3NTDA

Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c531s mutant
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
565
structure length
565
Chain Sequence
b'MKKILIIGGVAGGASAAARARRLSETAEIIMFERGEYVSFANCGLPYHISGEIAQRSALVLQTPESFKARFNVEVRVKHEVVAIDRAAKLVTVRRLLDGSEYQESYDTLLLSPGAAPIVPPIPGVDNPLTHSLRNIPDMDRILQTIQMNNVEHATVVGGGFIGLEMMESLHHLGIKTTLLELADQVMTPVDREMAGFAHQAIRDQGVDLRLGTALSEVSYQVQTHVASDAAGEDTAHQHIKGHLSLTLSNGELLETDLLIMAIGVRPETQLARDAGLAIGELGGIKVNAMMQTSDPAIYAVGDAVEEQDFVTGQACLVPLAGPANRQGRMAADNMFGREERYQGTQGTAICKVFDLAVGATGKNEKQLKQAGIAFEKVYVHTASHASYYPGAEVVSFKLLFDPVKGTIFGAQAVGKDGIDKRIDVMAVAQRAGMTVEQLQHLELSYAPPYGSAKDVINQAAFVASNIIKGDATPIHFDQIDNLSEDQLLLDVRNPGELQNGGLEGAVNIPVDELRDRMHELPKDKEIIIFSQVGLRGNVAYRQLVNNGYRARNLIGGYRTYKFAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FAD-dependent pyridine nucleotide-disulphide oxidoreductase
publication title Characterization of an NADH-Dependent Persulfide Reductase from Shewanella loihica PV-4: Implications for the Mechanism of Sulfur Respiration via FAD-Dependent Enzymes .
pubmed doi rcsb
source organism Shewanella loihica
molecule tags Oxidoreductase
total genus 184
structure length 565
sequence length 565
chains with identical sequence B
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2010-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3ntdA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ntdA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ntdA01
3P1WA 2XVFA 1ZMDA 4H4QA 4IVOB 4EQXA 4NZHA 1EL7A 3DJEA 3DK9A 3UKQA 2PYXA 2QCUA 2Z5XA 3DGHA 4IA6A 4ADWA 1S3BA 3NK2X 1KSSA 1OKGA 5L46A 2EQ7A 1Q9IA 2J3NA 4H4ZA 1DODA 1QLBA 1D4DA 4U8NA 4IV9A 3NGCX 1L9CA 3AE6A 2IVEA 3KVEA 3SFEA 2GR0A 1C25A 3BI5A 5EB4A 3QSSA 5IQ1A 1NHRA 4B66A 1YQ3A 4K5SA 4GUVA 1E0CA 1XDIA 4EM4A 2YG4A 2WOIA 2YG7A 1ZKQA 3L8KA 2WESA 4APNA 2DKIA 3AWIA 1K0JA 1TDEA 2QA1A 3UOVA 3AEGA 5HBLA 2A89A 1GNDA 4OCGA 1GEUA 2C75A 3UP4A 3NTAA 3CGCA 3F8PA 3F8DA 1IJHA 4B64A 4BK1A 2YLRA 3IF9A 3PO7A 1DOEA 1RYIA 4OVIA 4UDQA 3M0OA 3CNSA 2XLSA 3REDA 3UTGA 3K30A 5KOXA 2Z5YA 2JB2A 3AEAA 3AE2A 2C70A 1DNCA 4H7UA 3QSMA 1FEBA 4H4UA 5CKUA 3HZUA 3DK8A 4UDRA 5EOWA 4BK2A 5FMHA 1F8WA 2R46A 3FMWA 1TDKA 4YTNA 1D4EA 2FJDA 3UCLA 3GSIA 1YKJA 1YY5A 1GMXA 5U63A 3AYLA 1O95A 2Q0LA 2GEWA 4ZCCA 4A5LA 3GD3A 3UKPA 4AOSA 1RHDA 1CJ3A 1L9DA 1B37A 1PJ5A 2WOWA 1IUUA 2BXRA 4REKA 4YXDA 5BVAA 3UKLA 1GPEA 2JK6A 1GESA 2R9ZA 2X3NA 3LB8A 3OLHA 2YWLA 2R0GA 4TM4A 4O5UA 4U2TA 1ZOVA 1H7XA 2WP5A 5FS7A 3ICTA 2XDOA 1ZDLA 1BZLA 4P9SA 4U8MA 4OPCA 2WDRA 1NHQA 2O9ZA 4TLZA 1CC2A 3RNMA 1V59A 3AE1A 1ELIA 3P4PA 1GRFA 1H82A 5JCIA 1W4XA 5KVHA 3F4AA 3NYFA 2Y6RA 1B4VA 2GAGB 4J57A 2E4GA 3WE0A 2DKHA 2YG5A 4C74A 2WOVA 2B7SA 3NIXA 2GQWA 4Z26A 2B9YA 1CWRA 4GRTA 3SM8A 3ABVA 3CNDA 3LOVA 4GF7A 2BACA 3KA7A 1QB0A 3NN0X 4BURA 1N4VA 5IQ4A 1GERA 2VQ7A 5ER0A 1BGJA 5FS9A 1URHA 2AR8A 2GB0A 2GR2A 2QA2A 3KPFA 2VOUA 4K8DA 4A65A 2V5ZA 3H8LA 3BI4A 4H50A 3AE5A 3CPIG 2JKCA 2R0PA 3DJDA 2CVJA 2WDQA 3HZLA 3KD9A 1IUTA 1E39A 3UKFA 4EM3A 2XCGA 1Y56B 2BCPA 4GDEA 3CGBA 3P4RA 2WQYA 2BYBA 4JNQA 1KNRA 2BK5A 1E1NA 1GRHA 1Q1WA 1M64A 2XVHA 3AEBA 2JB1A 2R45A 5M0ZA 1RP0A 1B8SA 1K0IA 2YG6A 1N4WA 2RGHA 1BOHA 2NVKX 2CULA 3NYCA 5JCNA 5M10A 5CQFA 3EPTA 4X9NA 3HIXA 3GDNA 2WLRA 3AYIA 2WLXA 2XFPA 4Z2TA 1JNZA 3KLJA 2XYOA 1O5WA 3B3RA 4H4XA 1QXNA 3DMEA 4FK1A 3IPOA 2GV8A 2YG3A 2PHHA 3LZXA 3O3WA 4XWZA 1EL5A 2UZZA 2YR6A 3VR9A 1LVLA 4B65A 1OJAA 2GMJA 5KXJA 4KPRA 3IWAA 1S3EA 2V6OA 1ZOYA 2A8XA 3D8XA 4JY2A 3K7MX 1GRGA 3NNEA 4DGKA 5HBPA 4H2NA 4Z2UA 3QFBA 2Y6QA 3OC4A 2FJEA 3S5WA 4KX6A 1CWSA 3HWIA 4C77A 1TDNA 1E1LA 3AD7B 2ZZBA 4OPTA 3AE3A 4H4YA 4J56A 3DK4A 3QFAA 1XHCA 1E6EA 1CBOA 3L1RA 4WH9A 4U8PA 2YVJA 1NHPA 4M52A 1QJDA 1GOSA 3NK0X 1XANA 2X8GA 4CY6A 2RABA 2VVLA 1KFYA 1YS0A 4Y4NA 3RP8A 1N1PA 3CNPA 3I6DA 2B9XA 4Z25A 3RHAA 4DNAA 3KU9A 1PHHA 5U1OA 1DP2A 1PBDA 3K7TA 4PABA 5HBQA 2WHDA 4NEVA 4O5QA 2BS2A 2C76A 3EANA 2WEUA 4H4WA 1H6VA 2UZQA 3GWFA 3GRTA 2DCQA 1D5TA 1PBBA 4H2RA 4JN9A 1TDFA 4YTPA 3AD8B 4B1BA 4CCRA 3QVRA 5BUKA 5C3JA 2BCGG 3G5JA 3FBSA 5LAMA 2HQMA 1B5QA 3NLCA 2C66A 2GR1A 2C3DA 4CBQA 4IA5A 2JAEA 1H83A 4NTEA 4J33A 3LZWA 2VZ2A 2YQUA 1CL0A 3TP9A 2CFYA 3IPPA 4BK3A 4K2XA 1VEEA 2JTRA 3ALLA 2IIDA 2XFQA 3ALJA 2GVCA 2MOIA 3UP5A 1GT8A 2GMHA 4JNAA 1JRZA 2BS3A 4X9MA 2YM2A 4OPGA 3M12A 2YLWA 4EQSA 4MJWA 2EQ6A 1WHBA 3PVCA 1ZX9A 2AQJA 2VSWA 3IHMA 3GMBA 4J2WA 3G5QA 1F3PA 3G5RA 4J34A 1CC4A 3GD4A 4JQ9A 2C73A 4CRTA 1KNPA 3G5SA 2WS3A 4H4PA 4U2SA 5BRTA 2R0CA 4OPLA 3AXBA 3D1CA 2X8CA 2EG3A 3LJPA 1TRBA 1S2QA 1TDOA 2B7RA 2EQ8A 4JY3A 1S2YA 4NEWA 2WP6A 1K0LA 2V61A 2WDVA 2FJBA 4Z24A 3QVPA 1D4CA 5J60A 3DJGX 3II4A 3UTHA 3VRBA 1GXFA 2OA1A 1JRYA 3CN8A 3Q6JA 5C2TA 2YM1A 2FSXA 4EMJA 1CJ4A 2FBWA 2XVEA 3DJJA 2YLXA 1PDHA 1ZP0A 3K7QX 4D04A 3O0HA 4DSGA 1PJ6A 4WX1A 2K0ZA 4CY8A 4JDRA 5HXIA 3AE8A 1DOCA 1EBDA 4Z2RA 4H4VA 1NAAA 1XPQA 3AD9B 4Y4MA 3V76A 1LQTA 3ICRA 4C5OA 2V3BA 2A87A 1GN0A 1H84A 1PN0A 1PXBA 3LADA 5EB5A 3S61A 1KSUA 4U8KA 1GSNA 1YT8A 1CJCA 2OLNA 4B67A 5HBOA 2X50A 1BF3A 2VRMA 3P3AA 4H2PA 1YM9A 1MXTA 4HA6A 1TYTA 4C3YA 4TM0A 5J7XA 1H86A 3UOYA 2GAHB 3UKKA 2F5ZA 2JB3A 2IFVA 4ICYA 1CC6A 3IC9A 4U8LA 1H4MX 1WV9A 1YMLA 2BXSA 3AEFA 4A6NB 4HB9A 3QSEA 4IVMB 1D7YA 4EIPA 5JCMA 3Q9TA 3V3NA 2R4JA 2BK4A 1GREA 1VG9A 4N9XA 5JCLA 1CHUA 1E1KA 