3MZZA

Crystal structure of rhodanese-like domain protein from staphylococcus aureus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
MKSITTDELKNKLLESKPVQIVDVRTDEETAMGYIPNAKLIPMDTIPDNLNSFNKNEIYYIVCAGGVRSAKVVEYLEANGIDAVNVEGGMHAWGDEGLEIKSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Rhodanese-like domain protein
publication title Crystal Structure of Rhodanese-like Domain Protein from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
total genus 26
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3mzzA00
1CWRA 1BOIA 4WH7A 1E0CA 3AAXA 3G5JA 5HBOA 2WLXA 4OCGA 3HZUA 1GMXA 3FOJA 2ORAA 1RHSA 2WLRA 3ICTA 3NTDA 1OKGA 3I3UA 3OLHA 3TG1B 2EG4A 1URHA 3GK5A 3IWHA 5HBLA 1YMKA 2K0ZA 3ILMA 2MOIA 3UTNX 3MZZA 4JGTA 3NTAA 3HWIA 2A2KA 2UZQA 3FNJA 2JTRA 2DCQA 1YMLA 2IFVA 1YT8A 1CWTA 3F4AA 2EG3A 1GN0A 1YM9A 2FSXA 3ICSA 3R2UA 1WHBA 3NHVA 3O3WA 3FS5A 1WV9A 1BOHA 1QXNA 4F67A 1RHDA 1H4KX 1YMDA 1TQ1A 1HZMA 3FLHA 5HPAA 2GWFA 3IPPA 1T3KA 1ORBA 2JTSA 2EG4B 3NT6A 1C25A 2OUCA 1UARA 1QB0A 3HIXA 2VSWA 3D1PA 5HBQA 1H4MX 1VEEA 3ICRA 3IPOA 2MOLA 2HHGA 1DP2A 2JTQA 3I2VA 4WH9A 2J6PA 3P3AA 3K9RA 5LAMA 3TG3A 1CWSA 3AAYA 3TP9A 2IFDA 2MRMA 5LAOA 2KL3A 1YS0A 5HBPA 3OP3A
chains in the Genus database with same CATH superfamily
1CWRA 1BOIA 4WH7A 1E0CA 3AAXA 3G5JA 5HBOA 2WLXA 4OCGA 3HZUA 1GMXA 3FOJA 2ORAA 1RHSA 2WLRA 3ICTA 3NTDA 1OKGA 3I3UA 3OLHA 3TG1B 2EG4A 1URHA 3GK5A 3IWHA 5HBLA 1YMKA 2K0ZA 3ILMA 2MOIA 3UTNX 3MZZA 4JGTA 3NTAA 3HWIA 2A2KA 2UZQA 3FNJA 2JTRA 2DCQA 1YMLA 2IFVA 1YT8A 1CWTA 3F4AA 2EG3A 1GN0A 1YM9A 2FSXA 3ICSA 3R2UA 1WHBA 3NHVA 3O3WA 3FS5A 1WV9A 1BOHA 1QXNA 4F67A 1RHDA 1H4KX 1YMDA 1TQ1A 1HZMA 3FLHA 5HPAA 2GWFA 3IPPA 1T3KA 1ORBA 2JTSA 2EG4B 3NT6A 1C25A 2OUCA 1UARA 1QB0A 3HIXA 2VSWA 3D1PA 5HBQA 1H4MX 1VEEA 3ICRA 3IPOA 2MOLA 2HHGA 1DP2A 2JTQA 3I2VA 4WH9A 2J6PA 3P3AA 2Q82A 3K9RA 5LAMA 3TG3A 1CWSA 3AAYA 3TP9A 2IFDA 2MRMA 5LAOA 2KL3A 1YS0A 5HBPA 3OP3A
chains in the Genus database with same CATH topology
1CWRA 1BOIA 4WH7A 1E0CA 3AAXA 3G5JA 5HBOA 2WLXA 4OCGA 3HZUA 1GMXA 3FOJA 2ORAA 1RHSA 2WLRA 3ICTA 3NTDA 1OKGA 3I3UA 3OLHA 3TG1B 2EG4A 1URHA 3GK5A 3IWHA 5HBLA 1YMKA 2K0ZA 3ILMA 2MOIA 3UTNX 3MZZA 4JGTA 3NTAA 3HWIA 2A2KA 2UZQA 3FNJA 2JTRA 2DCQA 1YMLA 2IFVA 1YT8A 1CWTA 3F4AA 2EG3A 1GN0A 1YM9A 2FSXA 3ICSA 3R2UA 1WHBA 3NHVA 3O3WA 3FS5A 1WV9A 1BOHA 1QXNA 4F67A 1RHDA 1H4KX 1YMDA 1TQ1A 1HZMA 3FLHA 5HPAA 2GWFA 3IPPA 1T3KA 1ORBA 2JTSA 2EG4B 3NT6A 1C25A 2OUCA 1UARA 1QB0A 3HIXA 2VSWA 3D1PA 5HBQA 1H4MX 1VEEA 3ICRA 3IPOA 2MOLA 2HHGA 1DP2A 2JTQA 3I2VA 4WH9A 2J6PA 3P3AA 3K9RA 5LAMA 3TG3A 1CWSA 3AAYA 3TP9A 2IFDA 2MRMA 5LAOA 2KL3A 1YS0A 5HBPA 3OP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CWR A;  1BOI A;  4WH7 A;  1E0C A;  3AAX A;  3G5J A;  5HBO A;  2WLX A;  4OCG A;  3HZU A;  1GMX A;  3FOJ A;  2ORA A;  1RHS A;  2WLR A;  3ICT A;  3NTD A;  1OKG A;  3I3U A;  3OLH A;  3TG1 B;  2EG4 A;  1URH A;  3GK5 A;  