5U63A 2XFUA 3RP6A 3RP8A 2X50A 1RSGA 1VQWA 4A9WA 4AOSA 3O0HA 1AOGA 3SQPA 1Q9IA 1DXLA 3GMCA 5HBLA 3UTNX 1CC2A 3NK0X 3AEAA 1IUXA 2BRAA 3BNMA 1GRTA 4K5SA 1DNCA 3DH9A 2YAUA 3FG2P 2XLTA 3T2KA 3UTGA 1IJHA 4J36A 2YLXA 2GR0A 1O5WA 1DOBA 1H83A 2FJEA 2GH5A 4G9KA 4A65A 3UP5A 1TQ1A 1H84A 2BABA 2XFQA 4U8MA 2F5ZA 4HA6A 3D8XA 3UKQA 4YTPA 1EBDA 1XPQA 1NEKA 1X31B 1ZX9A 2NPXA 4JY3A 3KPKA 2GV8A 4XWRA 4OPTA 2BCPA 1YKJA 3BHKA 4JNQA 3DJEA 3VQRA 1YMLA 4NEVA 3SFEA 1DJQA 2BS4A 1NHSA 3T2ZA 4O5UA 2J6PA 4U8LA 2WESA 2EG4B 1K4QA 1L9EA 3NH3X 3T37A 3ICSA 2YR4A 1PBFA 2ACZA 3AYIA 2JK6A 4Z43A 1CC6A 1DJNA 1ORBA 1CWTA 4ICYA 3SZWA 1PXAA 3VRAA 2Q7VA 1Q1RA 2BYBA 1PN0A 2BXSA 2C67A 2XLPA 3S5WA 5HYMA 3NN0X 3P4QA 2V5ZA 2ZZBA 2A2KA 2PHHA 3ATQA 2EQ8A 4U8KA 2CDUA 2O9ZA 3OLHA 3HZLA 4C77A 2FBWA 3ADAB 4B66A 1REOA 3RNMA 2CVJA 1KFYA 4C3XA 1URHA 2FJAA 2WLRA 2QAEA 3I3UA 1BWCA 1B4VA 4UDRA 2Q6UA 2WU5A 4OPIA 2XVEA 1GTHA 3FMWA 4JN9A 4NNJA 4J2WA 3REDA 3LOVA 4OPDA 3GSIA 4AOXA 4GDEA 1IUWA 3P1WA 3FOJA 4PAAA 5HBPA 2CULA 2R0CA 5JCLA 2OALA 4KX6A 4Z44A 3HIXA 3P3AA 1PHHA 3K7MX 1QO8A 4U2SA 3LJPA 3JSKA 1D5TA 2WP5A 5C2TA 3GMBA 1K0LA 1S3BA 3GYXA 3DGHA 3DJGX 1LQUA 3AE9A 2WPFA 3P4PA 4H2QA 5KMQA 3IF9A 2BC0A 5KOXA 2JTRA 1QJDA 2Q0KA 3H8IA 4TM4A 3AEBA 4Z2TA 2WOIA 3HWIA 1N1PA 1C25A 4CY8A 1IUSA 3AE6A 1NAAA 3FS5A 1F8SA 4PABA 4ZCDA 1NHRA 3KVEA 3EAOA 2TMDA 5FS8A 3ILMA 3GDPA 1TRBA 1YQ4A 2WU2A 3GDNA 1RP0A 2J3NA 3KPFA 3AD7B 4Y4MA 3AECA 3CGDA 4U8OA 4B65A 4H4QA 2E5VA 5HPAA 5C3JA 1FCDA 1YY5A 1CBOA 1E1NA 4BK3A 1NDAA 1K0JA 1BGNA 3GD4A 1D7LA 4C5OA 1DOEA 1TDKA 3CPIG 2BACA 5HBQA 5HBOA 1JU2A 2NVKX 2VSWA 2YM2A 3EANA 2YLSA 2ZZCA 2WDQA 1F3PA 1QB0A 3ITJA 3K7QX 2WP9A 3L1RA 4H4XA 4TM0A 3T31A 4EIPA 3UOVA 3EPTA 4EM3A 3K7TA 1ELIA 1LQTA 2R4EA 4J57A 2GWFA 2VRMA 4EQXA 4REKA 3UTFA 1JNRA 3F8RA 2WQYA 1TDFA 3PVCA 1YMKA 4IA5A 4U2LA 5GSNA 4H4WA 1MO9A 4WX1A 3WE0A 2HHGA 2W0HA 5KMPA 2YLTA 4CRTA 2XVJA 5JCNA 2B9XA 2XVFA 1GESA 2IFDA 5FS7A 3TG1B 1BF3A 3ZDNA 2WBAA 5KOWA 2GQFA 2X8CA 1IUTA 5FMHA 4Z2RA 3CNSA 1PBEA 4WH7A 2H89A 2X3NA 3BNUA 1L9DA 3NLCA 3F8DA 5TR3A 4K7ZA 5BUKA 2MOLA 1W4XA 2E4GA 2EQ7A 3IC9A 4H4RA 4G6GA 3ISHA 1F8WA 1LJ1A 1Z6LA 3KKJA 2EG4A 5FS6A 4IA6A 3RP7A 2YVGA 4OPLA 4J33A 2B9WA 4EQRA 4Z26A 4II2A 1IUUA 4YTMA 2CFYA 5JCMA 2JB3A 2V6OA 3M0OA 4JGTA 3FBSA 1EL9A 3NG7X 3NHOX 3QJ4A 4ZCCA 5GRTA 2AR8A 3LB8A 1XDIA 3UKLA 3GWFA 1COYA 2C64A 2QA2A 3V3OA 2AQJA 1FECA 3CN8A 3CNPA 1UKVG 3SZFA 2V3AA 3V76A 4OPCA 4DSHA 1D4DA 1ZMDA 2C72A 2YLZA 4EMIA 1NG3A 4B64A 5JCIA 5M0ZA 3UKKA 4YSHA 1H4KX 1V59A 4ADWA 2WETA 3DA1A 5EB5A 4AT2A 2B7RA 2BRYA 3C96A 3T14A 1CJCA 1JNZA 1CJ3A 3AE1A 2IVEA 3QFAA 4H4UA 5KRQA 1KNRA 3AAYA 1LV0A 2GR3A 3HYVA 4OPUA 2A87A 4X9MA 5IPYA 3AD8B 3F4AA 5LAMA 2RGHA 1OJTA 1Q1WA 2WP6A 1VDCA 4H4SA 1JOAA 1GALA 2C73A 3SZ0A 2R4JA 2YG7A 3K30A 3IPPA 2C70A 3R9UA 2XLSA 4NTDA 3GK5A 1KF6A 2YQUA 1WHBA 3H8LA 3Q9TA 4CNKA 2GAGB 3B3RA 3KLJA 3AEEA 2XLUA 2Z5YA 3BI2A 1GEUA 5CQFA 2HQMA 2BK4A 3NK2X 1K0IA 3AE4A 3UOXA 2PYXA 3CMMA 1BOIA 3IWHA 1F6MA 2R9ZA 5KNLA 3GRTA 3I3LA 1VG9A 3E1TA 3NN6X 1NHPA 4H2NA 1FEBA 3EF6A 1E1KA 3URHA 1E39A 1H7XA 2B7SA 2JAEA 4H2RA 3IHGA 1JRZA 2YLWA 3Q6JA 4HB9A 2RGOA 1CWSA 3KU9A 4J56A 4BJYA 4USRA 4KPRA 3II4A 1PBCA 1CWRA 2IVDA 1LTXR 3CNJA
chains in the Genus database with same CATH topology
5DBJA 3GYIA 3AYLA 4YKGA 1DP2A 1ZKQA 1NENA 1PBBA 4EMWA 2C3CA 2V61A 3NHVA 3FLHA 1GRBA 2VVLA 4B69A 4GRTA 4YWOA 2FJDA 4U8PA 3I2VA 1RHDA 4NZHA 1YS0A 4YXDA 2EQ6A 1JRXA 3R2UA 3UP4A 4YT0A 5HY5A 3MZZA 2WOVA 1GSNA 1GV4A 3DK8A 3DJJA 4RG3A 2Y6RA 3UTHA 2JKCA 3TG3A 2YM1A 2YVJA 4APNA 1ZP0A 2ZBWA 1GOSA 1VRQB 3BI5A 3NRNA 3UKHA 4A99A 2OAMA 2GQWA 1ZOVA 1FL2A 5J7XA 1KSSA 4OCGA 3S61A 4TLXA 2YG5A 3NNEA 1YT8A 1BKWA 1SEZA 4H4YA 3UKFA 1ZDLA 3DK4A 2VOUA 3AWIA 1QXNA 2YWLA 3QSSA 2JTQA 5U25A 4D04A 3SFDA 1GRGA 2Q0LA 2WDVA 1GERA 1KDGA 1YQZA 3AYJA 4YSYA 4TM3A 1UARA 4IVOB 1ZMCA 1RHSA 1S3EA 3C4AA 2BC1A 2JBVA 5J60A 1BGJA 4GCMA 4U8IA 2YG6A 3ICRA 2GMJA 1YQ3A 3ALMA 1OJAA 2YR5A 2MOIA 1N4UA 1PJ5A 5LAOA 1MOKA 3AE7A 1GETA 4Z2UA 3AAXA 4U8NA 4BK2A 4EIQA 1GRHA 1Y56A 4OPGA 1CJ4A 3SZCA 1GMXA 3CNTA 2GR2A 5BVAA 1GTEA 4CY6A 3AE2A 3SM8A 1TYPA 2A8XA 1YMDA 4TM1A 3CGCA 4DGKA 1H4MX 2GEWA 5EB4A 2VZ2A 3AEGA 3DK9A 4NTEA 1OKGA 3UOYA 1XHCA 3FNJA 3ALLA 2C75A 3OP3A 1P2EA 2BXRA 2MRMA 2DKHA 1CHUA 3CTYA 1CC4A 1BOHA 1BZLA 2ZZ0A 3ZYXA 1CJ2A 1S2QA 4U2TA 1EL5A 1GREA 4YSZA 3SY4A 3VR9A 1FEAA 3DMEA 3NYFA 4IVMB 2UZQA 4IV9A 2UZZA 1Y56B 1B37A 3NTAA 2XVHA 1XANA 2EG3A 5IQ4A 3D1CA 4NWZA 2WPEA 2WHDA 1YM9A 1JRYA 1F8RA 3SXIA 4USQA 4Y4NA 3IWAA 1VG0A 1ZY8A 4N9XA 4GUVA 3NGCX 4A6NA 1Y0PA 3UOZA 3QSEA 4DNAA 4NEWA 4JY2A 2WEUA 1H81A 1L9CA 2GB0A 2XCGA 2YG3A 2Z5XA 4YKFA 4Z24A 2VQ7A 4RG4A 1ZK7A 2TPRA 1P2HA 3I6DA 2C4CA 1EL8A 4M52A 3M12A 4EMJA 1L0VA 1DODA 4OVIA 4D03A 2R0GA 1PS9A 1E1MA 2OLOA 4WCTA 3VRDB 2XYOA 4LA1A 1O94A 5U1OA 2C66A 1CL0A 3IPOA 1ZOYA 4I59A 4A6NB 4CCRA 1EL7A 3AEFA 1D4EA 3QVPA 4B63A 3BHFA 2ARDA 1M64A 3G5JA 1ONFA 3GYJA 3G5RA 4I58A 2WLXA 1E1LA 1TDOA 3G5QA 3H4KA 4FK1A 4JNAA 1M6IA 3NT6A 3AXBA 3NK1X 4H4VA 4BK1A 3UKAA 2BA9A 1DOCA 3AE3A 4B68A 3T2YA 3K9RA 