3CPJG 1TYPA 5KVIA 1LQUA 3BI2A 2TMDA 3ATQA 3FIMB 1DOBA 3ICSA 2W0HA 3GK5A 3KKJA 2BS4A 4GCMA 3TG3A 3FPZA 4H2QA 4UDPA 1KF6A 3UTEA 1ONFA 3GDPA 2YVFA 5TR3A 3BNMA 1H4KX 1L9EA 1SEZA 3UOXA 4I59A 4C3XA 3F8RA 3BHFA 3FNJA 3CPHG 1VG0A 3CTYA 1JEHA 3IHGA 3UTNX 4UP3A 1PBEA 1P2EA 4A9WA 4B63A 1MO9A 4GDPA 2H88A 2GWFA 2BC0A 1YMKA 2OAMA 4I58A 4U2LA 3UKHA 2XLPA 3R2UA 1DJQA 1OJ9A 2RGOA 4H4SA 1JOAA 4E0VA 1CJ2A 1PXAA 4PAAA 4A6NA 2YLTA 1ZK7A 1REOA 2OLOA 3ALMA 3OP3A 3CGDA 2VVMA 2XFOA 1F6MA 1HYUA 2WETA 4USQA 3VRAA 1FOHA 3QJ4A 1COYA 2ACZA 3ISHA 1P2HA 3UKAA 4ECHA 1LV0A 1YQZA 3COXA 4EQRA 3M13A 4J31A 3NT6A 2ORAA 1NG3A 4GR1A 3UOZA 3BHKA 2GH5A 3I2VA 5BULA 3CNJA 3TG1B 3GMCA 4TM3A 4EIQA 3NKSA 2GQFA 3BNUA 2MOLA 1AOGA 3LXDA 2BK3A 2OUCA 4BV6A 1O94A 1BOIA 1Z6LA 1PXCA 4LA1A 3VRDB 1M6IA 2YR5A 4JGTA 4OPUA 3ATRA 4XXGA 4YKGA 2GF3A 2ARDA 1BWCA 1LJ1A 1IUXA 2C65A 4YKFA 4EMWA 1IUWA 2KL3A 2I0ZA 4A79A 3AEEA 2GRTA 1IUSA 4TLXA 2Q0KA 2QAEA 5HHFA 1YMDA 5LAOA 1NG4A 2H89A 3OZ2A 2V3AA 2BABA 1NHSA 4K22A 5HPAA 3RP6A 1F8SA 2FJAA 4CNJA 2B9WA 1ORBA 4YSHA 4ZN0A 5HYMA 1E1MA 3AAYA 4B68A 2APGA 3P4SA 1FL2A 3AB1A 3E1TA 3FG2P 2WU5A 1L0VA 1GALA 1RHSA 2E1MA 2WBAA 3AE9A 2VVLG 4YTMA 4CCQA 2C7GA 3ZDNA 2B76A 2JTSA 3R9UA 3DH9A 1FEAA 2YLZA 4EMIA 3RP7A 2CDUA 1H7WA 4YSYA 3AYJA 4ZCDA 2R4EA 1UARA 2J6PA 2YAUA 4U8IA 4TM1A 2WP9A 3NYEA 5IPYA 4WCTA 3T37A 5JCKA 3V3OA 1GRBA 1K4QA 2Q7VA 3B6DA 3AEDA 4Z43A 2C67A 2WPCA 5DBJA 5EBKA 2YVGA 1OJTA 1OJDA 2WPEA 4WH7A 2BC1A 3ADAB 3ITJA 1CWTA 2AAQA 3AE7A 1H81A 3NRNA 4U8OA 2X99A 2IVDA 1D7LA 1JNRA 2XLUA 2Q6UA 4H4RA 3H8IA 3ZYXA 4K7ZA 5HY5A 3P4QA 2WU2A 4BJZA 1BGNA 4OPIA 1T3KA 1Q1RA 2E5VA 1NPXA 2XVJA 4FK1C 1MOKA 3NH3X 4Z44A 4OPDA 2NPXA 1VRQB 1E7PA 2VRLA 3NN6X 2JTQA 4X4JA 2TPRA 3CNTA 5GRTA 3P9UA 2C64A 4YSZA 2XFUA 4Y4LA 2EG4B 1DXLA 1EL9A 1NENA 3GYJA 4USRA 3GRSA 1QO8A 2RGJA 1GRAA 2YLSA 2XVIA 4NTDA 1LTXR 3NTDA 3NHOX 4U8JA 4BJYA 3K9RA 1NEKA 4EQWA 2ZBWA 1DJNA 3AECA 2HHGA 1ZMCA 3MZZA 1LPFA 4FDCB 1PBCA 3FS5A 3I3LA 5U25A 4CNKA 1VQWA 3CGEA 2BA9A 4J36A 3SGLA 1TQ1A 3VR8A 3IWHA 4B69A 4FX9A 1KDGA 1GETA 3H4KA 3UTFA 1YQ4A 4RSLA 2A2KA 3NG7X 3NK1X 3URHA 2XFNA 1ZY8A 4AOXA 3D1PA 2JBVA 1GTEA 1RSGA 2WPFA 2YR4A 3DGZA 5KOWA 3SFDA 4D03A 3FLHA 1OJCA 1PS9A 2GR3A 3C96A 1FCDA 3EAOA 3CIRA 4LU6A 5KRQA 1PJ7A 1HZMA 1GTHA 1N4UA 3JSKA 1BKWA 3AE4A 4AP1A 2VQBA 2XLTA 2EG4A 4YT0A 3SQPA 1PBFA 3DA1A 3C4AA 4AT2A 1Y0PA 1CF3A 1FECA 1JRXA 2V60A 1JU2A 5LV9A 2EQ9A 1X31B 2C3CA 5KWFA 2ZZCA 2IFDA 4AP3A 4YSXA 3GWDA 3NHVA 2ZZ0A 4LIIA 1NDAA 4K5RA 3AAXA 1F8RA 1EL8A 1Y56A 4H4TA 1IUVA 4AT0A 2OALA 3C4NA 2C72A 1UKVG 3ILMA 3FOJA 2MRMA 2XLRA 5GSNA 3VQRA 4RG4A 4A99A 1VDCA 4F67A 3I3UA 5FS8A 1GRTA 2X8HA 3GYIA 4A7AA 3EF6A 4YWOA 3PS9A 4RG3A 4DSHA 5FS6A 1GV4A 4XWRA 4NTCA
chains in the Genus database with same CATH superfamily
3P1WA 2XVFA 1ZMDA 4H4QA 4IVOB 4EQXA 4NZHA 1EL7A 3DJEA 4G73A 3DK9A 3UKQA 2PYXA 2QCUA 2Z5XA 3DGHA 4IA6A 4ADWA 1S3BA 3NK2X 1KSSA 1OKGA 5L46A 2EQ7A 1Q9IA 2J3NA 4H4ZA 1DODA 1QLBA 1D4DA 4U8NA 2BRAA 4IV9A 3NGCX 1L9CA 3AE6A 2IVEA 3KVEA 3SFEA 2GR0A 1C25A 3BI5A 5EB4A 3QSSA 5IQ1A 1NHRA 4B66A 1YQ3A 4K5SA 4GUVA 1E0CA 1XDIA 4EM4A 2YG4A 2WOIA 2YG7A 1ZKQA 3L8KA 2WESA 4APNA 2DKIA 3AWIA 1K0JA 1TDEA 2QA1A 3UOVA 3AEGA 5HBLA 2A89A 1GNDA 4OCGA 1GEUA 2C75A 3UP4A 3NTAA 3CGCA 3F8PA 3F8DA 1IJHA 4B64A 4BK1A 2YLRA 3IF9A 3PO7A 1DOEA 1RYIA 4OVIA 4UDQA 3M0OA 4G6GA 3CNSA 2XLSA 3REDA 3UTGA 3K30A 5KOXA 2Z5YA 2JB2A 3AEAA 3AE2A 2C70A 1DNCA 3HYWA 4H7UA 3QSMA 1FEBA 4H4UA 5CKUA 3HZUA 3DK8A 4UDRA 5EOWA 4BK2A 5FMHA 1F8WA 2R46A 3FMWA 1TDKA 4NNJA 4YTNA 1D4EA 2FJDA 3UCLA 3GSIA 3T0KA 1YKJA 1YY5A 1GMXA 5U63A 3AYLA 1O95A 2Q0LA 2GEWA 4ZCCA 4A5LA 3GD3A 3UKPA 4AOSA 1RHDA 1CJ3A 1L9DA 1B37A 1PJ5A 2WOWA 1IUUA 2BXRA 4REKA 4YXDA 5BVAA 3UKLA 1GPEA 2JK6A 1GESA 2R9ZA 2X3NA 3LB8A 3OLHA 2YWLA 2R0GA 4TM4A 4O5UA 4U2TA 1ZOVA 1H7XA 2WP5A 5FS7A 3ICTA 2XDOA 1ZDLA 1BZLA 5KMSA 4P9SA 4U8MA 4OPCA 2WDRA 5KNLA 1NHQA 2O9ZA 4TLZA 1CC2A 3RNMA 1V59A 3AE1A 1ELIA 3P4PA 1GRFA 1H82A 5JCIA 1W4XA 5KVHA 3F4AA 3NYFA 2Y6RA 1B4VA 2GAGB 4J57A 2E4GA 3WE0A 2DKHA 2YG5A 4C74A 2WOVA 2B7SA 3NIXA 2GQWA 4Z26A 2B9YA 1CWRA 4GRTA 3SM8A 3ABVA 3CNDA 3LOVA 4GF7A 2BACA 3KA7A 1QB0A 2Q82A 3NN0X 4BURA 1N4VA 5IQ4A 1GERA 2VQ7A 5ER0A 1BGJA 5FS9A 1URHA 2AR8A 2GB0A 2GR2A 2QA2A 3KPFA 2VOUA 4K8DA 4A65A 2V5ZA 3H8LA 3BI4A 4H50A 3AE5A 3CPIG 2JKCA 2R0PA 3DJDA 2CVJA 2WDQA 3HZLA 3KD9A 1IUTA 1E39A 3UKFA 4EM3A 2XCGA 1Y56B 2BCPA 4GDEA 3CGBA 3P4RA 2WQYA 2BYBA 4JNQA 1KNRA 2BK5A 1E1NA 1GRHA 1Q1WA 1M64A 2XVHA 3AEBA 2JB1A 2R45A 5M0ZA 1RP0A 1B8SA 1K0IA 2YG6A 1N4WA 2BRYA 1BOHA 2NVKX 2CULA 2RGHA 3NYCA 5JCNA 5M10A 5CQFA 3EPTA 4X9NA 3HIXA 3GDNA 2WLRA 3AYIA 2WLXA 2XFPA 4Z2TA 1JNZA 3KLJA 2XYOA 1O5WA 3B3RA 4H4XA 1QXNA 3DMEA 4FK1A 3IPOA 2GV8A 2YG3A 3SXIA 2PHHA 3LZXA 3O3WA 4XWZA 1EL5A 2UZZA 2YR6A 3SYIA 3VR9A 1LVLA 4B65A 1OJAA 2GMJA 5KXJA 4KPRA 3IWAA 1S3EA 2V6OA 1ZOYA 2A8XA 3D8XA 4JY2A 3K7MX 1GRGA 3NNEA 4DGKA 5HBPA 4H2NA 4Z2UA 3QFBA 2Y6QA 3OC4A 2FJEA 3S5WA 4KX6A 1CWSA 3HWIA 4C77A 3SZFA 1TDNA 1E1LA 3AD7B 2ZZBA 4OPTA 3AE3A 4H4YA 5KMPA 4J56A 3DK4A 3QFAA 1XHCA 1E6EA 1CBOA 3L1RA 4WH9A 4U8PA 2YVJA 1NHPA 4M52A 1QJDA 1GOSA 3NK0X 1XANA 2X8GA 4CY6A 2RABA 2VVLA 1KFYA 5KMQA 1YS0A 4Y4NA 3RP8A 1N1PA 3CNPA 3T31A 3I6DA 2B9XA 4Z25A 3RHAA 4DNAA 3KU9A 1PHHA 5U1OA 1DP2A 1PBDA 3K7TA 4PABA 5HBQA 4NWZA 2WHDA 4NEVA 4O5QA 2BS2A 2C76A 