3IWH A;  5HBL A;  1YMK A;  2K0Z A;  3ILM A;  2MOI A;  3UTN X;  3MZZ A;  4JGT A;  3NTA A;  3HWI A;  2A2K A;  2UZQ A;  3FNJ A;  2JTR A;  2DCQ A;  1YML A;  2IFV A;  1YT8 A;  1CWT A;  3F4A A;  2EG3 A;  1GN0 A;  1YM9 A;  2FSX A;  3ICS A;  3R2U A;  1WHB A;  3NHV A;  3O3W A;  3FS5 A;  1WV9 A;  1BOH A;  1QXN A;  4F67 A;  1RHD A;  1H4K X;  1YMD A;  1TQ1 A;  1HZM A;  3FLH A;  5HPA A;  2GWF A;  3IPP A;  1T3K A;  1ORB A;  2JTS A;  2EG4 B;  3NT6 A;  1C25 A;  2OUC A;  1UAR A;  1QB0 A;  3HIX A;  2VSW A;  3D1P A;  5HBQ A;  1H4M X;  1VEE A;  3ICR A;  3IPO A;  2MOL A;  2HHG A;  1DP2 A;  2JTQ A;  3I2V A;  4WH9 A;  2J6P A;  3P3A A;  3K9R A;  5LAM A;  3TG3 A;  1CWS A;  3AAY A;  3TP9 A;  2IFD A;  2MRM A;  5LAO A;  2KL3 A;  1YS0 A;  5HBP A;  3OP3 A; 
#chains in the Genus database with same CATH topology
 1CWR A;  1BOI A;  4WH7 A;  1E0C A;  3AAX A;  3G5J A;  5HBO A;  2WLX A;  4OCG A;  3HZU A;  1GMX A;  3FOJ A;  2ORA A;  1RHS A;  2WLR A;  3ICT A;  3NTD A;  1OKG A;  3I3U A;  3OLH A;  3TG1 B;  2EG4 A;  1URH A;  3GK5 A;  3IWH A;  5HBL A;  1YMK A;  2K0Z A;  3ILM A;  2MOI A;  3UTN X;  3MZZ A;  4JGT A;  3NTA A;  3HWI A;  2A2K A;  2UZQ A;  3FNJ A;  2JTR A;  2DCQ A;  1YML A;  2IFV A;  1YT8 A;  1CWT A;  3F4A A;  2EG3 A;  1GN0 A;  1YM9 A;  2FSX A;  3ICS A;  3R2U A;  1WHB A;  3NHV A;  3O3W A;  3FS5 A;  1WV9 A;  1BOH A;  1QXN A;  4F67 A;  1RHD A;  1H4K X;  1YMD A;  1TQ1 A;  1HZM A;  3FLH A;  5HPA A;  2GWF A;  3IPP A;  1T3K A;  1ORB A;  2JTS A;  2EG4 B;  3NT6 A;  1C25 A;  2OUC A;  1UAR A;  1QB0 A;  3HIX A;  2VSW A;  3D1P A;  5HBQ A;  1H4M X;  1VEE A;  3ICR A;  3IPO A;  2MOL A;  2HHG A;  1DP2 A;  2JTQ A;  3I2V A;  4WH9 A;  2J6P A;  3P3A A;  2Q82 A;  3K9R A;  5LAM A;  3TG3 A;  1CWS A;  3AAY A;  3TP9 A;  2IFD A;  2MRM A;  5LAO A;  2KL3 A;  1YS0 A;  5HBP A;  3OP3 A; 
#chains in the Genus database with same CATH homology
 1CWR A;  1BOI A;  4WH7 A;  1E0C A;  3AAX A;  3G5J A;  5HBO A;  2WLX A;  4OCG A;  3HZU A;  1GMX A;  3FOJ A;  2ORA A;  1RHS A;  2WLR A;  3ICT A;  3NTD A;  1OKG A;  3I3U A;  3OLH A;  3TG1 B;  2EG4 A;  1URH A;  3GK5 A;  3IWH A;  5HBL A;  1YMK A;  2K0Z A;  3ILM A;  2MOI A;  3UTN X;  3MZZ A;  4JGT A;  3NTA A;  3HWI A;  2A2K A;  2UZQ A;  3FNJ A;  2JTR A;  2DCQ A;  1YML A;  2IFV A;  1YT8 A;  1CWT A;  3F4A A;  2EG3 A;  1GN0 A;  1YM9 A;  2FSX A;  3ICS A;  3R2U A;  1WHB A;  3NHV A;  3O3W A;  3FS5 A;  1WV9 A;  1BOH A;  1QXN A;  4F67 A;  1RHD A;  1H4K X;  1YMD A;  1TQ1 A;  1HZM A;  3FLH A;  5HPA A;  2GWF A;  3IPP A;  1T3K A;  1ORB A;  2JTS A;  2EG4 B;  3NT6 A;  1C25 A;  2OUC A;  1UAR A;  1QB0 A;  3HIX A;  2VSW A;  3D1P A;  5HBQ A;  1H4M X;  1VEE A;  3ICR A;  3IPO A;  2MOL A;  2HHG A;  1DP2 A;  2JTQ A;  3I2V A;  4WH9 A;  2J6P A;  3P3A A;  3K9R A;  5LAM A;  3TG3 A;  1CWS A;  3AAY A;  3TP9 A;  2IFD A;  2MRM A;  5LAO A;  2KL3 A;  1YS0 A;  5HBP A;  3OP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...