4F67A 2IIDA 5LV9A 3QFBA 2OUCA 4A79A 2GMHA 2BCGG 2C65A 2OA1A 3NYCA 2C76A 4G6HA 4LIIA 1PBDA 4CCQA 4BV6A 5M10A 2YG4A 3C4NA 5EBKA 4FX9A 2XFPA 1PXBA 1PXCA 3UTEA 3LXDA 2K0ZA 3T0KA 2YR6A 1S2YA 4Y4LA 3HZUA 2GAHB 2X8HA 1E6EA 3CNDA 3OZ2A 5JCKA 1HZMA 2X99A 2FSXA 2IFVA 3AE8A 4YTNA 1KSUA 2BS2A 3VR8A 3AEDA 1H82A 3NKSA 5KVIA 2XFNA 5ER0A 1KNPA 3B6DA 4U8JA 4A7AA 2RABA 3LADA 3O3WA 1B8SA 2QCUA 5EOWA 5KMRA 1TDNA 1IUVA 1GPEA 2R45A 1GT8A 2XLRA 1GNDA 3ABVA 3GD3A 4LU6A 1TYTA 3DJDA 2I0ZA 4Z25A 4A5LA 4H4ZA 1NPXA 4UDQA 3LZXA 3PS9A 2QA1A 4GAPA 3KD9A 1WV9A 2RGJA 4GDPA 4J34A 1NHQA 5IQ1A 2B9YA 2JB1A 2VQBA 1RYIA 5HHFA 2E1MA 3FPZA 5KXJA 3QSMA 4G73A 3NYEA 4TLZA 1OJ9A 1O95A 4AP3A 4X4JA 4GR1A 4YSXA 3DGZA 2X8GA 1LPFA 4UP3A 4EM4A 4ECHA 5KVHA 4K8DA 4K5RA 3SYIA 4C74A 3F8PA 2WPCA 3KA7A 1N4VA 2DKIA 2C7GA 4WH9A 5KMSA 4XXGA 4GAVA 4E0VA 2XDOA 1GRFA 4H7UA 4BJZA 1OJDA 5BRTA 2YLRA 4J31A 4FK1C 2FJBA 2R46A 3AE5A 3ICTA 1VEEA 3RHAA 3OC4A 3SGLA 2B76A 4FDCB 3P4SA 1PDHA 3AD9B 2JTSA 4BURA 4ZN0A 1N4WA 4DSGA 3D1PA 1T3KA 2WS3A 3LZWA 3L8KA 3AB1A 3SX6A 3UCLA 4H4TA 4AT0A 1CF3A 1TDEA 2H88A 1H6VA 4CNJA 4G74A 4CBQA 4B67A 2C3DA 2V3BA 4H2PA 5HXIA 1D4CA 2OLNA 2JB2A 4P9SA 1NG4A 2AAQA 1H7WA 2WOWA 3QVRA 3P9UA 3NTDA 1PJ7A 2XFOA 1QLBA 2YVFA 4H4PA 3BI4A 2GVCA 2GRTA 1H86A 2BS3A 1B5QA 2KL3A 1E7PA 4NTCA 3HYWA 3COXA 3FIMB 5KWFA 1D7YA 3CIRA 1GXFA 1LVLA 4RSLA 1JEHA 3IHMA 3GWDA 1GRAA 3CPHG 4X9NA 2GR1A 3VRBA 1E0CA 4UDPA 1FOHA 3CGEA 4AP1A 3P4RA 4MJWA 2A89A 4II3A 2WDRA 2ORAA 1PJ6A 1HYUA 3NIXA 4GF7A 4JQ9A 3M13A 4JDRA 2GF3A 1GN0A 4XWZA 4B1BA 2XVIA 5BULA 2R0PA 2EQ9A 1OJCA 3TP9A 2BK5A 3ATRA 3ALJA 3GRSA 3UKPA 4EQWA 2VVMA 4K2XA 2APGA 4O5QA 5L46A 3HYXA 4K22A 2V60A 2VVLG 4H50A 5CKUA 2DCQA 2VRLA 5FS9A 4C3YA 4EQSA 2BK3A 3G5SA 3CGBA 3PO7A 2Y6QA 3V3NA 3CPJG 1MXTA 5U63A 2XFUA 3RP6A 3RP8A 2X50A 1RSGA 1VQWA 4A9WA 4AOSA 3O0HA 1AOGA 3SQPA 1Q9IA 1DXLA 3GMCA 5HBLA 3UTNX 1CC2A 3NK0X 3AEAA 1IUXA 2BRAA 3BNMA 1GRTA 4K5SA 1DNCA 3DH9A 2YAUA 3FG2P 2XLTA 3T2KA 3UTGA 1IJHA 4J36A 2YLXA 2GR0A 1O5WA 1DOBA 1H83A 2FJEA 2GH5A 4G9KA 4A65A 3UP5A 1TQ1A 1H84A 2BABA 2XFQA 4U8MA 2F5ZA 4HA6A 3D8XA 3UKQA 4YTPA 1EBDA 1XPQA 1NEKA 1X31B 1ZX9A 2NPXA 4JY3A 3KPKA 2GV8A 4XWRA 4OPTA 2BCPA 1YKJA 3BHKA 4JNQA 3DJEA 3VQRA 1YMLA 4NEVA 3SFEA 1DJQA 2BS4A 1NHSA 3T2ZA 4O5UA 2J6PA 4U8LA 2WESA 2EG4B 1K4QA 1L9EA 3NH3X 3T37A 3ICSA 2YR4A 1PBFA 2ACZA 3AYIA 2JK6A 4Z43A 1CC6A 1DJNA 1ORBA 1CWTA 4ICYA 3SZWA 1PXAA 3VRAA 2Q7VA 1Q1RA 2BYBA 1PN0A 2BXSA 2C67A 2XLPA 3S5WA 5HYMA 3NN0X 3P4QA 2V5ZA 2ZZBA 2A2KA 2PHHA 3ATQA 2EQ8A 4U8KA 2CDUA 2O9ZA 3OLHA 3HZLA 4C77A 2FBWA 3ADAB 4B66A 1REOA 3RNMA 2CVJA 1KFYA 4C3XA 1URHA 2FJAA 2WLRA 2QAEA 3I3UA 1BWCA 1B4VA 4UDRA 2Q6UA 2WU5A 4OPIA 2XVEA 1GTHA 3FMWA 4JN9A 4NNJA 4J2WA 3REDA 3LOVA 4OPDA 3GSIA 4AOXA 4GDEA 1IUWA 3P1WA 3FOJA 4PAAA 5HBPA 2CULA 2R0CA 5JCLA 2OALA 4KX6A 4Z44A 3HIXA 3P3AA 1PHHA 3K7MX 1QO8A 4U2SA 3LJPA 3JSKA 1D5TA 2WP5A 5C2TA 3GMBA 1K0LA 1S3BA 3GYXA 3DGHA 3DJGX 1LQUA 3AE9A 2WPFA 3P4PA 4H2QA 5KMQA 3IF9A 2BC0A 5KOXA 2JTRA 1QJDA 2Q0KA 3H8IA 4TM4A 3AEBA 4Z2TA 2WOIA 3HWIA 1N1PA 1C25A 4CY8A 1IUSA 3AE6A 1NAAA 3FS5A 1F8SA 4PABA 4ZCDA 1NHRA 3KVEA 3EAOA 2TMDA 5FS8A 3ILMA 3GDPA 1TRBA 1YQ4A 2WU2A 3GDNA 1RP0A 2J3NA 3KPFA 3AD7B 4Y4MA 3AECA 3CGDA 4U8OA 4B65A 4H4QA 2E5VA 5HPAA 5C3JA 1FCDA 1YY5A 1CBOA 1E1NA 4BK3A 1NDAA 1K0JA 1BGNA 3GD4A 1D7LA 4C5OA 1DOEA 1TDKA 3CPIG 2BACA 5HBQA 5HBOA 1JU2A 2NVKX 2VSWA 2YM2A 3EANA 2YLSA 2ZZCA 2WDQA 1F3PA 1QB0A 3ITJA 3K7QX 2WP9A 3L1RA 4H4XA 4TM0A 3T31A 4EIPA 3UOVA 3EPTA 4EM3A 3K7TA 1ELIA 1LQTA 2R4EA 4J57A 2GWFA 2VRMA 4EQXA 4REKA 3UTFA 1JNRA 3F8RA 2WQYA 1TDFA 3PVCA 1YMKA 4IA5A 4U2LA 5GSNA 4H4WA 1MO9A 4WX1A 3WE0A 2HHGA 2W0HA 5KMPA 2YLTA 4CRTA 2XVJA 5JCNA 2B9XA 2XVFA 1GESA 2IFDA 5FS7A 3TG1B 1BF3A 3ZDNA 2WBAA 5KOWA 2GQFA 2X8CA 1IUTA 5FMHA 4Z2RA 3CNSA 1PBEA 4WH7A 2H89A 2X3NA 3BNUA 1L9DA 3NLCA 3F8DA 5TR3A 4K7ZA 5BUKA 2MOLA 1W4XA 2E4GA 2EQ7A 3IC9A 4H4RA 4G6GA 3ISHA 1F8WA 1LJ1A 1Z6LA 3KKJA 2EG4A 5FS6A 4IA6A 3RP7A 2YVGA 4OPLA 4J33A 2B9WA 4EQRA 4Z26A 4II2A 1IUUA 4YTMA 2CFYA 5JCMA 2JB3A 2V6OA 3M0OA 4JGTA 3FBSA 1EL9A 3NG7X 3NHOX 3QJ4A 4ZCCA 5GRTA 2AR8A 3LB8A 1XDIA 3UKLA 3GWFA 1COYA 2C64A 2QA2A 3V3OA 2AQJA 1FECA 3CN8A 3CNPA 1UKVG 3SZFA 2V3AA 3V76A 4OPCA 4DSHA 1D4DA 1ZMDA 2C72A 2YLZA 4EMIA 1NG3A 4B64A 5JCIA 5M0ZA 3UKKA 4YSHA 1H4KX 1V59A 4ADWA 2WETA 3DA1A 5EB5A 4AT2A 2B7RA 2BRYA 3C96A 3T14A 1CJCA 1JNZA 1CJ3A 3AE1A 2IVEA 3QFAA 4H4UA 5KRQA 1KNRA 3AAYA 1LV0A 2GR3A 3HYVA 4OPUA 2A87A 4X9MA 5IPYA 3AD8B 3F4AA 5LAMA 2RGHA 1OJTA 1Q1WA 2WP6A 1VDCA 4H4SA 1JOAA 1GALA 2C73A 3SZ0A 2R4JA 2YG7A 3K30A 3IPPA 2C70A 3R9UA 2XLSA 4NTDA 3GK5A 1KF6A 2YQUA 1WHBA 3H8LA 3Q9TA 4CNKA 2GAGB 3B3RA 3KLJA 3AEEA 2XLUA 2Z5YA 3BI2A 1GEUA 5CQFA 2HQMA 2BK4A 3NK2X 1K0IA 3AE4A 3UOXA 2PYXA 3CMMA 1BOIA 3IWHA 1F6MA 2R9ZA 5KNLA 3GRTA 3I3LA 1VG9A 3E1TA 3NN6X 1NHPA 4H2NA 1FEBA 3EF6A 1E1KA 3URHA 1E39A 1H7XA 2B7SA 2JAEA 4H2RA 3IHGA 1JRZA 2YLWA 3Q6JA 4HB9A 2RGOA 1CWSA 3KU9A 4J56A 4BJYA 4USRA 4KPRA 3II4A 1PBCA 1CWRA 2IVDA 1LTXR 3CNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DBJ A;  3GYI A;  3AYL A;  4YKG A;  1DP2 A;  1ZKQ A;  1NEN A;  1PBB A;  4EMW A;  2C3C A;  2V61 A;  3NHV A;  3FLH A;  1GRB A;  2VVL A;  4B69 A;  4GRT A;  4YWO A;  2FJD A;  4U8P A;  3I2V A;  1RHD A;  4NZH A;  1YS0 A;  4YXD A;  2EQ6 A;  1JRX A;  3R2U A;  3UP4 A;  4YT0 A;  5HY5 A;  3MZZ A;  2WOV A;  1GSN A;  1GV4 A;  3DK8 A;  3DJJ A;  4RG3 A;  2Y6R A;  3UTH A;  2JKC A;  3TG3 A;  2YM1 A;  2YVJ A;  4APN A;  1ZP0 A;  2ZBW A;  1GOS A;  1VRQ B;  3BI5 A;  3NRN A;  3UKH A;  4A99 A;  2OAM A;  2GQW A;  1ZOV A;  1FL2 A;  5J7X A;  1KSS A;  4OCG A;  3S61 A;  4TLX A;  2YG5 A;  3NNE A;  1YT8 A;  1BKW A;  1SEZ A;  4H4Y A;  3UKF A;  1ZDL A;  3DK4 A;  2VOU A;  3AWI A;  1QXN A;  2YWL A;  3QSS A;  2JTQ A;  5U25 A;  4D04 A;  3SFD A;  1GRG A;  2Q0L A;  2WDV A;  1GER A;  1KDG A;  1YQZ A;  3AYJ A;  4YSY A;  4TM3 A;  1UAR A;  4IVO B;  1ZMC A;  1RHS A;  1S3E A;  3C4A A;  2BC1 A;  2JBV A;  5J60 A;  1BGJ A;  4GCM A;  4U8I A;  2YG6 A;  3ICR A;  2GMJ A;  1YQ3 A;  3ALM A;  1OJA A;  2YR5 A;  2MOI A;  1N4U A;  1PJ5 A;  5LAO A;  1MOK A;  3AE7 A;  1GET A;  4Z2U A;  3AAX A;  4U8N A;  4BK2 A;  4EIQ A;  1GRH A;  1Y56 A;  4OPG A;  1CJ4 A;  1GMX A;  3CNT A;  2GR2 A;  5BVA A;  1GTE A;  4CY6 A;  3AE2 A;  3SM8 A;  1TYP A;  2A8X A;  1YMD A;  4TM1 A;  3CGC A;  4DGK A;  1H4M X;  2GEW A;  5EB4 A;  2VZ2 A;  3AEG A;  3DK9 A;  4NTE A;  1OKG A;  3UOY A;  1XHC A;  3FNJ A;  3ALL A;  2C75 A;  3OP3 A;  1P2E A;  2BXR A;  2MRM A;  2DKH A;  1CHU A;  3CTY A;  1CC4 A;  1BOH A;  1BZL A;  2ZZ0 A;  3ZYX A;  1CJ2 A;  1S2Q A;  4U2T A;  1EL5 A;  1GRE A;  4YSZ A;  3VR9 A;  1FEA A;  3DME A;  3NYF A;  4IVM B;  2UZQ A;  4IV9 A;  2UZZ A;  1Y56 B;  1B37 A;  3NTA A;  2XVH A;  1XAN A;  2EG3 A;  5IQ4 A;  3D1C A;  2WPE A;  2WHD A;  1YM9 A;  1JRY A;  1F8R A;  4USQ A;  4Y4N A;  3IWA A;  1VG0 A;  1ZY8 A;  4N9X A;  4GUV A;  3NGC X;  4A6N A;  1Y0P A;  3UOZ A;  3QSE A;  4DNA A;  4NEW A;  4JY2 A;  2WEU A;  1H81 A;  1L9C A;  2GB0 A;  2XCG A;  2YG3 A;  2Z5X A;  4YKF A;  4Z24 A;  2VQ7 A;  4RG4 A;  1ZK7 A;  2TPR A;  1P2H A;  3I6D A;  1EL8 A;  4M52 A;  3M12 A;  4EMJ A;  1L0V A;  1DOD A;  4OVI A;  4D03 A;  2R0G A;  1PS9 A;  1E1M A;  2OLO A;  4WCT A;  3VRD B;  2XYO A;  4LA1 A;  1O94 A;  5U1O A;  2C66 A;  1CL0 A;  3IPO A;  1ZOY A;  4I59 A;  4A6N B;  4CCR A;  1EL7 A;  3AEF A;  1D4E A;  3QVP A;  4B63 A;  3BHF A;  2ARD A;  1M64 A;  3G5J A;  1ONF A;  3GYJ A;  3G5R A;  4I58 A;  2WLX A;  1E1L A;  1TDO A;  3G5Q A;  3H4K A;  4FK1 A;  4JNA A;  1M6I A;  3NT6 A;  3AXB A;  3NK1 X;  4H4V A;  4BK1 A;  3UKA A;  2BA9 A;  1DOC A;  3AE3 A;  4B68 A;  5LV9 A;  3K9R A;  4F67 A;  2IID A;  3QFB A;  2OUC A;  4A79 A;  2GMH A;  2BCG G;  2C65 A;  2OA1 A;  3NYC A;  2C76 A;  4LII A;  4CCQ A;  1PBD A;  4BV6 A;  5M10 A;  2YG4 A;  3C4N A;  5EBK A;  4FX9 A;  2XFP A;  1PXB A;  1PXC A;  3UTE A;  3LXD A;  2K0Z A;  2YR6 A;  1S2Y A;  4Y4L A;  3HZU A;  2GAH B;  2X8H A;  1E6E A;  3CND A;  3OZ2 A;  5JCK A;  1HZM A;  2X99 A;  2FSX A;  2IFV A;  3AE8 A;  4YTN A;  1KSU A;  2BS2 A;  3AED A;  1H82 A;  3NKS A;  5KVI A;  2XFN A;  5ER0 A;  1KNP A;  3B6D A;  4U8J A;  4A7A A;  2RAB A;  3LAD A;  3O3W A;  1B8S A;  2QCU A;  5EOW A;  1TDN A;  1IUV A;  1GPE A;  2R45 A;  1GT8 A;  2XLR A;  1GND A;  3ABV A;  3GD3 A;  4LU6 A;  1TYT A;  3DJD A;  2I0Z A;  4Z25 A;  4A5L A;  4H4Z A;  1NPX A;  4UDQ A;  3LZX A;  3PS9 A;  2QA1 A;  4GDP A;  3KD9 A;  1WV9 A;  2RGJ A;  4J34 A;  3VR8 A;  1NHQ A;  5IQ1 A;  2B9Y A;  2JB1 A;  2VQB A;  1RYI A;  5HHF A;  2E1M A;  3FPZ A;  5KXJ A;  3QSM A;  3NYE A;  4TLZ A;  1OJ9 A;  1O95 A;  4AP3 A;  4X4J A;  4GR1 A;  4YSX A;  3DGZ A;  2X8G A;  1LPF A;  4UP3 A;  4EM4 A;  4ECH A;  5KVH A;  4K8D A;  4K5R A;  4C74 A;  3F8P A;  2WPC A;  3KA7 A;  1N4V A;  2DKI A;  2C7G A;  4WH9 A;  4XXG A;  4E0V A;  2XDO A;  1GRF A;  4H7U A;  4BJZ A;  1OJD A;  5BRT A;  2YLR A;  4J31 A;  4FK1 C;  2FJB A;  2R46 A;  3AE5 A;  3ICT A;  1VEE A;  3RHA A;  3OC4 A;  3SGL A;  2B76 A;  4FDC B;  3P4S A;  1PDH A;  3AD9 B;  2JTS A;  4BUR A;  4ZN0 A;  1N4W A;  4DSG A;  3D1P A;  1T3K A;  2WS3 A;  3LZW A;  3L8K A;  3AB1 A;  3UCL A;  4H4T A;  4AT0 A;  1CF3 A;  1TDE A;  2H88 A;  1H6V A;  4CNJ A;  4CBQ A;  4B67 A;  2C3D A;  2V3B A;  4H2P A;  5HXI A;  1D4C A;  2OLN A;  2JB2 A;  4P9S A;  1NG4 A;  2AAQ A;  1H7W A;  2WOW A;  3QVR A;  3P9U A;  3NTD A;  1PJ7 A;  2XFO A;  1QLB A;  2YVF A;  4H4P A;  3BI4 A;  2GVC A;  2GRT A;  1H86 A;  2BS3 A;  1B5Q A;  2KL3 A;  1E7P A;  4NTC A;  3COX A;  3FIM B;  5KWF A;  1D7Y A;  3CIR A;  1GXF A;  1LVL A;  4RSL A;  1JEH A;  3IHM A;  3GWD A;  1GRA A;  3CPH G;  4X9N A;  2GR1 A;  3VRB A;  1E0C A;  4UDP A;  1FOH A;  3CGE A;  4AP1 A;  3P4R A;  4MJW A;  2A89 A;  2WDR A;  2ORA A;  1PJ6 A;  1HYU A;  3NIX A;  4GF7 A;  4JQ9 A;  3M13 A;  4JDR A;  2GF3 A;  1GN0 A;  4XWZ A;  4B1B A;  2XVI A;  5BUL A;  2R0P A;  2EQ9 A;  1OJC A;  3TP9 A;  2BK5 A;  3ATR A;  3ALJ A;  3GRS A;  3UKP A;  4EQW A;  2VVM A;  4K2X A;  2APG A;  4O5Q A;  5L46 A;  4K22 A;  2V60 A;  2VVL G;  4H50 A;  5CKU A;  2DCQ A;  2VRL