3EANA 2WEUA 4H4WA 1H6VA 2UZQA 3GWFA 3GRTA 2DCQA 1D5TA 1PBBA 4H2RA 4JN9A 1TDFA 4YTPA 3AD8B 4B1BA 4CCRA 3QVRA 5BUKA 5C3JA 2BCGG 3G5JA 3FBSA 5LAMA 2HQMA 1B5QA 3NLCA 2C66A 2GR1A 2C3DA 4CBQA 4IA5A 2JAEA 1H83A 4G74A 4NTEA 4J33A 3LZWA 2VZ2A 2YQUA 1CL0A 3TP9A 2CFYA 3IPPA 4BK3A 4K2XA 1VEEA 2JTRA 3ALLA 2IIDA 2XFQA 2C4CA 3ALJA 2GVCA 2MOIA 3UP5A 1GT8A 2GMHA 4JNAA 1JRZA 2BS3A 4G6HA 2YM2A 4X9MA 4OPGA 3M12A 2YLWA 4EQSA 4MJWA 2EQ6A 1WHBA 3PVCA 1ZX9A 2AQJA 2VSWA 3IHMA 3GMBA 4J2WA 3G5QA 1F3PA 3G5RA 4J34A 1CC4A 3GD4A 4JQ9A 2C73A 4CRTA 1KNPA 3G5SA 2WS3A 4H4PA 4U2SA 5BRTA 2R0CA 4OPLA 3AXBA 3D1CA 2X8CA 2EG3A 3LJPA 1TRBA 1S2QA 1TDOA 2B7RA 2EQ8A 4JY3A 1S2YA 4NEWA 2WP6A 1K0LA 2V61A 2WDVA 2FJBA 4Z24A 3QVPA 1D4CA 5J60A 3DJGX 3II4A 3UTHA 3VRBA 1GXFA 2OA1A 1JRYA 3CN8A 3Q6JA 5C2TA 2YM1A 2FSXA 4EMJA 1CJ4A 2FBWA 2XVEA 3DJJA 2YLXA 1PDHA 1ZP0A 3K7QX 4D04A 3O0HA 3SY4A 4DSGA 1PJ6A 4WX1A 2K0ZA 4CY8A 4JDRA 5HXIA 3AE8A 1DOCA 1EBDA 4Z2RA 4H4VA 1NAAA 1XPQA 3AD9B 4Y4MA 3V76A 1LQTA 3ICRA 4C5OA 2V3BA 2A87A 1GN0A 1H84A 4G9KA 1PN0A 1PXBA 3LADA 5EB5A 3S61A 1KSUA 4U8KA 1GSNA 1YT8A 1CJCA 2OLNA 4B67A 5HBOA 2X50A 1BF3A 2VRMA 3P3AA 4H2PA 1YM9A 1MXTA 4HA6A 1TYTA 4C3YA 4TM0A 5J7XA 1H86A 3UOYA 2GAHB 3UKKA 2F5ZA 2JB3A 2IFVA 4ICYA 1CC6A 3IC9A 4U8LA 1H4MX 1WV9A 1YMLA 2BXSA 3AEFA 4A6NB 4HB9A 3QSEA 4IVMB 1D7YA 4EIPA 5JCMA 3Q9TA 3V3NA 2R4JA 2BK4A 1GREA 1VG9A 4N9XA 5JCLA 1CHUA 1E1KA 3CPJG 1TYPA 5KVIA 1LQUA 3BI2A 2TMDA 3ATQA 3FIMB 1DOBA 3ICSA 2W0HA 3GK5A 3KKJA 2BS4A 4GCMA 3TG3A 3FPZA 4H2QA 4UDPA 1KF6A 3UTEA 1ONFA 3GDPA 2YVFA 5TR3A 3BNMA 1H4KX 1L9EA 1SEZA 3UOXA 4I59A 3KPKA 4C3XA 3F8RA 3BHFA 3FNJA 3CPHG 1VG0A 3CTYA 1JEHA 3IHGA 3UTNX 4UP3A 1PBEA 1P2EA 4A9WA 4B63A 1MO9A 4GDPA 2H88A 2GWFA 2BC0A 1YMKA 2OAMA 4I58A 4U2LA 3UKHA 2XLPA 3R2UA 1DJQA 1OJ9A 2RGOA 4H4SA 1JOAA 4E0VA 1CJ2A 1PXAA 4PAAA 4A6NA 2YLTA 1ZK7A 1REOA 2OLOA 3ALMA 3OP3A 3CGDA 2VVMA 2XFOA 1F6MA 1HYUA 2WETA 4USQA 3VRAA 1FOHA 3QJ4A 4II2A 1COYA 2ACZA 3GYXA 3ISHA 1P2HA 3UKAA 4ECHA 1LV0A 1YQZA 3COXA 4EQRA 3M13A 4J31A 3NT6A 2ORAA 1NG3A 4GR1A 3UOZA 3BHKA 2GH5A 3I2VA 5BULA 3CNJA 3TG1B 3GMCA 4TM3A 4EIQA 3HYVA 3NKSA 2GQFA 3BNUA 2MOLA 1AOGA 3LXDA 2BK3A 2OUCA 4BV6A 1O94A 1BOIA 1Z6LA 1PXCA 4LA1A 3VRDB 1M6IA 2YR5A 4JGTA 4OPUA 3ATRA 4GAVA 4XXGA 4YKGA 2GF3A 2ARDA 1BWCA 1LJ1A 1IUXA 2C65A 4YKFA 4EMWA 1IUWA 2KL3A 3HYXA 2I0ZA 4A79A 3AEEA 2GRTA 4GAPA 1IUSA 4TLXA 2Q0KA 2QAEA 5HHFA 1YMDA 5LAOA 1NG4A 2H89A 3OZ2A 2V3AA 3SZ0A 2BABA 1NHSA 4K22A 5HPAA 3RP6A 1F8SA 2FJAA 4CNJA 2B9WA 1ORBA 4YSHA 4ZN0A 5HYMA 1E1MA 3AAYA 4B68A 2APGA 3P4SA 1FL2A 3AB1A 3E1TA 3FG2P 2WU5A 1L0VA 1GALA 1RHSA 2E1MA 2WBAA 3AE9A 2VVLG 4YTMA 4CCQA 2C7GA 3ZDNA 2B76A 2JTSA 3R9UA 3DH9A 1FEAA 2YLZA 4EMIA 3RP7A 2CDUA 1H7WA 4YSYA 3SX6A 3AYJA 4ZCDA 2R4EA 1UARA 2J6PA 2YAUA 4U8IA 4TM1A 2WP9A 3NYEA 5IPYA 4WCTA 3T37A 5JCKA 3V3OA 1GRBA 1K4QA 2Q7VA 3B6DA 3AEDA 4Z43A 2C67A 2WPCA 5DBJA 5EBKA 2YVGA 1OJTA 1OJDA 2WPEA 4WH7A 2BC1A 3ADAB 3ITJA 1CWTA 2AAQA 3AE7A 1H81A 3NRNA 4U8OA 2X99A 2IVDA 1D7LA 1JNRA 2XLUA 2Q6UA 4H4RA 3H8IA 3ZYXA 4K7ZA 5HY5A 3P4QA 2WU2A 3T14A 1BGNA 4BJZA 4OPIA 1T3KA 1Q1RA 2E5VA 1NPXA 2XVJA 4FK1C 1MOKA 3NH3X 4Z44A 4OPDA 2NPXA 1VRQB 1E7PA 2VRLA 3NN6X 2JTQA 4X4JA 2TPRA 3CNTA 5GRTA 3P9UA 2C64A 4YSZA 2XFUA 4Y4LA 2EG4B 1DXLA 1EL9A 1NENA 3GYJA 4USRA 3GRSA 1QO8A 2RGJA 1GRAA 2YLSA 2XVIA 4NTDA 1LTXR 3NTDA 3NHOX 4U8JA 4BJYA 3K9RA 1NEKA 4EQWA 2ZBWA 1DJNA 3AECA 2HHGA 3T2YA 1ZMCA 3MZZA 1LPFA 4FDCB 1PBCA 3FS5A 3I3LA 5U25A 4CNKA 4II3A 1VQWA 3CGEA 2BA9A 4J36A 3SGLA 1TQ1A 3VR8A 3IWHA 4B69A 4FX9A 1KDGA 1GETA 3H4KA 3SZCA 1YQ4A 4RSLA 3T2KA 3UTFA 2A2KA 3NG7X 3NK1X 3URHA 2XFNA 1ZY8A 4AOXA 3D1PA 2JBVA 1GTEA 1RSGA 2WPFA 2YR4A 3DGZA 5KOWA 5KMRA 3SFDA 4D03A 3FLHA 1OJCA 1PS9A 2GR3A 3C96A 1FCDA 3EAOA 3CIRA 4LU6A 5KRQA 1PJ7A 1HZMA 3CMMA 1GTHA 1N4UA 3JSKA 1BKWA 3AE4A 4AP1A 2VQBA 2XLTA 2EG4A 4YT0A 3SQPA 1PBFA 3DA1A 3C4AA 4AT2A 1Y0PA 1CF3A 1FECA 1JRXA 2V60A 1JU2A 5LV9A 2EQ9A 1X31B 2C3CA 3T2ZA 5KWFA 2ZZCA 2IFDA 4AP3A 4YSXA 3GWDA 3NHVA 2ZZ0A 4LIIA 1NDAA 3SZWA 4K5RA 3AAXA 1F8RA 1EL8A 1Y56A 4H4TA 1IUVA 4AT0A 2OALA 3C4NA 2C72A 1UKVG 3ILMA 3FOJA 2MRMA 2XLRA 5GSNA 3VQRA 4RG4A 4A99A 1VDCA 4F67A 3I3UA 5FS8A 1GRTA 2X8HA 3GYIA 4A7AA 3EF6A 4YWOA 3PS9A 4RG3A 4DSHA 5FS6A 1GV4A 4XWRA 4NTCA
chains in the Genus database with same CATH topology
3P1WA 2XVFA 1ZMDA 4H4QA 4IVOB 4EQXA 4NZHA 1EL7A 3DJEA 4G73A 3DK9A 3UKQA 2PYXA 2QCUA 2Z5XA 3DGHA 4IA6A 4ADWA 1S3BA 3NK2X 1KSSA 1OKGA 5L46A 2EQ7A 1Q9IA 2J3NA 4H4ZA 1DODA 1QLBA 1D4DA 4U8NA 2BRAA 4IV9A 3NGCX 1L9CA 3AE6A 2IVEA 3KVEA 3SFEA 2GR0A 1C25A 3BI5A 5EB4A 3QSSA 5IQ1A 1NHRA 4B66A 1YQ3A 4K5SA 4GUVA 1E0CA 1XDIA 4EM4A 2YG4A 2WOIA 2YG7A 1ZKQA 3L8KA 2WESA 4APNA 2DKIA 3AWIA 1K0JA 1TDEA 2QA1A 3UOVA 3AEGA 5HBLA 2A89A 1GNDA 4OCGA 1GEUA 2C75A 3UP4A 3NTAA 3CGCA 3F8PA 3F8DA 1IJHA 4B64A 4BK1A 2YLRA 3IF9A 3PO7A 1DOEA 1RYIA 4OVIA 4UDQA 3M0OA 4G6GA 3CNSA 2XLSA 3REDA 3UTGA 3K30A 5KOXA 2Z5YA 2JB2A 3AEAA 3AE2A 2C70A 1DNCA 3HYWA 4H7UA 3QSMA 1FEBA 4H4UA 5CKUA 3HZUA 3DK8A 4UDRA 5EOWA 4BK2A 5FMHA 1F8WA 2R46A 3FMWA 1TDKA 4NNJA 4YTNA 1D4EA 2FJDA 3UCLA 3GSIA 3T0KA 1YKJA 1YY5A 1GMXA 5U63A 3AYLA 1O95A 2Q0LA 2GEWA 4ZCCA 4A5LA 3GD3A 3UKPA 4AOSA 1RHDA 1CJ3A 1L9DA 1B37A 1PJ5A 2WOWA 1IUUA 2BXRA 4REKA 4YXDA 5BVAA 3UKLA 1GPEA 2JK6A 1GESA 2R9ZA 2X3NA 3LB8A 3OLHA 2YWLA 2R0GA 4TM4A 4O5UA 