3O3WA

Crystal structure of bh2092 protein (residues 14-131) from bacillus halodurans, northeast structural genomics consortium target bhr228a
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
118
structure length
118
Chain Sequence
EPANPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEAYKECHIPTAISIPGNKINEDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQLGFRVKELIGGIEYWRKENG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords BH2092 protein
publication title Crystal Structure of BH2092 protein (residues 14-131) from Bacillus halodurans, Northeast Structural Genomics Consortium Target BhR228A
rcsb
source organism Bacillus halodurans
total genus 34
structure length 118
sequence length 118
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2010-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3o3wA00
1DP2A 3NTDA 3OP3A 3ILMA 1YM9A 3FLHA 3IPOA 3P3AA 1C25A 2JTQA 4F67A 1UARA 1WV9A 2ORAA 1H4KX 4WH7A 1YMLA 5HBLA 3K9RA 1YMKA 3HIXA 5LAMA 2K0ZA 3AAYA 3GK5A 1CWRA 2JTSA 3HWIA 2IFDA 2J6PA 4WH9A 1URHA 2A2KA 3IWHA 1RHSA 1RHDA 1OKGA 3TG3A 1QXNA 1YMDA 3I2VA 2EG3A 3AAXA 4OCGA 3I3UA 2DCQA 3NTAA 2UZQA 5LAOA 1YT8A 3D1PA 3UTNX 1VEEA 1BOHA 5HBOA 3FOJA 2OUCA 2WLXA 3ICSA 1ORBA 3NHVA 3FNJA 3MZZA 1CWSA 2EG4B 1H4MX 3TP9A 2WLRA 3IPPA 1GN0A 2KL3A 1BOIA 4JGTA 3HZUA 1E0CA 2EG4A 2IFVA 3NT6A 3OLHA 5HBPA 2MOLA 1T3KA 3FS5A 3G5JA 2VSWA 1GMXA 2HHGA 1WHBA 1QB0A 3ICTA 3TG1B 2FSXA 5HBQA 1CWTA 2GWFA 3R2UA 2MRMA 5HPAA 1TQ1A 1HZMA 3O3WA 2MOIA 1YS0A 2JTRA 3ICRA 3F4AA
chains in the Genus database with same CATH superfamily
1DP2A 3NTDA 3OP3A 3ILMA 1YM9A 3FLHA 3IPOA 3P3AA 1C25A 2JTQA 4F67A 1UARA 1WV9A 2ORAA 1H4KX 4WH7A 1YMLA 5HBLA 3K9RA 1YMKA 3HIXA 5LAMA 2K0ZA 3AAYA 3GK5A 1CWRA 2JTSA 3HWIA 2IFDA 2J6PA 4WH9A 1URHA 2A2KA 3IWHA 1RHSA 1RHDA 1OKGA 3TG3A 1QXNA 1YMDA 3I2VA 2EG3A 3AAXA 4OCGA 3I3UA 2DCQA 3NTAA 2UZQA 5LAOA 1YT8A 3D1PA 3UTNX 1VEEA 1BOHA 5HBOA 3FOJA 2OUCA 2WLXA 3ICSA 1ORBA 3NHVA 3FNJA 3MZZA 1CWSA 2EG4B 1H4MX 3TP9A 2WLRA 3IPPA 1GN0A 2KL3A 1BOIA 4JGTA 3HZUA 1E0CA 2EG4A 2IFVA 3NT6A 3OLHA 5HBPA 2MOLA 1T3KA 3FS5A 3G5JA 2Q82A 2VSWA 1GMXA 2HHGA 1WHBA 1QB0A 3ICTA 3TG1B 2FSXA 5HBQA 1CWTA 2GWFA 3R2UA 2MRMA 5HPAA 1TQ1A 1HZMA 3O3WA 2MOIA 1YS0A 2JTRA 3ICRA 3F4AA
chains in the Genus database with same CATH topology
1DP2A 3NTDA 3OP3A 3ILMA 1YM9A 3FLHA 3IPOA 3P3AA 1C25A 2JTQA 4F67A 1UARA 1WV9A 2ORAA 1H4KX 4WH7A 1YMLA 5HBLA 3K9RA 1YMKA 3HIXA 5LAMA 2K0ZA 3AAYA 3GK5A 1CWRA 2JTSA 3HWIA 2IFDA 2J6PA 4WH9A 1URHA 2A2KA 3IWHA 1RHSA 1RHDA 1OKGA 3TG3A 1QXNA 1YMDA 3I2VA 2EG3A 3AAXA 4OCGA 3I3UA 2DCQA 3NTAA 2UZQA 5LAOA 1YT8A 3D1PA 3UTNX 1VEEA 1BOHA 5HBOA 3FOJA 2OUCA 2WLXA 3ICSA 1ORBA 3NHVA 3FNJA 3MZZA 1CWSA 2EG4B 1H4MX 3TP9A 2WLRA 3IPPA 1GN0A 2KL3A 1BOIA 4JGTA 3HZUA 1E0CA 2EG4A 2IFVA 3NT6A 3OLHA 5HBPA 2MOLA 1T3KA 3FS5A 3G5JA 2VSWA 1GMXA 2HHGA 1WHBA 1QB0A 3ICTA 3TG1B 2FSXA 5HBQA 1CWTA 2GWFA 3R2UA 2MRMA 5HPAA 1TQ1A 1HZMA 3O3WA 2MOIA 1YS0A 2JTRA 3ICRA 3F4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DP2 A;  3NTD A;  3OP3 A;  3ILM A;  1YM9 A;  3FLH A;  3IPO A;  