A;  5FS9 A;  4C3Y A;  4EQS A;  2BK3 A;  3G5S A;  3CGB A;  3PO7 A;  2Y6Q A;  3V3N A;  3CPJ G;  1MXT A;  5U63 A;  2XFU A;  3RP6 A;  3RP8 A;  2X50 A;  1RSG A;  1VQW A;  4A9W A;  4AOS A;  3O0H A;  1AOG A;  3SQP A;  1Q9I A;  1DXL A;  3GMC A;  5HBL A;  3UTN X;  1CC2 A;  3NK0 X;  3AEA A;  1IUX A;  3BNM A;  1GRT A;  4K5S A;  1DNC A;  3DH9 A;  2YAU A;  3FG2 P;  2XLT A;  3UTG A;  1IJH A;  4J36 A;  2YLX A;  2GR0 A;  1O5W A;  1DOB A;  1H83 A;  2FJE A;  2GH5 A;  4A65 A;  3UP5 A;  1TQ1 A;  1H84 A;  2BAB A;  2XFQ A;  4U8M A;  2F5Z A;  4HA6 A;  3D8X A;  3UKQ A;  4YTP A;  1EBD A;  1XPQ A;  1NEK A;  1X31 B;  1ZX9 A;  2NPX A;  4JY3 A;  2GV8 A;  4XWR A;  4OPT A;  2BCP A;  1YKJ A;  3BHK A;  4JNQ A;  3DJE A;  3VQR A;  1YML A;  4NEV A;  3SFE A;  1DJQ A;  2BS4 A;  1NHS A;  4O5U A;  2J6P A;  4U8L A;  2WES A;  2EG4 B;  1K4Q A;  1L9E A;  3NH3 X;  3T37 A;  3ICS A;  2YR4 A;  1PBF A;  2ACZ A;  3AYI A;  2JK6 A;  4Z43 A;  1CC6 A;  1DJN A;  1ORB A;  1CWT A;  4ICY A;  1PXA A;  3VRA A;  2Q7V A;  1Q1R A;  2BYB A;  1PN0 A;  2BXS A;  2C67 A;  2XLP A;  3S5W A;  5HYM A;  3NN0 X;  3P4Q A;  2V5Z A;  2ZZB A;  2A2K A;  2PHH A;  3ATQ A;  2EQ8 A;  4U8K A;  2CDU A;  2O9Z A;  3OLH A;  3HZL A;  4C77 A;  2FBW A;  3ADA B;  4B66 A;  1REO A;  3RNM A;  2CVJ A;  1KFY A;  4C3X A;  1URH A;  2FJA A;  2WLR A;  2QAE A;  3I3U A;  1BWC A;  1B4V A;  4UDR A;  2Q6U A;  2WU5 A;  4OPI A;  2XVE A;  1GTH A;  3FMW A;  4JN9 A;  4J2W A;  3RED A;  3LOV A;  4OPD A;  3GSI A;  4AOX A;  4GDE A;  1IUW A;  3P1W A;  3FOJ A;  4PAA A;  5HBP A;  2CUL A;  2R0C A;  5JCL A;  2OAL A;  4KX6 A;  4Z44 A;  3HIX A;  3P3A A;  1PHH A;  3K7M X;  1QO8 A;  4U2S A;  3LJP A;  3JSK A;  1D5T A;  2WP5 A;  5C2T A;  3GMB A;  1K0L A;  1S3B A;  3DGH A;  3DJG X;  1LQU A;  3AE9 A;  2WPF A;  3P4P A;  4H2Q A;  3IF9 A;  2BC0 A;  5KOX A;  2JTR A;  1QJD A;  2Q0K A;  3H8I A;  4TM4 A;  3AEB A;  4Z2T A;  2WOI A;  3HWI A;  1N1P A;  1C25 A;  4CY8 A;  1IUS A;  3AE6 A;  1NAA A;  3FS5 A;  1F8S A;  4PAB A;  4ZCD A;  1NHR A;  3KVE A;  3EAO A;  2TMD A;  5FS8 A;  3ILM A;  3GDP A;  1TRB A;  1YQ4 A;  2WU2 A;  3GDN A;  1RP0 A;  2J3N A;  3KPF A;  3AD7 B;  4Y4M A;  3AEC A;  3CGD A;  4U8O A;  4B65 A;  4H4Q A;  2E5V A;  5HPA A;  5C3J A;  1FCD A;  1YY5 A;  1CBO A;  1E1N A;  4BK3 A;  1NDA A;  1K0J A;  1BGN A;  3GD4 A;  1D7L A;  4C5O A;  1DOE A;  1TDK A;  3CPI G;  2BAC A;  5HBQ A;  5HBO A;  1JU2 A;  2NVK X;  2VSW A;  2YM2 A;  3EAN A;  2YLS A;  2ZZC A;  2WDQ A;  1F3P A;  1QB0 A;  3ITJ A;  3K7Q X;  2WP9 A;  3L1R A;  4H4X A;  4TM0 A;  4EIP A;  3UOV A;  3EPT A;  4EM3 A;  3K7T A;  1ELI A;  1LQT A;  2R4E A;  4J57 A;  2GWF A;  2VRM A;  4EQX A;  4REK A;  3UTF A;  1JNR A;  3F8R A;  2WQY A;  1TDF A;  3PVC A;  1YMK A;  4IA5 A;  4U2L A;  5GSN A;  4H4W A;  1MO9 A;  4WX1 A;  3WE0 A;  2HHG A;  2W0H A;  2YLT A;  4CRT A;  2XVJ A;  5JCN A;  2B9X A;  2XVF A;  1GES A;  2IFD A;  5FS7 A;  3TG1 B;  1BF3 A;  3ZDN A;  2WBA A;  5KOW A;  2GQF A;  2X8C A;  1IUT A;  5FMH A;  4Z2R A;  3CNS A;  1PBE A;  4WH7 A;  2H89 A;  2X3N A;  3BNU A;  1L9D A;  3NLC A;  3F8D A;  5TR3 A;  4K7Z A;  5BUK A;  2MOL A;  1W4X A;  2E4G A;  2EQ7 A;  3IC9 A;  4H4R A;  3ISH A;  1F8W A;  1LJ1 A;  1Z6L A;  3KKJ A;  2EG4 A;  5FS6 A;  4IA6 A;  3RP7 A;  2YVG A;  4OPL A;  4J33 A;  2B9W A;  4EQR A;  4Z26 A;  1IUU A;  4YTM A;  2CFY A;  5JCM A;  2JB3 A;  2V6O A;  3M0O A;  4JGT A;  3FBS A;  1EL9 A;  3NG7 X;  3NHO X;  3QJ4 A;  4ZCC A;  5GRT A;  2AR8 A;  3LB8 A;  1XDI A;  3UKL A;  3GWF A;  1COY A;  2C64 A;  2QA2 A;  3V3O A;  2AQJ A;  1FEC A;  3CN8 A;  3CNP A;  1UKV G;  3V76 A;  2V3A A;  4DSH A;  4OPC A;  1D4D A;  1ZMD A;  2C72 A;  2YLZ A;  4EMI A;  1NG3 A;  4B64 A;  5JCI A;  5M0Z A;  3UKK A;  4YSH A;  1H4K X;  1V59 A;  4ADW A;  2WET A;  3DA1 A;  5EB5 A;  4AT2 A;  2B7R A;  3C96 A;  1CJC A;  1JNZ A;  1CJ3 A;  3AE1 A;  2IVE A;  3QFA A;  4H4U A;  5KRQ A;  1KNR A;  3AAY A;  1LV0 A;  2GR3 A;  4OPU A;  2A87 A;  4X9M A;  5IPY A;  3AD8 B;  3F4A A;  5LAM A;  2RGH A;  1OJT A;  1Q1W A;  2WP6 A;  1VDC A;  4H4S A;  1JOA A;  1GAL A;  2C73 A;  2R4J A;  2YG7 A;  3K30 A;  3IPP A;  2C70 A;  3R9U A;  2XLS A;  4NTD A;  3GK5 A;  1KF6 A;  2YQU A;  1WHB A;  3H8L A;  3Q9T A;  4CNK A;  2GAG B;  3B3R A;  3KLJ A;  3AEE A;  2XLU A;  2Z5Y A;  3BI2 A;  1GEU A;  5CQF A;  2HQM A;  2BK4 A;  3NK2 X;  1K0I A;  3AE4 A;  3UOX A;  2PYX A;  1BOI A;  3IWH A;  1F6M A;  2R9Z A;  3GRT A;  3I3L A;  1VG9 A;  3E1T A;  3NN6 X;  1NHP A;  4H2N A;  1FEB A;  3EF6 A;  1E1K A;  3URH A;  1E39 A;  1H7X A;  2B7S A;  2JAE A;  4H2R A;  3IHG A;  1JRZ A;  2YLW A;  3Q6J A;  4HB9 A;  2RGO A;  1CWS A;  3KU9 A;  4J56 A;  4BJY A;  4USR A;  4KPR A;  3II4 A;  1PBC A;  1CWR A;  2IVD A;  1LTX R;  3CNJ A; 
#chains in the Genus database with same CATH topology