4U2TA 1ZOVA 1H7XA 2WP5A 5FS7A 3ICTA 2XDOA 1ZDLA 1BZLA 5KMSA 4P9SA 4U8MA 4OPCA 2WDRA 5KNLA 1NHQA 2O9ZA 4TLZA 1CC2A 3RNMA 1V59A 3AE1A 1ELIA 3P4PA 1GRFA 1H82A 5JCIA 1W4XA 5KVHA 3F4AA 3NYFA 2Y6RA 1B4VA 2GAGB 4J57A 2E4GA 3WE0A 2DKHA 2YG5A 4C74A 2WOVA 2B7SA 3NIXA 2GQWA 4Z26A 2B9YA 1CWRA 4GRTA 3SM8A 3ABVA 3CNDA 3LOVA 4GF7A 2BACA 3KA7A 1QB0A 3NN0X 4BURA 1N4VA 5IQ4A 1GERA 2VQ7A 5ER0A 1BGJA 5FS9A 1URHA 2AR8A 2GB0A 2GR2A 2QA2A 3KPFA 2VOUA 4K8DA 4A65A 2V5ZA 3H8LA 3BI4A 4H50A 3AE5A 3CPIG 2JKCA 2R0PA 3DJDA 2CVJA 2WDQA 3HZLA 3KD9A 1IUTA 1E39A 3UKFA 4EM3A 2XCGA 1Y56B 2BCPA 4GDEA 3CGBA 3P4RA 2WQYA 2BYBA 4JNQA 1KNRA 2BK5A 1E1NA 1GRHA 1Q1WA 1M64A 2XVHA 3AEBA 2JB1A 2R45A 5M0ZA 1RP0A 1B8SA 1K0IA 2YG6A 1N4WA 2BRYA 1BOHA 2NVKX 2CULA 2RGHA 3NYCA 5JCNA 5M10A 5CQFA 3EPTA 4X9NA 3HIXA 3GDNA 2WLRA 3AYIA 2WLXA 2XFPA 4Z2TA 1JNZA 3KLJA 2XYOA 1O5WA 3B3RA 4H4XA 1QXNA 3DMEA 4FK1A 3IPOA 2GV8A 2YG3A 3SXIA 2PHHA 3LZXA 3O3WA 4XWZA 1EL5A 2UZZA 2YR6A 3SYIA 3VR9A 1LVLA 4B65A 1OJAA 2GMJA 5KXJA 4KPRA 3IWAA 1S3EA 2V6OA 1ZOYA 2A8XA 3D8XA 4JY2A 3K7MX 1GRGA 3NNEA 4DGKA 5HBPA 4H2NA 4Z2UA 3QFBA 2Y6QA 3OC4A 2FJEA 3S5WA 4KX6A 1CWSA 3HWIA 4C77A 3SZFA 1TDNA 1E1LA 3AD7B 2ZZBA 4OPTA 3AE3A 4H4YA 5KMPA 4J56A 3DK4A 3QFAA 1XHCA 1E6EA 1CBOA 3L1RA 4WH9A 4U8PA 2YVJA 1NHPA 4M52A 1QJDA 1GOSA 3NK0X 1XANA 2X8GA 4CY6A 2RABA 2VVLA 1KFYA 5KMQA 1YS0A 4Y4NA 3RP8A 1N1PA 3CNPA 3T31A 3I6DA 2B9XA 4Z25A 3RHAA 4DNAA 3KU9A 1PHHA 5U1OA 1DP2A 1PBDA 3K7TA 4PABA 5HBQA 4NWZA 2WHDA 4NEVA 4O5QA 2BS2A 2C76A 3EANA 2WEUA 4H4WA 1H6VA 2UZQA 3GWFA 3GRTA 2DCQA 1D5TA 1PBBA 4H2RA 4JN9A 1TDFA 4YTPA 3AD8B 4B1BA 4CCRA 3QVRA 5BUKA 5C3JA 2BCGG 3G5JA 3FBSA 5LAMA 2HQMA 1B5QA 3NLCA 2C66A 2GR1A 2C3DA 4CBQA 4IA5A 2JAEA 1H83A 4G74A 4NTEA 4J33A 3LZWA 2VZ2A 2YQUA 1CL0A 3TP9A 2CFYA 3IPPA 4BK3A 4K2XA 1VEEA 2JTRA 3ALLA 2IIDA 2XFQA 2C4CA 3ALJA 2GVCA 2MOIA 3UP5A 1GT8A 2GMHA 4JNAA 1JRZA 2BS3A 4G6HA 2YM2A 4X9MA 4OPGA 3M12A 2YLWA 4EQSA 4MJWA 2EQ6A 1WHBA 3PVCA 1ZX9A 2AQJA 2VSWA 3IHMA 3GMBA 4J2WA 3G5QA 1F3PA 3G5RA 4J34A 1CC4A 3GD4A 4JQ9A 2C73A 4CRTA 1KNPA 3G5SA 2WS3A 4H4PA 4U2SA 5BRTA 2R0CA 4OPLA 3AXBA 3D1CA 2X8CA 2EG3A 3LJPA 1TRBA 1S2QA 1TDOA 2B7RA 2EQ8A 4JY3A 1S2YA 4NEWA 2WP6A 1K0LA 2V61A 2WDVA 2FJBA 4Z24A 3QVPA 1D4CA 5J60A 3DJGX 3II4A 3UTHA 3VRBA 1GXFA 2OA1A 1JRYA 3CN8A 3Q6JA 5C2TA 2YM1A 2FSXA 4EMJA 1CJ4A 2FBWA 2XVEA 3DJJA 2YLXA 1PDHA 1ZP0A 3K7QX 4D04A 3O0HA 3SY4A 4DSGA 1PJ6A 4WX1A 2K0ZA 4CY8A 4JDRA 5HXIA 3AE8A 1DOCA 1EBDA 4Z2RA 4H4VA 1NAAA 1XPQA 3AD9B 4Y4MA 3V76A 1LQTA 3ICRA 4C5OA 2V3BA 2A87A 1GN0A 1H84A 4G9KA 1PN0A 1PXBA 3LADA 5EB5A 3S61A 1KSUA 4U8KA 1GSNA 1YT8A 1CJCA 2OLNA 4B67A 5HBOA 2X50A 1BF3A 2VRMA 3P3AA 4H2PA 1YM9A 1MXTA 4HA6A 1TYTA 4C3YA 4TM0A 5J7XA 1H86A 3UOYA 2GAHB 3UKKA 2F5ZA 2JB3A 2IFVA 4ICYA 1CC6A 3IC9A 4U8LA 1H4MX 1WV9A 1YMLA 2BXSA 3AEFA 4A6NB 4HB9A 3QSEA 4IVMB 1D7YA 4EIPA 5JCMA 3Q9TA 3V3NA 2R4JA 2BK4A 1GREA 1VG9A 4N9XA 5JCLA 1CHUA 1E1KA 3CPJG 1TYPA 5KVIA 1LQUA 3BI2A 2TMDA 3ATQA 3FIMB 1DOBA 3ICSA 2W0HA 3GK5A 3KKJA 2BS4A 4GCMA 3TG3A 3FPZA 4H2QA 4UDPA 1KF6A 3UTEA 1ONFA 3GDPA 2YVFA 5TR3A 3BNMA 1H4KX 1L9EA 1SEZA 3UOXA 4I59A 3KPKA 4C3XA 3F8RA 3BHFA 3FNJA 3CPHG 1VG0A 3CTYA 1JEHA 3IHGA 3UTNX 4UP3A 1PBEA 1P2EA 4A9WA 4B63A 1MO9A 4GDPA 2H88A 2GWFA 2BC0A 1YMKA 2OAMA 4I58A 4U2LA 3UKHA 2XLPA 3R2UA 1DJQA 1OJ9A 2RGOA 4H4SA 1JOAA 4E0VA 1CJ2A 1PXAA 4PAAA 4A6NA 2YLTA 1ZK7A 1REOA 2OLOA 3ALMA 3OP3A 3CGDA 2VVMA 2XFOA 1F6MA 1HYUA 2WETA 4USQA 3VRAA 1FOHA 3QJ4A 4II2A 1COYA 2ACZA 3GYXA 3ISHA 1P2HA 3UKAA 4ECHA 1LV0A 1YQZA 3COXA 4EQRA 3M13A 4J31A 3NT6A 2ORAA 1NG3A 4GR1A 3UOZA 3BHKA 2GH5A 3I2VA 5BULA 3CNJA 3TG1B 3GMCA 4TM3A 4EIQA 3HYVA 3NKSA 2GQFA 3BNUA 2MOLA 1AOGA 3LXDA 2BK3A 2OUCA 4BV6A 1O94A 1BOIA 1Z6LA 1PXCA 4LA1A 3VRDB 1M6IA 2YR5A 4JGTA 4OPUA 3ATRA 4GAVA 4XXGA 4YKGA 2GF3A 2ARDA 1BWCA 1LJ1A 1IUXA 2C65A 4YKFA 4EMWA 1IUWA 2KL3A 3HYXA 2I0ZA 4A79A 3AEEA 2GRTA 4GAPA 1IUSA 4TLXA 2Q0KA 2QAEA 5HHFA 1YMDA 5LAOA 1NG4A 2H89A 3OZ2A 2V3AA 3SZ0A 2BABA 1NHSA 4K22A 5HPAA 3RP6A 1F8SA 2FJAA 4CNJA 2B9WA 1ORBA 4YSHA 4ZN0A 5HYMA 1E1MA 3AAYA 4B68A 2APGA 3P4SA 1FL2A 3AB1A 3E1TA 3FG2P 2WU5A 1L0VA 1GALA 1RHSA 2E1MA 2WBAA 3AE9A 2VVLG 4YTMA 4CCQA 2C7GA 3ZDNA 2B76A 2JTSA 3R9UA 3DH9A 1FEAA 2YLZA 4EMIA 3RP7A 2CDUA 1H7WA 4YSYA 3SX6A 3AYJA 4ZCDA 2R4EA 1UARA 2J6PA 2YAUA 4U8IA 4TM1A 2WP9A 3NYEA 5IPYA 4WCTA 3T37A 5JCKA 3V3OA 1GRBA 1K4QA 2Q7VA 3B6DA 3AEDA 4Z43A 2C67A 2WPCA 5DBJA 5EBKA 2YVGA 1OJTA 1OJDA 2WPEA 4WH7A 2BC1A 3ADAB 3ITJA 1CWTA 2AAQA 3AE7A 1H81A 3NRNA 4U8OA 2X99A 2IVDA 1D7LA 1JNRA 2XLUA 2Q6UA 4H4RA 3H8IA 3ZYXA 4K7ZA 5HY5A 3P4QA 2WU2A 3T14A 1BGNA 4BJZA 4OPIA 1T3KA 1Q1RA 2E5VA 1NPXA 2XVJA 4FK1C 1MOKA 3NH3X 4Z44A 4OPDA 2NPXA 1VRQB 1E7PA 2VRLA 3NN6X 2JTQA 4X4JA 2TPRA 3CNTA 5GRTA 3P9UA 2C64A 4YSZA 2XFUA 4Y4LA 2EG4B 1DXLA 1EL9A 1NENA 3GYJA 4USRA 3GRSA 1QO8A 2RGJA 1GRAA 2YLSA 2XVIA 4NTDA 1LTXR 3NTDA 3NHOX 4U8JA 4BJYA 3K9RA 1NEKA 4EQWA 2ZBWA 1DJNA 3AECA 2HHGA 3T2YA 1ZMCA 3MZZA 1LPFA 4FDCB 1PBCA 3FS5A 3I3LA 5U25A 4CNKA 4II3A 1VQWA 3CGEA 2BA9A 4J36A 3SGLA 1TQ1A 3VR8A 3IWHA 4B69A 4FX9A 1KDGA 1GETA 3H4KA 3SZCA 1YQ4A 4RSLA 3T2KA 3UTFA 2A2KA 3NG7X 3NK1X 3URHA 2XFNA 1ZY8A 4AOXA 3D1PA 2JBVA 1GTEA 1RSGA 2WPFA 2YR4A 3DGZA 5KOWA 5KMRA 3SFDA 4D03A 3FLHA 1OJCA 1PS9A 2GR3A 3C96A 1FCDA 3EAOA 3CIRA 4LU6A 5KRQA 1PJ7A 1HZMA 3CMMA 1GTHA 1N4UA 3JSKA 