3P3A A;  1C25 A;  2JTQ A;  4F67 A;  1UAR A;  1WV9 A;  2ORA A;  1H4K X;  4WH7 A;  1YML A;  5HBL A;  3K9R A;  1YMK A;  3HIX A;  5LAM A;  2K0Z A;  3AAY A;  3GK5 A;  1CWR A;  2JTS A;  3HWI A;  2IFD A;  2J6P A;  4WH9 A;  1URH A;  2A2K A;  3IWH A;  1RHS A;  1RHD A;  1OKG A;  3TG3 A;  1QXN A;  1YMD A;  3I2V A;  2EG3 A;  3AAX A;  4OCG A;  3I3U A;  2DCQ A;  3NTA A;  2UZQ A;  5LAO A;  1YT8 A;  3D1P A;  3UTN X;  1VEE A;  1BOH A;  5HBO A;  3FOJ A;  2OUC A;  2WLX A;  3ICS A;  1ORB A;  3NHV A;  3FNJ A;  3MZZ A;  1CWS A;  2EG4 B;  1H4M X;  3TP9 A;  2WLR A;  3IPP A;  1GN0 A;  2KL3 A;  1BOI A;  4JGT A;  3HZU A;  1E0C A;  2EG4 A;  2IFV A;  3NT6 A;  3OLH A;  5HBP A;  2MOL A;  1T3K A;  3FS5 A;  3G5J A;  2VSW A;  1GMX A;  2HHG A;  1WHB A;  1QB0 A;  3ICT A;  3TG1 B;  2FSX A;  5HBQ A;  1CWT A;  2GWF A;  3R2U A;  2MRM A;  5HPA A;  1TQ1 A;  1HZM A;  3O3W A;  2MOI A;  1YS0 A;  2JTR A;  3ICR A;  3F4A A; 
#chains in the Genus database with same CATH topology
 1DP2 A;  3NTD A;  3OP3 A;  3ILM A;  1YM9 A;  3FLH A;  3IPO A;  3P3A A;  1C25 A;  2JTQ A;  4F67 A;  1UAR A;  1WV9 A;  2ORA A;  1H4K X;  4WH7 A;  1YML A;  5HBL A;  3K9R A;  1YMK A;  3HIX A;  5LAM A;  2K0Z A;  3AAY A;  3GK5 A;  1CWR A;  2JTS A;  3HWI A;  2IFD A;  2J6P A;  4WH9 A;  1URH A;  2A2K A;  3IWH A;  1RHS A;  1RHD A;  1OKG A;  3TG3 A;  1QXN A;  1YMD A;  3I2V A;  2EG3 A;  3AAX A;  4OCG A;  3I3U A;  2DCQ A;  3NTA A;  2UZQ A;  5LAO A;  1YT8 A;  3D1P A;  3UTN X;  1VEE A;  1BOH A;  5HBO A;  3FOJ A;  2OUC A;  2WLX A;  3ICS A;  1ORB A;  3NHV A;  3FNJ A;  3MZZ A;  1CWS A;  2EG4 B;  1H4M X;  3TP9 A;  2WLR A;  3IPP A;  1GN0 A;  2KL3 A;  1BOI A;  4JGT A;  3HZU A;  1E0C A;  2EG4 A;  2IFV A;  3NT6 A;  3OLH A;  5HBP A;  2MOL A;  1T3K A;  3FS5 A;  3G5J A;  2Q82 A;  2VSW A;  1GMX A;  2HHG A;  1WHB A;  1QB0 A;  3ICT A;  3TG1 B;  2FSX A;  5HBQ A;  1CWT A;  2GWF A;  3R2U A;  2MRM A;  5HPA A;  1TQ1 A;  1HZM A;  3O3W A;  2MOI A;  1YS0 A;  2JTR A;  3ICR A;  3F4A A; 
#chains in the Genus database with same CATH homology
 1DP2 A;  3NTD A;  3OP3 A;  3ILM A;  1YM9 A;  3FLH A;  3IPO A;  3P3A A;  1C25 A;  2JTQ A;  4F67 A;  1UAR A;  1WV9 A;  2ORA A;  1H4K X;  4WH7 A;  1YML A;  5HBL A;  3K9R A;  1YMK A;  3HIX A;  5LAM A;  2K0Z A;  3AAY A;  3GK5 A;  1CWR A;  2JTS A;  3HWI A;  2IFD A;  2J6P A;  4WH9 A;  1URH A;  2A2K A;  3IWH A;  1RHS A;  1RHD A;  1OKG A;  3TG3 A;  1QXN A;  1YMD A;  3I2V A;  2EG3 A;  3AAX A;  4OCG A;  3I3U A;  2DCQ A;  3NTA A;  2UZQ A;  5LAO A;  1YT8 A;  3D1P A;  3UTN X;  1VEE A;  1BOH A;  5HBO A;  3FOJ A;  2OUC A;  2WLX A;  3ICS A;  1ORB A;  3NHV A;  3FNJ A;  3MZZ A;  1CWS A;  2EG4 B;  1H4M X;  3TP9 A;  2WLR A;  3IPP A;  1GN0 A;  2KL3 A;  1BOI A;  4JGT A;  3HZU A;  1E0C A;  2EG4 A;  2IFV A;  3NT6 A;  3OLH A;  5HBP A;  2MOL A;  1T3K A;  3FS5 A;  3G5J A;  2VSW A;  1GMX A;  2HHG A;  1WHB A;  1QB0 A;  3ICT A;  3TG1 B;  2FSX A;  5HBQ A;  1CWT A;  2GWF A;  3R2U A;  2MRM A;  5HPA A;  1TQ1 A;  1HZM A;  3O3W A;  2MOI A;  1YS0 A;  2JTR A;  3ICR A;  3F4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...