 5DBJ A;  3GYI A;  3AYL A;  4YKG A;  1DP2 A;  1ZKQ A;  1NEN A;  1PBB A;  4EMW A;  2C3C A;  2V61 A;  3NHV A;  3FLH A;  1GRB A;  2VVL A;  4B69 A;  4GRT A;  4YWO A;  2FJD A;  4U8P A;  3I2V A;  1RHD A;  4NZH A;  1YS0 A;  4YXD A;  2EQ6 A;  1JRX A;  3R2U A;  3UP4 A;  4YT0 A;  5HY5 A;  3MZZ A;  2WOV A;  1GSN A;  1GV4 A;  3DK8 A;  3DJJ A;  4RG3 A;  2Y6R A;  3UTH A;  2JKC A;  3TG3 A;  2YM1 A;  2YVJ A;  4APN A;  1ZP0 A;  2ZBW A;  1GOS A;  1VRQ B;  3BI5 A;  3NRN A;  3UKH A;  4A99 A;  2OAM A;  2GQW A;  1ZOV A;  1FL2 A;  5J7X A;  1KSS A;  4OCG A;  3S61 A;  4TLX A;  2YG5 A;  3NNE A;  1YT8 A;  1BKW A;  1SEZ A;  4H4Y A;  3UKF A;  1ZDL A;  3DK4 A;  2VOU A;  3AWI A;  1QXN A;  2YWL A;  3QSS A;  2JTQ A;  5U25 A;  4D04 A;  3SFD A;  1GRG A;  2Q0L A;  2WDV A;  1GER A;  1KDG A;  1YQZ A;  3AYJ A;  4YSY A;  4TM3 A;  1UAR A;  4IVO B;  1ZMC A;  1RHS A;  1S3E A;  3C4A A;  2BC1 A;  2JBV A;  5J60 A;  1BGJ A;  4GCM A;  4U8I A;  2YG6 A;  3ICR A;  2GMJ A;  1YQ3 A;  3ALM A;  1OJA A;  2YR5 A;  2MOI A;  1N4U A;  1PJ5 A;  5LAO A;  1MOK A;  3AE7 A;  1GET A;  4Z2U A;  3AAX A;  4U8N A;  4BK2 A;  4EIQ A;  1GRH A;  1Y56 A;  4OPG A;  1CJ4 A;  3SZC A;  1GMX A;  3CNT A;  2GR2 A;  5BVA A;  1GTE A;  4CY6 A;  3AE2 A;  3SM8 A;  1TYP A;  2A8X A;  1YMD A;  4TM1 A;  3CGC A;  4DGK A;  1H4M X;  2GEW A;  5EB4 A;  2VZ2 A;  3AEG A;  3DK9 A;  4NTE A;  1OKG A;  3UOY A;  1XHC A;  3FNJ A;  3ALL A;  2C75 A;  3OP3 A;  1P2E A;  2BXR A;  2MRM A;  2DKH A;  1CHU A;  3CTY A;  1CC4 A;  1BOH A;  1BZL A;  2ZZ0 A;  3ZYX A;  1CJ2 A;  1S2Q A;  4U2T A;  1EL5 A;  1GRE A;  4YSZ A;  3SY4 A;  3VR9 A;  1FEA A;  3DME A;  3NYF A;  4IVM B;  2UZQ A;  4IV9 A;  2UZZ A;  1Y56 B;  1B37 A;  3NTA A;  2XVH A;  1XAN A;  2EG3 A;  5IQ4 A;  3D1C A;  4NWZ A;  2WPE A;  2WHD A;  1YM9 A;  1JRY A;  1F8R A;  3SXI A;  4USQ A;  4Y4N A;  3IWA A;  1VG0 A;  1ZY8 A;  4N9X A;  4GUV A;  3NGC X;  4A6N A;  1Y0P A;  3UOZ A;  3QSE A;  4DNA A;  4NEW A;  4JY2 A;  2WEU A;  1H81 A;  1L9C A;  2GB0 A;  2XCG A;  2YG3 A;  2Z5X A;  4YKF A;  4Z24 A;  2VQ7 A;  4RG4 A;  1ZK7 A;  2TPR A;  1P2H A;  3I6D A;  2C4C A;  1EL8 A;  4M52 A;  3M12 A;  4EMJ A;  1L0V A;  1DOD A;  4OVI A;  4D03 A;  2R0G A;  1PS9 A;  1E1M A;  2OLO A;  4WCT A;  3VRD B;  2XYO A;  4LA1 A;  1O94 A;  5U1O A;  2C66 A;  1CL0 A;  3IPO A;  1ZOY A;  4I59 A;  4A6N B;  4CCR A;  1EL7 A;  3AEF A;  1D4E A;  3QVP A;  4B63 A;  3BHF A;  2ARD A;  1M64 A;  3G5J A;  1ONF A;  3GYJ A;  3G5R A;  4I58 A;  2WLX A;  1E1L A;  1TDO A;  3G5Q A;  3H4K A;  4FK1 A;  4JNA A;  1M6I A;  3NT6 A;  3AXB A;  3NK1 X;  4H4V A;  4BK1 A;  3UKA A;  2BA9 A;  1DOC A;  3AE3 A;  4B68 A;  3T2Y A;  3K9R A;  4F67 A;  2IID A;  5LV9 A;  3QFB A;  2OUC A;  4A79 A;  2GMH A;  2BCG G;  2C65 A;  2OA1 A;  3NYC A;  2C76 A;  4G6H A;  4LII A;  1PBD A;  4CCQ A;  4BV6 A;  5M10 A;  2YG4 A;  3C4N A;  5EBK A;  4FX9 A;  2XFP A;  1PXB A;  1PXC A;  3UTE A;  3LXD A;  2K0Z A;  3T0K A;  2YR6 A;  1S2Y A;  4Y4L A;  3HZU A;  2GAH B;  2X8H A;  1E6E A;  3CND A;  3OZ2 A;  5JCK A;  1HZM A;  2X99 A;  2FSX A;  2IFV A;  3AE8 A;  4YTN A;  1KSU A;  2BS2 A;  3VR8 A;  3AED A;  1H82 A;  3NKS A;  5KVI A;  2XFN A;  5ER0 A;  1KNP A;  3B6D A;  4U8J A;  4A7A A;  2Q82 A;  2RAB A;  3LAD A;  3O3W A;  1B8S A;  2QCU A;  5EOW A;  5KMR A;  1TDN A;  1IUV A;  1GPE A;  2R45 A;  1GT8 A;  2XLR A;  1GND A;  3ABV A;  3GD3 A;  4LU6 A;  1TYT A;  3DJD A;  2I0Z A;  4Z25 A;  4A5L A;  4H4Z A;  1NPX A;  4UDQ A;  3LZX A;  3PS9 A;  2QA1 A;  4GAP A;  3KD9 A;  1WV9 A;  2RGJ A;  4GDP A;  4J34 A;  1NHQ A;  5IQ1 A;  2B9Y A;  2JB1 A;  2VQB A;  1RYI A;  5HHF A;  2E1M A;  3FPZ A;  5KXJ A;  3QSM A;  4G73 A;  3NYE A;  4TLZ A;  1OJ9 A;  1O95 A;  4AP3 A;  4X4J A;  4GR1 A;  4YSX A;  3DGZ A;  2X8G A;  1LPF A;  4UP3 A;  4EM4 A;  4ECH A;  5KVH A;  4K8D A;  4K5R A;  3SYI A;  4C74 A;  3F8P A;  2WPC A;  3KA7 A;  1N4V A;  2DKI A;  2C7G A;  4WH9 A;  5KMS A;  4XXG A;  4GAV A;  4E0V A;  2XDO A;  1GRF A;  4H7U A;  4BJZ A;  1OJD A;  5BRT A;  2YLR A;  4J31 A;  4FK1 C;  2FJB A;  2R46 A;  3AE5 A;  3ICT A;  1VEE A;  3RHA A;  3OC4 A;  3SGL A;  2B76 A;  4FDC B;  3P4S A;  1PDH A;  3AD9 B;  2JTS A;  4BUR A;  4ZN0 A;  1N4W A;  4DSG A;  3D1P A;  1T3K A;  2WS3 A;  3LZW A;  3L8K A;  3AB1 A;  3SX6 A;  3UCL A;  4H4T A;  4AT0 A;  1CF3 A;  1TDE A;  2H88 A;  1H6V A;  4CNJ A;  4G74 A;  4CBQ A;  4B67 A;  2C3D A;  2V3B A;  4H2P A;  5HXI A;  1D4C A;  2OLN A;  2JB2 A;  4P9S A;  1NG4 A;  2AAQ A;  1H7W A;  2WOW A;  3QVR A;  3P9U A;  3NTD A;  1PJ7 A;  2XFO A;  1QLB A;  2YVF A;  4H4P A;  3BI4 A;  2GVC A;  2GRT A;  1H86 A;  2BS3 A;  1B5Q A;  2KL3 A;  1E7P A;  4NTC A;  3HYW A;  3COX A;  3FIM B;  5KWF A;  1D7Y A;  3CIR A;  1GXF A;  1LVL A;  4RSL A;  1JEH A;  3IHM A;  3GWD A;  1GRA A;  3CPH G;  4X9N A;  2GR1 A;  3VRB A;  1E0C A;  4UDP A;  1FOH A;  3CGE A;  4AP1 A;  3P4R A;  4MJW A;  2A89 A;  4II3 A;  2WDR A;  2ORA A;  1PJ6 A;  1HYU A;  3NIX A;  4GF7 A;  4JQ9 A;  3M13 A;  4JDR A;  2GF3 A;  1GN0 A;  4XWZ A;  4B1B A;  2XVI A;  5BUL A;  2R0P A;  2EQ9 A;  1OJC A;  3TP9 A;  2BK5 A;  3ATR A;  3ALJ A;  3GRS A;  3UKP A;  4EQW A;  2VVM A;  4K2X A;  2APG A;  4O5Q A;  5L46 A;  3HYX A;  4K22 A;  2V60 A;  2VVL G;  4H50 A;  5CKU A;  2DCQ A;  2VRL A;  5FS9 A;  4C3Y A;  4EQS A;  2BK3 A;  3G5S A;  3CGB