1BKWA 3AE4A 4AP1A 2VQBA 2XLTA 2EG4A 4YT0A 3SQPA 1PBFA 3DA1A 3C4AA 4AT2A 1Y0PA 1CF3A 1FECA 1JRXA 2V60A 1JU2A 5LV9A 2EQ9A 1X31B 2C3CA 3T2ZA 5KWFA 2ZZCA 2IFDA 4AP3A 4YSXA 3GWDA 3NHVA 2ZZ0A 4LIIA 1NDAA 3SZWA 4K5RA 3AAXA 1F8RA 1EL8A 1Y56A 4H4TA 1IUVA 4AT0A 2OALA 3C4NA 2C72A 1UKVG 3ILMA 3FOJA 2MRMA 2XLRA 5GSNA 3VQRA 4RG4A 4A99A 1VDCA 4F67A 3I3UA 5FS8A 1GRTA 2X8HA 3GYIA 4A7AA 3EF6A 4YWOA 3PS9A 4RG3A 4DSHA 5FS6A 1GV4A 4XWRA 4NTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1W A;  2XVF A;  1ZMD A;  4H4Q A;  4IVO B;  4EQX A;  4NZH A;  1EL7 A;  3DJE A;  3DK9 A;  3UKQ A;  2PYX A;  2QCU A;  2Z5X A;  3DGH A;  4IA6 A;  4ADW A;  1S3B A;  3NK2 X;  1KSS A;  1OKG A;  5L46 A;  2EQ7 A;  1Q9I A;  2J3N A;  4H4Z A;  1DOD A;  1QLB A;  1D4D A;  4U8N A;  4IV9 A;  3NGC X;  1L9C A;  3AE6 A;  2IVE A;  3KVE A;  3SFE A;  2GR0 A;  1C25 A;  3BI5 A;  5EB4 A;  3QSS A;  5IQ1 A;  1NHR A;  4B66 A;  1YQ3 A;  4K5S A;  4GUV A;  1E0C A;  1XDI A;  4EM4 A;  2YG4 A;  2WOI A;  2YG7 A;  1ZKQ A;  3L8K A;  2WES A;  4APN A;  2DKI A;  3AWI A;  1K0J A;  1TDE A;  2QA1 A;  3UOV A;  3AEG A;  5HBL A;  2A89 A;  1GND A;  4OCG A;  1GEU A;  2C75 A;  3UP4 A;  3NTA A;  3CGC A;  3F8P A;  3F8D A;  1IJH A;  4B64 A;  4BK1 A;  2YLR A;  3IF9 A;  3PO7 A;  1DOE A;  1RYI A;  4OVI A;  4UDQ A;  3M0O A;  3CNS A;  2XLS A;  3RED A;  3UTG A;  3K30 A;  5KOX A;  2Z5Y A;  2JB2 A;  3AEA A;  3AE2 A;  2C70 A;  1DNC A;  4H7U A;  3QSM A;  1FEB A;  4H4U A;  5CKU A;  3HZU A;  3DK8 A;  4UDR A;  5EOW A;  4BK2 A;  5FMH A;  1F8W A;  2R46 A;  3FMW A;  1TDK A;  4YTN A;  1D4E A;  2FJD A;  3UCL A;  3GSI A;  1YKJ A;  1YY5 A;  1GMX A;  5U63 A;  3AYL A;  1O95 A;  2Q0L A;  2GEW A;  4ZCC A;  4A5L A;  3GD3 A;  3UKP A;  4AOS A;  1RHD A;  1CJ3 A;  1L9D A;  1B37 A;  1PJ5 A;  2WOW A;  1IUU A;  2BXR A;  4REK A;  4YXD A;  5BVA A;  3UKL A;  1GPE A;  2JK6 A;  1GES A;  2R9Z A;  2X3N A;  3LB8 A;  3OLH A;  2YWL A;  2R0G A;  4TM4 A;  4O5U A;  4U2T A;  1ZOV A;  1H7X A;  2WP5 A;  5FS7 A;  3ICT A;  2XDO A;  1ZDL A;  1BZL A;  4P9S A;  4U8M A;  4OPC A;  2WDR A;  1NHQ A;  2O9Z A;  4TLZ A;  1CC2 A;  3RNM A;  1V59 A;  3AE1 A;  1ELI A;  3P4P A;  1GRF A;  1H82 A;  5JCI A;  1W4X A;  5KVH A;  3F4A A;  3NYF A;  2Y6R A;  1B4V A;  2GAG B;  4J57 A;  2E4G A;  3WE0 A;  2DKH A;  2YG5 A;  4C74 A;  2WOV A;  2B7S A;  3NIX A;  2GQW A;  4Z26 A;  2B9Y A;  1CWR A;  4GRT A;  3SM8 A;  3ABV A;  3CND A;  3LOV A;  4GF7 A;  2BAC A;  3KA7 A;  1QB0 A;  3NN0 X;  4BUR A;  1N4V A;  5IQ4 A;  1GER A;  2VQ7 A;  5ER0 A;  1BGJ A;  5FS9 A;  1URH A;  2AR8 A;  2GB0 A;  2GR2 A;  2QA2 A;  3KPF A;  2VOU A;  4K8D A;  4A65 A;  2V5Z A;  3H8L A;  3BI4 A;  4H50 A;  3AE5 A;  3CPI G;  2JKC A;  2R0P A;  3DJD A;  2CVJ A;  2WDQ A;  3HZL A;  3KD9 A;  1IUT A;  1E39 A;  3UKF A;  4EM3 A;  2XCG A;  1Y56 B;  2BCP A;  4GDE A;  3CGB A;  3P4R A;  2WQY A;  2BYB A;  4JNQ A;  1KNR A;  2BK5 A;  1E1N A;  1GRH A;  1Q1W A;  1M64 A;  2XVH A;  3AEB A;  2JB1 A;  2R45 A;  5M0Z A;  1RP0 A;  1B8S A;  1K0I A;  2YG6 A;  1N4W A;  2RGH A;  1BOH A;  2NVK X;  2CUL A;  3NYC A;  5JCN A;  5M10 A;  5CQF A;  3EPT A;  4X9N A;  3HIX A;  3GDN A;  2WLR A;  3AYI A;  2WLX A;  2XFP A;  4Z2T A;  1JNZ A;  3KLJ A;  2XYO A;  1O5W A;  3B3R A;  4H4X A;  1QXN A;  3DME A;  4FK1 A;  3IPO A;  2GV8 A;  2YG3 A;  2PHH A;  3LZX A;  3O3W A;  4XWZ A;  1EL5 A;  2UZZ A;  2YR6 A;  3VR9 A;  1LVL A;  4B65 A;  1OJA A;  2GMJ A;  5KXJ A;  4KPR A;  3IWA A;  1S3E A;  2V6O A;  1ZOY A;  2A8X A;  3D8X A;  4JY2 A;  3K7M X;  1GRG A;  3NNE A;  4DGK A;  5HBP A;  4H2N A;  4Z2U A;  3QFB A;  2Y6Q A;  3OC4 A;  2FJE A;  3S5W A;  4KX6 A;  1CWS A;  3HWI A;  4C77 A;  1TDN A;  1E1L A;  3AD7 B;  2ZZB A;  4OPT A;  3AE3 A;  4H4Y A;  4J56 A;  3DK4 A;  3QFA A;  1XHC A;  1E6E A;  1CBO A;  3L1R A;  4WH9 A;  4U8P A;  2YVJ A;  1NHP A;  4M52 A;  1QJD A;  1GOS A;  3NK0 X;  1XAN A;  2X8G A;  4CY6 A;  2RAB A;  2VVL A;  1KFY A;  1YS0 A;  4Y4N A;  3RP8 A;  1N1P A;  3CNP A;  3I6D A;  2B9X A;  4Z25 A;  3RHA A;  4DNA A;  3KU9 A;  1PHH A;  5U1O A;  1DP2 A;  1PBD A;  3K7T A;  4PAB A;  5HBQ A;  2WHD A;  4NEV A;  4O5Q A;  2BS2 A;  2C76 A;  3EAN A;  2WEU A;  4H4W A;  1H6V A;  2UZQ A;  3GWF A;  3GRT A;  2DCQ A;  1D5T A;  1PBB A;  4H2R A;  4JN9 A;  1TDF A;  4YTP A;  3AD8 B;  4B1B A;  4CCR A;  3QVR A;  5BUK A;  5C3J A;  2BCG G;  3G5J A;  3FBS A;  5LAM A;  2HQM A;  1B5Q A;  3NLC A;  2C66 A;  2GR1 A;  2C3D A;  4CBQ A;  4IA5 A;  2JAE A;  1H83 A;  4NTE A;  4J33 A;  3LZW A;  2VZ2 A;  2YQU A;  1CL0 A;  3TP9 A;  2CFY A;  3IPP A;  4BK3 A;  4K2X A;  1VEE A;  2JTR A;  3ALL A;  2IID A;  2XFQ A;  3ALJ A;  2GVC A;  2MOI A;  3UP5 A;  1GT8 A;  2GMH A;  4JNA A;  1JRZ A;  2BS3 A;  4X9M A;  2YM2 A;  4OPG A;  3M12 A;  2YLW A;  4EQS A;  4MJW A;  2EQ6 A;  1WHB A;  3PVC A;  1ZX9 A;  2AQJ A;  2VSW A;  3IHM A;  3GMB A;  4J2W A;  3G5Q A;  1F3P A;  3G5R A;  4J34 A;  1CC4 A;  3GD4 A;  4JQ9 A;  2C73 A;  4CRT A;  1KNP A;  3G5S A;  2WS3 A;  4H4P A;  4U2S A;  5BRT A;  2R0C A;  4OPL A;  3AXB A;  3D1C A;  2X8C A;  2EG3 A;  3LJP A;  1TRB A;  1S2Q A;  1TDO A;  2B7R A;  2EQ8 A;  4JY3 A;  1S2Y A;  4NEW A;  2WP6 A;  1K0L A;  2V61 A;  2WDV A;  2FJB A;  4Z24 A;  3QVP A;  1D4C A;  5J60 A;  3DJG X;  3II4 A;  3UTH A;  3VRB A;  1GXF A;  2OA1 A;  1JRY A;  3CN8 A;  3Q6J A;  5C2T A;  2YM1 A;  2FSX A;  4EMJ A;  1CJ4 A;  2FBW A;  2XVE A;  3DJJ A;  2YLX A;  1PDH A;  1ZP0 A;  3K7Q X;  4D04 A;  3O0H A;  4DSG A;  1PJ6 A;  4WX1 A;  2K0Z A;  4CY8 A;  4JDR A;  5HXI A;  3AE8 A;  1DOC A;  1EBD A;  4Z2R A;  4H4V A;  1NAA A;  1XPQ A;  3AD9 B;  4Y4M A;  3V76 A;  1LQT A;  3ICR A;  4C5O A;  2V3B A;  2A87 A;  1GN0 A;  1H84 A;  1PN0 A;  1PXB A;  3LAD A;  5EB5 A;  3S61 A;  1KSU A;  4U8K A;  1GSN A;  1YT8 A;  1CJC A;  2OLN A;  4B67 A;  5HBO A;  2X50 A;  1BF3 A;  2VRM A;  3P3A A;  4H2P A;  1YM9 A;  1MXT A;  4HA6 A;  1TYT A;  4C3Y A;  4TM0 A;  5J7X A;  1H86 A;  3UOY A;  2GAH B;  3UKK A;  2F5Z A;  2JB3 A;  2IFV A;  4ICY A;  1CC6 A;  3IC9 A;  4U8L A;  1H4M X;  1WV9 A;  1YML A;  2BXS A;  3AEF A;  4A6N B;  4HB9 A;  3QSE A;  4IVM B;  1D7Y A;  4EIP A;  5JCM A;  3Q9T A;  3V3N A;  2R4J A;  2BK4 A;  1GRE A;  1VG9 A;  4N9X A;  5JCL A;  1CHU A;  1E1K A;  3CPJ G;  1TYP A;  5KVI A;  1LQU A;  3BI2 A;  2TMD A;  3ATQ A;  3FIM B;  1DOB A;  3ICS A;  2W0H A;  3GK5 A;  3KKJ A;  2BS4 A;  4GCM A;  3TG3 A;  3FPZ A;  4H2Q A;  4UDP A;  1KF6 A;  3UTE A;  1ONF A;  3GDP A;  2YVF A;  5TR3 A;  3BNM A;  1H4K X;  1L9E A;  1SEZ A;  3UOX A;  4I59 A;  4C3X A;  3F8R A;  3BHF A;  3FNJ A;  3CPH G;  1VG0 A;  3CTY A;  1JEH A;  3IHG A;  3UTN X;  4UP3 A;  1PBE A;  1P2E A;  4A9W A;  4B63 A;  1MO9 A;  4GDP A;  2H88 A;  2GWF A;  2BC0 A;  1YMK A;  2OAM A;  4I58 A;  4U2L A;  3UKH A;  2XLP A;  3R2U A;  1DJQ A;  1OJ9 A;  2RGO A;  4H4S A;  1JOA A;  4E0V A;  1CJ2 A;  1PXA A;  4PAA A;  4A6N A;  2YLT A;  1ZK7 A;  1REO A;  2OLO A;  3ALM A;  3OP3 A;  3CGD A;  2VVM A;  2XFO A;  1F6M A;  1HYU A;  2WET A;  4USQ A;  3VRA A;  1FOH A;  3QJ4 A;  1COY A;  2ACZ A;  3ISH A;  1P2H A;  3UKA A;  4ECH A;  1LV0 A;  1YQZ A;  3COX A;  4EQR A;  3M13 A;  4J31 A;  3NT6 A;  2ORA A;  1NG3 A;  4GR1 A;  3UOZ A;  3BHK A;  2GH5 A;  3I2V A;  5BUL A;  3CNJ A;  3TG1 B;  3GMC A;  4TM3 A;  4EIQ A;  3NKS A;  2GQF A;  3BNU A;  2MOL A;  1AOG A;  3LXD A;  2BK3 A;  2OUC A;  4BV6 A;  1O94 A;  1BOI A;  1Z6L A;  1PXC A;  4LA1 A;  3VRD B;  1M6I A;  2YR5 A;  4JGT A;  4OPU A;  3ATR A;  4XXG A;  4YKG A;  2GF3 A;  2ARD A;  1BWC A;  1LJ1 A;  1IUX A;  2C65 A;  4YKF A;  4EMW A;  1IUW A;  2KL3 A;  2I0Z A;  4A79 A;  3AEE A;  2GRT A;  1IUS A;  4TLX A;  2Q0K A;  2QAE A;  5HHF A;  1YMD A;  5LAO A;  1NG4 A;  2H89 A;  3OZ2 A;  2V3A A;  2BAB A;  1NHS A;  4K22 A;  5HPA A;  3RP6 A;  1F8S A;  2FJA A;  4CNJ A;  2B9W A;  1ORB A;  4YSH A;  4ZN0 A;  5HYM A;  1E1M A;  3AAY A;  4B68 A;  2APG A;  3P4S A;  1FL2 A;  3AB1 A;  3E1T A;  3FG2 P;  2WU5 A;  1L0V A;  1GAL A;  1RHS A;  2E1M A;  2WBA A;  3AE9 A;  2VVL G;  4YTM A;  4CCQ A;  2C7G A;  3ZDN A;  2B76 A;  2JTS A;  3R9U A;  3DH9 A;  1FEA A;  2YLZ A;  4EMI A;  3RP7 A;  2CDU A;  1H7W A;  4YSY A;  3AYJ A;  4ZCD A;  2R4E A;  1UAR A;  2J6P A;  2YAU A;  4U8I A;  4TM1 A;  2WP9 A;  3NYE A;  5IPY A;  4WCT A;  3T37 A;  5JCK A;  3V3O A;  1GRB A;  1K4Q A;  2Q7V A;  3B6D A;  3AED A;  4Z43 A;  2C67 A;  2WPC A;  5DBJ A;  5EBK A;  2YVG A;  1OJT A;  1OJD A;  2WPE A;  4WH7 A;  2BC1 A;  3ADA B;  3ITJ A;  1CWT A;  2AAQ A;  3AE7 A;  1H81 A;  3NRN A;  4U8O A;  2X99 A;  2IVD A;  1D7L A;  1JNR A;  2XLU A;  2Q6U A;  4H4R A;  3H8I A;  3ZYX A;  4K7Z A;  5HY5 A;  3P4Q A;  2WU2 A;  4BJZ A;  1BGN A;  4OPI A;  1T3K A;  1Q1R A;  2E5V A;  1NPX A;  2XVJ A;  4FK1 C;  1MOK A;  3NH3 X;  4Z44 A;  4OPD A;  2NPX A;  1VRQ B;  1E7P A;  2VRL A;  3NN6 X;  2JTQ A;  4X4J A;  2TPR A;  3CNT A;  5GRT A;  3P9U A;  2C64 A;  4YSZ A;  2XFU A;  4Y4L A;  2EG4 B;  1DXL A;  1EL9 A;  1NEN A;  3GYJ A;  4USR A;  3GRS A;  1QO8 A;  2RGJ A;  1GRA A;  2YLS A;  2XVI A;  4NTD A;  1LTX R;  3NTD A;  3NHO X;  4U8J A;  4BJY A;  3K9R A;  1NEK A;  4EQW A;  2ZBW A;  1DJN A;  3AEC A;  2HHG A;  1ZMC A;  3MZZ A;  1LPF A;  4FDC B;  1PBC A;  3FS5 A;  3I3L A;  5U25 A;  4CNK A;  1VQW A;  3CGE A;  2BA9 A;  4J36 A;  3SGL A;  1TQ1 A;  3VR8 A;  3IWH A;  4B69 A;  4FX9 A;  1KDG A;  1GET A;  3H4K A;  3UTF A;  1YQ4 A;  4RSL A;  2A2K A;  3NG7 X;  3NK1 X;  3URH A;  2XFN A;  1ZY8 A;  4AOX A;  3D1P A;  2JBV A;  1GTE A;  1RSG A;  2WPF A;  2YR4 A;  3DGZ A;  5KOW A;  3SFD A;  4D03 A;  3FLH A;  1OJC A;  1PS9 A;  2GR3 A;  3C96 A;  1FCD A;  3EAO A;  3CIR A;  4LU6 A;  5KRQ A;  1PJ7 A;  1HZM A;  1GTH A;  1N4U A;  3JSK A;  1BKW A;  3AE4 A;  4AP1 A;  2VQB A;  2XLT A;  2EG4 A;  4YT0 A;  3SQP A;  1PBF A;  3DA1 A;  3C4A A;  4AT2 A;  1Y0P A;  1CF3 A;  1FEC A;  1JRX A;  2V60 A;  1JU2 A;  5LV9 A;  2EQ9 A;  1X31 B;  2C3C A;  5KWF A;  2ZZC A;  2IFD A;  4AP3 A;  4YSX A;  3GWD A;  3NHV A;  2ZZ0 A;  4LII A;  1NDA A;  4K5R A;  3AAX A;  1F8R A;  1EL8 A;  1Y56 A;  4H4T A;  1IUV A;  4AT0 A;  2OAL A;  3C4N A;  2C72 A;  1UKV G;  3ILM A;  3FOJ A;  2MRM A;  2XLR A;  5GSN A;  3VQR A;  4RG4 A;  4A99 A;  1VDC A;  4F67 A;  3I3U A;  5FS8 A;  1GRT A;  2X8H A;  3GYI A;  4A7A A;  3EF6 A;  4YWO A;  3PS9 A;  4RG3 A;  4DSH A;  5FS6 A;  1GV4 A;  4XWR A;  4NTC A; 
#chains in the Genus database with same CATH topology