A;  3PO7 A;  2Y6Q A;  3V3N A;  3CPJ G;  1MXT A;  5U63 A;  2XFU A;  3RP6 A;  3RP8 A;  2X50 A;  1RSG A;  1VQW A;  4A9W A;  4AOS A;  3O0H A;  1AOG A;  3SQP A;  1Q9I A;  1DXL A;  3GMC A;  5HBL A;  3UTN X;  1CC2 A;  3NK0 X;  3AEA A;  1IUX A;  2BRA A;  3BNM A;  1GRT A;  4K5S A;  1DNC A;  3DH9 A;  2YAU A;  3FG2 P;  2XLT A;  3T2K A;  3UTG A;  1IJH A;  4J36 A;  2YLX A;  2GR0 A;  1O5W A;  1DOB A;  1H83 A;  2FJE A;  2GH5 A;  4G9K A;  4A65 A;  3UP5 A;  1TQ1 A;  1H84 A;  2BAB A;  2XFQ A;  4U8M A;  2F5Z A;  4HA6 A;  3D8X A;  3UKQ A;  4YTP A;  1EBD A;  1XPQ A;  1NEK A;  1X31 B;  1ZX9 A;  2NPX A;  4JY3 A;  3KPK A;  2GV8 A;  4XWR A;  4OPT A;  2BCP A;  1YKJ A;  3BHK A;  4JNQ A;  3DJE A;  3VQR A;  1YML A;  4NEV A;  3SFE A;  1DJQ A;  2BS4 A;  1NHS A;  3T2Z A;  4O5U A;  2J6P A;  4U8L A;  2WES A;  2EG4 B;  1K4Q A;  1L9E A;  3NH3 X;  3T37 A;  3ICS A;  2YR4 A;  1PBF A;  2ACZ A;  3AYI A;  2JK6 A;  4Z43 A;  1CC6 A;  1DJN A;  1ORB A;  1CWT A;  4ICY A;  3SZW A;  1PXA A;  3VRA A;  2Q7V A;  1Q1R A;  2BYB A;  1PN0 A;  2BXS A;  2C67 A;  2XLP A;  3S5W A;  5HYM A;  3NN0 X;  3P4Q A;  2V5Z A;  2ZZB A;  2A2K A;  2PHH A;  3ATQ A;  2EQ8 A;  4U8K A;  2CDU A;  2O9Z A;  3OLH A;  3HZL A;  4C77 A;  2FBW A;  3ADA B;  4B66 A;  1REO A;  3RNM A;  2CVJ A;  1KFY A;  4C3X A;  1URH A;  2FJA A;  2WLR A;  2QAE A;  3I3U A;  1BWC A;  1B4V A;  4UDR A;  2Q6U A;  2WU5 A;  4OPI A;  2XVE A;  1GTH A;  3FMW A;  4JN9 A;  4NNJ A;  4J2W A;  3RED A;  3LOV A;  4OPD A;  3GSI A;  4AOX A;  4GDE A;  1IUW A;  3P1W A;  3FOJ A;  4PAA A;  5HBP A;  2CUL A;  2R0C A;  5JCL A;  2OAL A;  4KX6 A;  4Z44 A;  3HIX A;  3P3A A;  1PHH A;  3K7M X;  1QO8 A;  4U2S A;  3LJP A;  3JSK A;  1D5T A;  2WP5 A;  5C2T A;  3GMB A;  1K0L A;  1S3B A;  3GYX A;  3DGH A;  3DJG X;  1LQU A;  3AE9 A;  2WPF A;  3P4P A;  4H2Q A;  5KMQ A;  3IF9 A;  2BC0 A;  5KOX A;  2JTR A;  1QJD A;  2Q0K A;  3H8I A;  4TM4 A;  3AEB A;  4Z2T A;  2WOI A;  3HWI A;  1N1P A;  1C25 A;  4CY8 A;  1IUS A;  3AE6 A;  1NAA A;  3FS5 A;  1F8S A;  4PAB A;  4ZCD A;  1NHR A;  3KVE A;  3EAO A;  2TMD A;  5FS8 A;  3ILM A;  3GDP A;  1TRB A;  1YQ4 A;  2WU2 A;  3GDN A;  1RP0 A;  2J3N A;  3KPF A;  3AD7 B;  4Y4M A;  3AEC A;  3CGD A;  4U8O A;  4B65 A;  4H4Q A;  2E5V A;  5HPA A;  5C3J A;  1FCD A;  1YY5 A;  1CBO A;  1E1N A;  4BK3 A;  1NDA A;  1K0J A;  1BGN A;  3GD4 A;  1D7L A;  4C5O A;  1DOE A;  1TDK A;  3CPI G;  2BAC A;  5HBQ A;  5HBO A;  1JU2 A;  2NVK X;  2VSW A;  2YM2 A;  3EAN A;  2YLS A;  2ZZC A;  2WDQ A;  1F3P A;  1QB0 A;  3ITJ A;  3K7Q X;  2WP9 A;  3L1R A;  4H4X A;  4TM0 A;  3T31 A;  4EIP A;  3UOV A;  3EPT A;  4EM3 A;  3K7T A;  1ELI A;  1LQT A;  2R4E A;  4J57 A;  2GWF A;  2VRM A;  4EQX A;  4REK A;  3UTF A;  1JNR A;  3F8R A;  2WQY A;  1TDF A;  3PVC A;  1YMK A;  4IA5 A;  4U2L A;  5GSN A;  4H4W A;  1MO9 A;  4WX1 A;  3WE0 A;  2HHG A;  2W0H A;  5KMP A;  2YLT A;  4CRT A;  2XVJ A;  5JCN A;  2B9X A;  2XVF A;  1GES A;  2IFD A;  5FS7 A;  3TG1 B;  1BF3 A;  3ZDN A;  2WBA A;  5KOW A;  2GQF A;  2X8C A;  1IUT A;  5FMH A;  4Z2R A;  3CNS A;  1PBE A;  4WH7 A;  2H89 A;  2X3N A;  3BNU A;  1L9D A;  3NLC A;  3F8D A;  5TR3 A;  4K7Z A;  5BUK A;  2MOL A;  1W4X A;  2E4G A;  2EQ7 A;  3IC9 A;  4H4R A;  4G6G A;  3ISH A;  1F8W A;  1LJ1 A;  1Z6L A;  3KKJ A;  2EG4 A;  5FS6 A;  4IA6 A;  3RP7 A;  2YVG A;  4OPL A;  4J33 A;  2B9W A;  4EQR A;  4Z26 A;  4II2 A;  1IUU A;  4YTM A;  2CFY A;  5JCM A;  2JB3 A;  2V6O A;  3M0O A;  4JGT A;  3FBS A;  1EL9 A;  3NG7 X;  3NHO X;  3QJ4 A;  4ZCC A;  5GRT A;  2AR8 A;  3LB8 A;  1XDI A;  3UKL A;  3GWF A;  1COY A;  2C64 A;  2QA2 A;  3V3O A;  2AQJ A;  1FEC A;  3CN8 A;  3CNP A;  1UKV G;  3SZF A;  2V3A A;  3V76 A;  4OPC A;  4DSH A;  1D4D A;  1ZMD A;  2C72 A;  2YLZ A;  4EMI A;  1NG3 A;  4B64 A;  5JCI A;  5M0Z A;  3UKK A;  4YSH A;  1H4K X;  1V59 A;  4ADW A;  2WET A;  3DA1 A;  5EB5 A;  4AT2 A;  2B7R A;  2BRY A;  3C96 A;  3T14 A;  1CJC A;  1JNZ A;  1CJ3 A;  3AE1 A;  2IVE A;  3QFA A;  4H4U A;  5KRQ A;  1KNR A;  3AAY A;  1LV0 A;  2GR3 A;  3HYV A;  4OPU A;  2A87 A;  4X9M A;  5IPY A;  3AD8 B;  3F4A A;  5LAM A;  2RGH A;  1OJT A;  1Q1W A;  2WP6 A;  1VDC A;  4H4S A;  1JOA A;  1GAL A;  2C73 A;  3SZ0 A;  2R4J A;  2YG7 A;  3K30 A;  3IPP A;  2C70 A;  3R9U A;  2XLS A;  4NTD A;  3GK5 A;  1KF6 A;  2YQU A;  1WHB A;  3H8L A;  3Q9T A;  4CNK A;  2GAG B;  3B3R A;  3KLJ A;  3AEE A;  2XLU A;  2Z5Y A;  3BI2 A;  1GEU A;  5CQF A;  2HQM A;  2BK4 A;  3NK2 X;  1K0I A;  3AE4 A;  3UOX A;  2PYX A;  3CMM A;  1BOI A;  3IWH A;  1F6M A;  2R9Z A;  5KNL A;  3GRT A;  3I3L A;  1VG9 A;  3E1T A;  3NN6 X;  1NHP A;  4H2N A;  1FEB A;  3EF6 A;  1E1K A;  3URH A;  1E39 A;  1H7X A;  2B7S A;  2JAE A;  4H2R A;  3IHG A;  1JRZ A;  2YLW A;  3Q6J A;  4HB9 A;  2RGO A;  1CWS A;  3KU9 A;  4J56 A;  4BJY A;  4USR A;  4KPR A;  3II4 A;  1PBC A;  1CWR A;  2IVD A;  1LTX R;  3CNJ A; 
#chains in the Genus database with same CATH homology
 5DBJ A;  3GYI A;  3AYL A;  4YKG A;  1DP2 A;  1ZKQ A;  1NEN A;  1PBB A;  4EMW A;  2C3C A;  2V61 A;  3NHV A;  3FLH A;  1GRB A;  2VVL A;  4B69 A;  4GRT A;  4YWO A;  2FJD A;  4U8P A;  3I2V A;  1RHD A;  4NZH A;  1YS0 A;  4YXD A;  2EQ6 A;  1JRX A;  3R2U A;  3UP4 A;  4YT0 A;  5HY5 A;  3MZZ A;  2WOV A;  1GSN A;  1GV4 A;  3DK8 A;  3DJJ A;  4RG3 A;  2Y6R A;  3UTH A;  2JKC A;  3TG3 A;  2YM1 A;  2YVJ A;  4APN A;  1ZP0 A;  2ZBW A;  1GOS A;  1VRQ B;  3BI5 A;  3NRN A;  3UKH A;  4A99 A;  2OAM A;  2GQW A;  1ZOV A;  1FL2 A;  5J7X A;  1KSS A;  4OCG A;  3S61 A;  4TLX A;  2YG5 A;  3NNE A;  1YT8 A;  1BKW A;  1SEZ A;  4H4Y A;  3UKF A;  1ZDL A;  3DK4 A;  2VOU A;  3AWI A;  1QXN A;  2YWL A;  3QSS A;  2JTQ A;  5U25 A;  4D04 A;  3SFD A;  1GRG A;  2Q0L A;  2WDV A;  1GER A;  1KDG A;  1YQZ A;  3AYJ A;  4YSY A;  4TM3 A;  1UAR A;  4IVO B;  1ZMC A;  1RHS A;  1S3E A;  3C4A A;  2BC1 A;  2JBV A;  5J60 A;  1BGJ A;  4GCM A;  4U8I A;  2YG6 A;  3ICR A;  2GMJ A;  1YQ3 A;  3ALM A;  1OJA A;  2YR5 A;  2MOI A;  1N4U A;  1PJ5 A;  5LAO A;  1MOK A;  3AE7 A;  1GET A;  4Z2U A;  3AAX A;  4U8N A;  4BK2 A;  4EIQ A;  1GRH A;  1Y56 A;  4OPG A;  1CJ4 A;  3SZC A;  1GMX A;  3CNT A;  2GR2 A;  5BVA A;  1GTE A;  4CY6 A;  3AE2 A;  3SM8 A;  1TYP A;  2A8X A;  1YMD A;  4TM1 A;  3CGC A;  4DGK A;  1H4M X;  2GEW A;  5EB4 A;  2VZ2 A;  3AEG A;  3DK9 A;  4NTE A;  1OKG A;  3UOY A;  1XHC A;  3FNJ A;  3ALL A;  2C75 A;  3OP3 A;  1P2E A;  2BXR A;  2MRM A;  2DKH A;  1CHU A;  3CTY A;  1CC4 A;  1BOH A;  1BZL A;  2ZZ0 A;  3ZYX A;  1CJ2 A;  1S2Q A;  4U2T A;  1EL5 A;  1GRE A;  4YSZ A;  3SY4 A;  3VR9 A;  1FEA A;  3DME A;  3NYF A;  4IVM B;  2UZQ A;  4IV9 A;  2UZZ A;  1Y56 B;  1B37 A;  3NTA A;  2XVH A;  1XAN A;  2EG3 A;  5IQ4 A;  3D1C A;  4NWZ A;  2WPE A;  2WHD A;  1YM9 A;  1JRY A;  1F8R A;  3SXI A;  4USQ A;  4Y4N A;  3IWA A;  1VG0 A;  1ZY8 A;  4N9X A;  4GUV A;  3NGC X;  4A6N A;  1Y0P A;  3UOZ A;  3QSE A;  4DNA A;  4NEW A;  4JY2 A;  2WEU A;  1H81 A;  1L9C A;  2GB0 A;  2XCG A;  2YG3 A;  2Z5X A;  4YKF A;  4Z24 A;  2VQ7 A;  4RG4 A;  1ZK7 A;  2TPR A;  1P2H A;  3I6D A;  2C4C A;  1EL8 A;  4M52 A;  3M12 A;  4EMJ A;  1L0V A;  1DOD A;  4OVI A;  4D03 A;  2R0G A;  1PS9 A;  1E1M A;  2OLO A;  4WCT A;  3VRD B;  2XYO A;  4LA1 A;  1O94 A;  5U1O A;  2C66 A;  1CL0 A;  3IPO A;  1ZOY A;  4I59 A;  4A6N B;  4CCR A;  1EL7 A;  3AEF A;  1D4E A;  3QVP A;  4B63 A;  3BHF A;  2ARD A;  1M64 A;  3G5J A;  1ONF A;  3GYJ A;  3G5R A;  4I58 A;  2WLX A;  1E1L A;  1TDO A;  3G5Q A;  3H4K A;  4FK1 A;  4JNA A;  1M6I A;  3NT6 A;  3AXB A;  3NK1 X;  4H4V A;  4BK1 A;  3UKA A;  2BA9 A;  1DOC A;  3AE3 A;  4B68 A;  3T2Y A;  3K9R A;  4F67 A;  2IID A;  5LV9 A;  3QFB A;  2OUC A;  4A79 A;  2GMH A;  2BCG G;  2C65 A;  2OA1 A;  3NYC A;  2C76 A;  4G6H A;  4LII A;  1PBD A;  4CCQ A;  4BV6 A;  5M10 A;  2YG4 A;  3C4N A;  5EBK A;  4FX9 A;  2XFP A;  1PXB A;  1PXC A;  3UTE A;  3LXD A;  2K0Z A;  3T0K A;  2YR6 A;  1S2Y A;  4Y4L A;  3HZU A;  2GAH B;  2X8H A;  1E6E A;  3CND A;  3OZ2 A;  5JCK A;  1HZM A;  2X99 A;  2FSX A;  2IFV A;  3AE8 A;  4YTN A;  1KSU A;  2BS2 A;  3VR8 A;  3AED A;  1H82 A;  3NKS A;  5KVI A;  2XFN A;  5ER0 A;  1KNP A;  3B6D A;  4U8J A;  4A7A A;  2RAB A;  3LAD A;  3O3W A;  1B8S A;  2QCU A;  5EOW A;  5KMR A;  1TDN A;  1IUV A;  1GPE A;  2R45 A;  1GT8 A;  2XLR A;  1GND A;  3ABV A;  3GD3 A;  4LU6 A;  1TYT A;  3DJD A;  2I0Z A;  4Z25 A;  4A5L A;  4H4Z A;  1NPX A;  4UDQ A;  3LZX A;  3PS9 A;  2QA1 A;  4GAP A;  3KD9 A;  1WV9 A;  2RGJ A;  4GDP A;  4J34 A;  1NHQ A;  5IQ1 A;  2B9Y A;  2JB1 A;  2VQB A;  1RYI A;  5HHF A;  2E1M A;  3FPZ A;  5KXJ A;  3QSM A;  4G73 A;  3NYE A;  4TLZ A;  1OJ9 A;  1O95 A;  4AP3 A;  4X4J A;  4GR1 A;  4YSX A;  3DGZ A;  2X8G A;  1LPF A;  4UP3 A;  4EM4 A;  4ECH A;  5KVH A;  4K8D A;  4K5R A;  3SYI A;  4C74 A;  3F8P A;  2WPC A;  3KA7 A;  1N4V A;  2DKI A;  2C7G A;  4WH9 A;  5KMS A;  4XXG A;  4GAV A;  4E0V A;  2XDO A;  1GRF A;  4H7U A;  4BJZ A;  1OJD A;  5BRT A;  2YLR A;  4J31 A;  4FK1 C;  2FJB A;  2R46 A;  3AE5 A;  3ICT A;  1VEE A;  3RHA A;  3OC4 A;  3SGL A;  2B76 A;  4FDC B;  3P4S A;  1PDH A;  3AD9 B;  2JTS A;  4BUR A;  4ZN0 A;  1N4W A;  4DSG A;  3D1P A;  1T3K A;  2WS3 A;  3LZW A;  3L8K A;  3AB1 A;  3SX6 A;  3UCL A;  4H4T A;  4AT0 A;  1CF3 A;  1TDE A;  2H88 A;  1H6V A;  4CNJ A;  4G74 A;  4CBQ A;  4B67 A;  2C3D A;  2V3B A;  4H2P A;  5HXI A;  1D4C A;  2OLN A;  2JB2 A;  4P9S A;  1NG4 A;  2AAQ A;  1H7W A;  2WOW A;  3QVR A;  3P9U A;  3NTD A;  1PJ7 A;  2XFO A;  1QLB A;  2YVF A;  4H4P A;  3BI4 A;  2GVC A;  2GRT A;  1H86 A;  2BS3 A;  1B5Q A;  2KL3 A;  1E7P A;  4NTC A;  3HYW A;  3COX A;  3FIM B;  5KWF A;  1D7Y A;  3CIR A;  1GXF A;  1LVL A;  4RSL A;  1JEH A;  3IHM A;  3GWD A;  1GRA A;  3CPH G;  4X9N A;  2GR1 A;  3VRB A;  1E0C A;  4UDP A;  1FOH A;  3CGE A;  4AP1 A;  3P4R A;  4MJW A;  2A89 A;  4II3 A;  2WDR A;  2ORA A;  1PJ6 A;  1HYU A;  3NIX A;  4GF7 A;  4JQ9 A;  3M13 A;  4JDR A;  2GF3 A;  1GN0 A;  4XWZ A;  4B1B A;  2XVI A;  5BUL A;  2R0P A;  2EQ9 A;  1OJC A;  3TP9 A;  2BK5 A;  3ATR A;  3ALJ A;  3GRS A;  3UKP A;  4EQW A;  2VVM A;  4K2X A;  2APG A;  4O5Q A;  5L46 A;  3HYX