 3P1W A;  2XVF A;  1ZMD A;  4H4Q A;  4IVO B;  4EQX A;  4NZH A;  1EL7 A;  3DJE A;  4G73 A;  3DK9 A;  3UKQ A;  2PYX A;  2QCU A;  2Z5X A;  3DGH A;  4IA6 A;  4ADW A;  1S3B A;  3NK2 X;  1KSS A;  1OKG A;  5L46 A;  2EQ7 A;  1Q9I A;  2J3N A;  4H4Z A;  1DOD A;  1QLB A;  1D4D A;  4U8N A;  2BRA A;  4IV9 A;  3NGC X;  1L9C A;  3AE6 A;  2IVE A;  3KVE A;  3SFE A;  2GR0 A;  1C25 A;  3BI5 A;  5EB4 A;  3QSS A;  5IQ1 A;  1NHR A;  4B66 A;  1YQ3 A;  4K5S A;  4GUV A;  1E0C A;  1XDI A;  4EM4 A;  2YG4 A;  2WOI A;  2YG7 A;  1ZKQ A;  3L8K A;  2WES A;  4APN A;  2DKI A;  3AWI A;  1K0J A;  1TDE A;  2QA1 A;  3UOV A;  3AEG A;  5HBL A;  2A89 A;  1GND A;  4OCG A;  1GEU A;  2C75 A;  3UP4 A;  3NTA A;  3CGC A;  3F8P A;  3F8D A;  1IJH A;  4B64 A;  4BK1 A;  2YLR A;  3IF9 A;  3PO7 A;  1DOE A;  1RYI A;  4OVI A;  4UDQ A;  3M0O A;  4G6G A;  3CNS A;  2XLS A;  3RED A;  3UTG A;  3K30 A;  5KOX A;  2Z5Y A;  2JB2 A;  3AEA A;  3AE2 A;  2C70 A;  1DNC A;  3HYW A;  4H7U A;  3QSM A;  1FEB A;  4H4U A;  5CKU A;  3HZU A;  3DK8 A;  4UDR A;  5EOW A;  4BK2 A;  5FMH A;  1F8W A;  2R46 A;  3FMW A;  1TDK A;  4NNJ A;  4YTN A;  1D4E A;  2FJD A;  3UCL A;  3GSI A;  3T0K A;  1YKJ A;  1YY5 A;  1GMX A;  5U63 A;  3AYL A;  1O95 A;  2Q0L A;  2GEW A;  4ZCC A;  4A5L A;  3GD3 A;  3UKP A;  4AOS A;  1RHD A;  1CJ3 A;  1L9D A;  1B37 A;  1PJ5 A;  2WOW A;  1IUU A;  2BXR A;  4REK A;  4YXD A;  5BVA A;  3UKL A;  1GPE A;  2JK6 A;  1GES A;  2R9Z A;  2X3N A;  3LB8 A;  3OLH A;  2YWL A;  2R0G A;  4TM4 A;  4O5U A;  4U2T A;  1ZOV A;  1H7X A;  2WP5 A;  5FS7 A;  3ICT A;  2XDO A;  1ZDL A;  1BZL A;  5KMS A;  4P9S A;  4U8M A;  4OPC A;  2WDR A;  5KNL A;  1NHQ A;  2O9Z A;  4TLZ A;  1CC2 A;  3RNM A;  1V59 A;  3AE1 A;  1ELI A;  3P4P A;  1GRF A;  1H82 A;  5JCI A;  1W4X A;  5KVH A;  3F4A A;  3NYF A;  2Y6R A;  1B4V A;  2GAG B;  4J57 A;  2E4G A;  3WE0 A;  2DKH A;  2YG5 A;  4C74 A;  2WOV A;  2B7S A;  3NIX A;  2GQW A;  4Z26 A;  2B9Y A;  1CWR A;  4GRT A;  3SM8 A;  3ABV A;  3CND A;  3LOV A;  4GF7 A;  2BAC A;  3KA7 A;  1QB0 A;  2Q82 A;  3NN0 X;  4BUR A;  1N4V A;  5IQ4 A;  1GER A;  2VQ7 A;  5ER0 A;  1BGJ A;  5FS9 A;  1URH A;  2AR8 A;  2GB0 A;  2GR2 A;  2QA2 A;  3KPF A;  2VOU A;  4K8D A;  4A65 A;  2V5Z A;  3H8L A;  3BI4 A;  4H50 A;  3AE5 A;  3CPI G;  2JKC A;  2R0P A;  3DJD A;  2CVJ A;  2WDQ A;  3HZL A;  3KD9 A;  1IUT A;  1E39 A;  3UKF A;  4EM3 A;  2XCG A;  1Y56 B;  2BCP A;  4GDE A;  3CGB A;  3P4R A;  2WQY A;  2BYB A;  4JNQ A;  1KNR A;  2BK5 A;  1E1N A;  1GRH A;  1Q1W A;  1M64 A;  2XVH A;  3AEB A;  2JB1 A;  2R45 A;  5M0Z A;  1RP0 A;  1B8S A;  1K0I A;  2YG6 A;  1N4W A;  2BRY A;  1BOH A;  2NVK X;  2CUL A;  2RGH A;  3NYC A;  5JCN A;  5M10 A;  5CQF A;  3EPT A;  4X9N A;  3HIX A;  3GDN A;  2WLR A;  3AYI A;  2WLX A;  2XFP A;  4Z2T A;  1JNZ A;  3KLJ A;  2XYO A;  1O5W A;  3B3R A;  4H4X A;  1QXN A;  3DME A;  4FK1 A;  3IPO A;  2GV8 A;  2YG3 A;  3SXI A;  2PHH A;  3LZX A;  3O3W A;  4XWZ A;  1EL5 A;  2UZZ A;  2YR6 A;  3SYI A;  3VR9 A;  1LVL A;  4B65 A;  1OJA A;  2GMJ A;  5KXJ A;  4KPR A;  3IWA A;  1S3E A;  2V6O A;  1ZOY A;  2A8X A;  3D8X A;  4JY2 A;  3K7M X;  1GRG A;  3NNE A;  4DGK A;  5HBP A;  4H2N A;  4Z2U A;  3QFB A;  2Y6Q A;  3OC4 A;  2FJE A;  3S5W A;  4KX6 A;  1CWS A;  3HWI A;  4C77 A;  3SZF A;  1TDN A;  1E1L A;  3AD7 B;  2ZZB A;  4OPT A;  3AE3 A;  4H4Y A;  5KMP A;  4J56 A;  3DK4 A;  3QFA A;  1XHC A;  1E6E A;  1CBO A;  3L1R A;  4WH9 A;  4U8P A;  2YVJ A;  1NHP A;  4M52 A;  1QJD A;  1GOS A;  3NK0 X;  1XAN A;  2X8G A;  4CY6 A;  2RAB A;  2VVL A;  1KFY A;  5KMQ A;  1YS0 A;  4Y4N A;  3RP8 A;  1N1P A;  3CNP A;  3T31 A;  3I6D A;  2B9X A;  4Z25 A;  3RHA A;  4DNA A;  3KU9 A;  1PHH A;  5U1O A;  1DP2 A;  1PBD A;  3K7T A;  4PAB A;  5HBQ A;  4NWZ A;  2WHD A;  4NEV A;  4O5Q A;  2BS2 A;  2C76 A;  3EAN A;  2WEU A;  4H4W A;  1H6V A;  2UZQ A;  3GWF A;  3GRT A;  2DCQ A;  1D5T A;  1PBB A;  4H2R A;  4JN9 A;  1TDF A;  4YTP A;  3AD8 B;  4B1B A;  4CCR A;  3QVR A;  5BUK A;  5C3J A;  2BCG G;  3G5J A;  3FBS A;  5LAM A;  2HQM A;  1B5Q A;  3NLC A;  2C66 A;  2GR1 A;  2C3D A;  4CBQ A;  4IA5 A;  2JAE A;  1H83 A;  4G74 A;  4NTE A;  4J33 A;  3LZW A;  2VZ2 A;  2YQU A;  1CL0 A;  3TP9 A;  2CFY A;  3IPP A;  4BK3 A;  4K2X A;  1VEE A;  2JTR A;  3ALL A;  2IID A;  2XFQ A;  2C4C A;  3ALJ A;  2GVC A;  2MOI A;  3UP5 A;  1GT8 A;  2GMH A;  4JNA A;  1JRZ A;  2BS3 A;  4G6H A;  2YM2 A;  4X9M A;  4OPG A;  3M12 A;  2YLW A;  4EQS A;  4MJW A;  2EQ6 A;  1WHB A;  3PVC A;  1ZX9 A;  2AQJ A;  2VSW A;  3IHM A;  3GMB A;  4J2W A;  3G5Q A;  1F3P A;  3G5R A;  4J34 A;  1CC4 A;  3GD4 A;  4JQ9 A;  2C73 A;  4CRT A;  1KNP A;  3G5S A;  2WS3 A;  4H4P A;  4U2S A;  5BRT A;  2R0C A;  4OPL A;  3AXB A;  3D1C A;  2X8C A;  2EG3 A;  3LJP A;  1TRB A;  1S2Q A;  1TDO A;  2B7R A;  2EQ8 A;  4JY3 A;  1S2Y A;  4NEW A;  2WP6 A;  1K0L A;  2V61 A;  2WDV A;  2FJB A;  4Z24 A;  3QVP A;  1D4C A;  5J60 A;  3DJG X;  3II4 A;  3UTH A;  3VRB A;  1GXF A;  2OA1 A;  1JRY A;  3CN8 A;  3Q6J A;  5C2T A;  2YM1 A;  2FSX A;  4EMJ A;  1CJ4 A;  2FBW A;  2XVE A;  3DJJ A;  2YLX A;  1PDH A;  1ZP0 A;  3K7Q X;  4D04 A;  3O0H A;  3SY4 A;  4DSG A;  1PJ6 A;  4WX1 A;  2K0Z A;  4CY8 A;  4JDR A;  5HXI A;  3AE8 A;  1DOC A;  1EBD A;  4Z2R A;  4H4V A;  1NAA A;  1XPQ A;  3AD9 B;  4Y4M A;  3V76 A;  1LQT A;  3ICR A;  4C5O A;  2V3B A;  2A87 A;  1GN0 A;  1H84 A;  4G9K A;  1PN0 A;  1PXB A;  3LAD A;  5EB5 A;  3S61 A;  1KSU A;  4U8K A;  1GSN A;  1YT8 A;  1CJC A;  2OLN A;  4B67 A;  5HBO A;  2X50 A;  1BF3 A;  2VRM A;  3P3A A;  4H2P A;  1YM9 A;  1MXT A;  4HA6 A;  1TYT A;  4C3Y A;  4TM0 