A;  4K22 A;  2V60 A;  2VVL G;  4H50 A;  5CKU A;  2DCQ A;  2VRL A;  5FS9 A;  4C3Y A;  4EQS A;  2BK3 A;  3G5S A;  3CGB A;  3PO7 A;  2Y6Q A;  3V3N A;  3CPJ G;  1MXT A;  5U63 A;  2XFU A;  3RP6 A;  3RP8 A;  2X50 A;  1RSG A;  1VQW A;  4A9W A;  4AOS A;  3O0H A;  1AOG A;  3SQP A;  1Q9I A;  1DXL A;  3GMC A;  5HBL A;  3UTN X;  1CC2 A;  3NK0 X;  3AEA A;  1IUX A;  2BRA A;  3BNM A;  1GRT A;  4K5S A;  1DNC A;  3DH9 A;  2YAU A;  3FG2 P;  2XLT A;  3T2K A;  3UTG A;  1IJH A;  4J36 A;  2YLX A;  2GR0 A;  1O5W A;  1DOB A;  1H83 A;  2FJE A;  2GH5 A;  4G9K A;  4A65 A;  3UP5 A;  1TQ1 A;  1H84 A;  2BAB A;  2XFQ A;  4U8M A;  2F5Z A;  4HA6 A;  3D8X A;  3UKQ A;  4YTP A;  1EBD A;  1XPQ A;  1NEK A;  1X31 B;  1ZX9 A;  2NPX A;  4JY3 A;  3KPK A;  2GV8 A;  4XWR A;  4OPT A;  2BCP A;  1YKJ A;  3BHK A;  4JNQ A;  3DJE A;  3VQR A;  1YML A;  4NEV A;  3SFE A;  1DJQ A;  2BS4 A;  1NHS A;  3T2Z A;  4O5U A;  2J6P A;  4U8L A;  2WES A;  2EG4 B;  1K4Q A;  1L9E A;  3NH3 X;  3T37 A;  3ICS A;  2YR4 A;  1PBF A;  2ACZ A;  3AYI A;  2JK6 A;  4Z43 A;  1CC6 A;  1DJN A;  1ORB A;  1CWT A;  4ICY A;  3SZW A;  1PXA A;  3VRA A;  2Q7V A;  1Q1R A;  2BYB A;  1PN0 A;  2BXS A;  2C67 A;  2XLP A;  3S5W A;  5HYM A;  3NN0 X;  3P4Q A;  2V5Z A;  2ZZB A;  2A2K A;  2PHH A;  3ATQ A;  2EQ8 A;  4U8K A;  2CDU A;  2O9Z A;  3OLH A;  3HZL A;  4C77 A;  2FBW A;  3ADA B;  4B66 A;  1REO A;  3RNM A;  2CVJ A;  1KFY A;  4C3X A;  1URH A;  2FJA A;  2WLR A;  2QAE A;  3I3U A;  1BWC A;  1B4V A;  4UDR A;  2Q6U A;  2WU5 A;  4OPI A;  2XVE A;  1GTH A;  3FMW A;  4JN9 A;  4NNJ A;  4J2W A;  3RED A;  3LOV A;  4OPD A;  3GSI A;  4AOX A;  4GDE A;  1IUW A;  3P1W A;  3FOJ A;  4PAA A;  5HBP A;  2CUL A;  2R0C A;  5JCL A;  2OAL A;  4KX6 A;  4Z44 A;  3HIX A;  3P3A A;  1PHH A;  3K7M X;  1QO8 A;  4U2S A;  3LJP A;  3JSK A;  1D5T A;  2WP5 A;  5C2T A;  3GMB A;  1K0L A;  1S3B A;  3GYX A;  3DGH A;  3DJG X;  1LQU A;  3AE9 A;  2WPF A;  3P4P A;  4H2Q A;  5KMQ A;  3IF9 A;  2BC0 A;  5KOX A;  2JTR A;  1QJD A;  2Q0K A;  3H8I A;  4TM4 A;  3AEB A;  4Z2T A;  2WOI A;  3HWI A;  1N1P A;  1C25 A;  4CY8 A;  1IUS A;  3AE6 A;  1NAA A;  3FS5 A;  1F8S A;  4PAB A;  4ZCD A;  1NHR A;  3KVE A;  3EAO A;  2TMD A;  5FS8 A;  3ILM A;  3GDP A;  1TRB A;  1YQ4 A;  2WU2 A;  3GDN A;  1RP0 A;  2J3N A;  3KPF A;  3AD7 B;  4Y4M A;  3AEC A;  3CGD A;  4U8O A;  4B65 A;  4H4Q A;  2E5V A;  5HPA A;  5C3J A;  1FCD A;  1YY5 A;  1CBO A;  1E1N A;  4BK3 A;  1NDA A;  1K0J A;  1BGN A;  3GD4 A;  1D7L A;  4C5O A;  1DOE A;  1TDK A;  3CPI G;  2BAC A;  5HBQ A;  5HBO A;  1JU2 A;  2NVK X;  2VSW A;  2YM2 A;  3EAN A;  2YLS A;  2ZZC A;  2WDQ A;  1F3P A;  1QB0 A;  3ITJ A;  3K7Q X;  2WP9 A;  3L1R A;  4H4X A;  4TM0 A;  3T31 A;  4EIP A;  3UOV A;  3EPT A;  4EM3 A;  3K7T A;  1ELI A;  1LQT A;  2R4E A;  4J57 A;  2GWF A;  2VRM A;  4EQX A;  4REK A;  3UTF A;  1JNR A;  3F8R A;  2WQY A;  1TDF A;  3PVC A;  1YMK A;  4IA5 A;  4U2L A;  5GSN A;  4H4W A;  1MO9 A;  4WX1 A;  3WE0 A;  2HHG A;  2W0H A;  5KMP A;  2YLT A;  4CRT A;  2XVJ A;  5JCN A;  2B9X A;  2XVF A;  1GES A;  2IFD A;  5FS7 A;  3TG1 B;  1BF3 A;  3ZDN A;  2WBA A;  5KOW A;  2GQF A;  2X8C A;  1IUT A;  5FMH A;  4Z2R A;  3CNS A;  1PBE A;  4WH7 A;  2H89 A;  2X3N A;  3BNU A;  1L9D A;  3NLC A;  3F8D A;  5TR3 A;  4K7Z A;  5BUK A;  2MOL A;  1W4X A;  2E4G A;  2EQ7 A;  3IC9 A;  4H4R A;  4G6G A;  3ISH A;  1F8W A;  1LJ1 A;  1Z6L A;  3KKJ A;  2EG4 A;  5FS6 A;  4IA6 A;  3RP7 A;  2YVG A;  4OPL A;  4J33 A;  2B9W A;  4EQR A;  4Z26 A;  4II2 A;  1IUU A;  4YTM A;  2CFY A;  5JCM A;  2JB3 A;  2V6O A;  3M0O A;  4JGT A;  3FBS A;  1EL9 A;  3NG7 X;  3NHO X;  3QJ4 A;  4ZCC A;  5GRT A;  2AR8 A;  3LB8 A;  1XDI A;  3UKL A;  3GWF A;  1COY A;  2C64 A;  2QA2 A;  3V3O A;  2AQJ A;  1FEC A;  3CN8 A;  3CNP A;  1UKV G;  3SZF A;  2V3A A;  3V76 A;  4OPC A;  4DSH A;  1D4D A;  1ZMD A;  2C72 A;  2YLZ A;  4EMI A;  1NG3 A;  4B64 A;  5JCI A;  5M0Z A;  3UKK A;  4YSH A;  1H4K X;  1V59 A;  4ADW A;  2WET A;  3DA1 A;  5EB5 A;  4AT2 A;  2B7R A;  2BRY A;  3C96 A;  3T14 A;  1CJC A;  1JNZ A;  1CJ3 A;  3AE1 A;  2IVE A;  3QFA A;  4H4U A;  5KRQ A;  1KNR A;  3AAY A;  1LV0 A;  2GR3 A;  3HYV A;  4OPU A;  2A87 A;  4X9M A;  5IPY A;  3AD8 B;  3F4A A;  5LAM A;  2RGH A;  1OJT A;  1Q1W A;  2WP6 A;  1VDC A;  4H4S A;  1JOA A;  1GAL A;  2C73 A;  3SZ0 A;  2R4J A;  2YG7 A;  3K30 A;  3IPP A;  2C70 A;  3R9U A;  2XLS A;  4NTD A;  3GK5 A;  1KF6 A;  2YQU A;  1WHB A;  3H8L A;  3Q9T A;  4CNK A;  2GAG B;  3B3R A;  3KLJ A;  3AEE A;  2XLU A;  2Z5Y A;  3BI2 A;  1GEU A;  5CQF A;  2HQM A;  2BK4 A;  3NK2 X;  1K0I A;  3AE4 A;  3UOX A;  2PYX A;  3CMM A;  1BOI A;  3IWH A;  1F6M A;  2R9Z A;  5KNL A;  3GRT A;  3I3L A;  1VG9 A;  3E1T A;  3NN6 X;  1NHP A;  4H2N A;  1FEB A;  3EF6 A;  1E1K A;  3URH A;  1E39 A;  1H7X A;  2B7S A;  2JAE A;  4H2R A;  3IHG A;  1JRZ A;  2YLW A;  3Q6J A;  4HB9 A;  2RGO A;  1CWS A;  3KU9 A;  4J56 A;  4BJY A;  4USR A;  4KPR A;  3II4 A;  1PBC A;  1CWR A;  2IVD A;  1LTX R;  3CNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...