A;  5J7X A;  1H86 A;  3UOY A;  2GAH B;  3UKK A;  2F5Z A;  2JB3 A;  2IFV A;  4ICY A;  1CC6 A;  3IC9 A;  4U8L A;  1H4M X;  1WV9 A;  1YML A;  2BXS A;  3AEF A;  4A6N B;  4HB9 A;  3QSE A;  4IVM B;  1D7Y A;  4EIP A;  5JCM A;  3Q9T A;  3V3N A;  2R4J A;  2BK4 A;  1GRE A;  1VG9 A;  4N9X A;  5JCL A;  1CHU A;  1E1K A;  3CPJ G;  1TYP A;  5KVI A;  1LQU A;  3BI2 A;  2TMD A;  3ATQ A;  3FIM B;  1DOB A;  3ICS A;  2W0H A;  3GK5 A;  3KKJ A;  2BS4 A;  4GCM A;  3TG3 A;  3FPZ A;  4H2Q A;  4UDP A;  1KF6 A;  3UTE A;  1ONF A;  3GDP A;  2YVF A;  5TR3 A;  3BNM A;  1H4K X;  1L9E A;  1SEZ A;  3UOX A;  4I59 A;  3KPK A;  4C3X A;  3F8R A;  3BHF A;  3FNJ A;  3CPH G;  1VG0 A;  3CTY A;  1JEH A;  3IHG A;  3UTN X;  4UP3 A;  1PBE A;  1P2E A;  4A9W A;  4B63 A;  1MO9 A;  4GDP A;  2H88 A;  2GWF A;  2BC0 A;  1YMK A;  2OAM A;  4I58 A;  4U2L A;  3UKH A;  2XLP A;  3R2U A;  1DJQ A;  1OJ9 A;  2RGO A;  4H4S A;  1JOA A;  4E0V A;  1CJ2 A;  1PXA A;  4PAA A;  4A6N A;  2YLT A;  1ZK7 A;  1REO A;  2OLO A;  3ALM A;  3OP3 A;  3CGD A;  2VVM A;  2XFO A;  1F6M A;  1HYU A;  2WET A;  4USQ A;  3VRA A;  1FOH A;  3QJ4 A;  4II2 A;  1COY A;  2ACZ A;  3GYX A;  3ISH A;  1P2H A;  3UKA A;  4ECH A;  1LV0 A;  1YQZ A;  3COX A;  4EQR A;  3M13 A;  4J31 A;  3NT6 A;  2ORA A;  1NG3 A;  4GR1 A;  3UOZ A;  3BHK A;  2GH5 A;  3I2V A;  5BUL A;  3CNJ A;  3TG1 B;  3GMC A;  4TM3 A;  4EIQ A;  3HYV A;  3NKS A;  2GQF A;  3BNU A;  2MOL A;  1AOG A;  3LXD A;  2BK3 A;  2OUC A;  4BV6 A;  1O94 A;  1BOI A;  1Z6L A;  1PXC A;  4LA1 A;  3VRD B;  1M6I A;  2YR5 A;  4JGT A;  4OPU A;  3ATR A;  4GAV A;  4XXG A;  4YKG A;  2GF3 A;  2ARD A;  1BWC A;  1LJ1 A;  1IUX A;  2C65 A;  4YKF A;  4EMW A;  1IUW A;  2KL3 A;  3HYX A;  2I0Z A;  4A79 A;  3AEE A;  2GRT A;  4GAP A;  1IUS A;  4TLX A;  2Q0K A;  2QAE A;  5HHF A;  1YMD A;  5LAO A;  1NG4 A;  2H89 A;  3OZ2 A;  2V3A A;  3SZ0 A;  2BAB A;  1NHS A;  4K22 A;  5HPA A;  3RP6 A;  1F8S A;  2FJA A;  4CNJ A;  2B9W A;  1ORB A;  4YSH A;  4ZN0 A;  5HYM A;  1E1M A;  3AAY A;  4B68 A;  2APG A;  3P4S A;  1FL2 A;  3AB1 A;  3E1T A;  3FG2 P;  2WU5 A;  1L0V A;  1GAL A;  1RHS A;  2E1M A;  2WBA A;  3AE9 A;  2VVL G;  4YTM A;  4CCQ A;  2C7G A;  3ZDN A;  2B76 A;  2JTS A;  3R9U A;  3DH9 A;  1FEA A;  2YLZ A;  4EMI A;  3RP7 A;  2CDU A;  1H7W A;  4YSY A;  3SX6 A;  3AYJ A;  4ZCD A;  2R4E A;  1UAR A;  2J6P A;  2YAU A;  4U8I A;  4TM1 A;  2WP9 A;  3NYE A;  5IPY A;  4WCT A;  3T37 A;  5JCK A;  3V3O A;  1GRB A;  1K4Q A;  2Q7V A;  3B6D A;  3AED A;  4Z43 A;  2C67 A;  2WPC A;  5DBJ A;  5EBK A;  2YVG A;  1OJT A;  1OJD A;  2WPE A;  4WH7 A;  2BC1 A;  3ADA B;  3ITJ A;  1CWT A;  2AAQ A;  3AE7 A;  1H81 A;  3NRN A;  4U8O A;  2X99 A;  2IVD A;  1D7L A;  1JNR A;  2XLU A;  2Q6U A;  4H4R A;  3H8I A;  3ZYX A;  4K7Z A;  5HY5 A;  3P4Q A;  2WU2 A;  3T14 A;  1BGN A;  4BJZ A;  4OPI A;  1T3K A;  1Q1R A;  2E5V A;  1NPX A;  2XVJ A;  4FK1 C;  1MOK A;  3NH3 X;  4Z44 A;  4OPD A;  2NPX A;  1VRQ B;  1E7P A;  2VRL A;  3NN6 X;  2JTQ A;  4X4J A;  2TPR A;  3CNT A;  5GRT A;  3P9U A;  2C64 A;  4YSZ A;  2XFU A;  4Y4L A;  2EG4 B;  1DXL A;  1EL9 A;  1NEN A;  3GYJ A;  4USR A;  3GRS A;  1QO8 A;  2RGJ A;  1GRA A;  2YLS A;  2XVI A;  4NTD A;  1LTX R;  3NTD A;  3NHO X;  4U8J A;  4BJY A;  3K9R A;  1NEK A;  4EQW A;  2ZBW A;  1DJN A;  3AEC A;  2HHG A;  3T2Y A;  1ZMC A;  3MZZ A;  1LPF A;  4FDC B;  1PBC A;  3FS5 A;  3I3L A;  5U25 A;  4CNK A;  4II3 A;  1VQW A;  3CGE A;  2BA9 A;  4J36 A;  3SGL A;  1TQ1 A;  3VR8 A;  3IWH A;  4B69 A;  4FX9 A;  1KDG A;  1GET A;  3H4K A;  3SZC A;  1YQ4 A;  4RSL A;  3T2K A;  3UTF A;  2A2K A;  3NG7 X;  3NK1 X;  3URH A;  2XFN A;  1ZY8 A;  4AOX A;  3D1P A;  2JBV A;  1GTE A;  1RSG A;  2WPF A;  2YR4 A;  3DGZ A;  5KOW A;  5KMR A;  3SFD A;  4D03 A;  3FLH A;  1OJC A;  1PS9 A;  2GR3 A;  3C96 A;  1FCD A;  3EAO A;  3CIR A;  4LU6 A;  5KRQ A;  1PJ7 A;  1HZM A;  3CMM A;  1GTH A;  1N4U A;  3JSK A;  1BKW A;  3AE4 A;  4AP1 A;  2VQB A;  2XLT A;  2EG4 A;  4YT0 A;  3SQP A;  1PBF A;  3DA1 A;  3C4A A;  4AT2 A;  1Y0P A;  1CF3 A;  1FEC A;  1JRX A;  2V60 A;  1JU2 A;  5LV9 A;  2EQ9 A;  1X31 B;  2C3C A;  3T2Z A;  5KWF A;  2ZZC A;  2IFD A;  4AP3 A;  4YSX A;  3GWD A;  3NHV A;  2ZZ0 A;  4LII A;  1NDA A;  3SZW A;  4K5R A;  3AAX A;  1F8R A;  1EL8 A;  1Y56 A;  4H4T A;  1IUV A;  4AT0 A;  2OAL A;  3C4N A;  2C72 A;  1UKV G;  3ILM A;  3FOJ A;  2MRM A;  2XLR A;  5GSN A;  3VQR A;  4RG4 A;  4A99 A;  1VDC A;  4F67 A;  3I3U A;  5FS8 A;  1GRT A;  2X8H A;  3GYI A;  4A7A A;  3EF6 A;  4YWO A;  3PS9 A;  4RG3 A;  4DSH A;  5FS6 A;  1GV4 A;  4XWR A;  4NTC A; 
#chains in the Genus database with same CATH homology
 3P1W A;  2XVF A;  1ZMD A;  4H4Q A;  4IVO B;  4EQX A;  4NZH A;  1EL7 A;  3DJE A;  4G73 A;  3DK9 A;  3UKQ A;  2PYX A;  2QCU A;  2Z5X A;  3DGH A;  4IA6 A;  4ADW A;  1S3B A;  3NK2 X;  1KSS A;  1OKG A;  5L46 A;  2EQ7 A;  1Q9I A;  2J3N A;  4H4Z A;  1DOD A;  1QLB A;  1D4D A;  4U8N A;  2BRA A;  4IV9 A;  3NGC X;  1L9C A;  3AE6 A;  2IVE A;  3KVE A;  3SFE A;  2GR0 A;  1C25 A;  3BI5 A;  5EB4 A;  3QSS A;  5IQ1 A;  1NHR A;  4B66 A;  1YQ3 A;  4K5S A;  4GUV A;  1E0C A;  1XDI A;  4EM4 A;  2YG4 A;  2WOI A;  2YG7 A;  1ZKQ A;  3L8K A;  2WES A;  4APN A;  2DKI A;  3AWI A;  1K0J A;  1TDE A;  2QA1 A;  3UOV A;  3AEG A;  5HBL A;  2A89 A;  1GND A;  4OCG A;  1GEU A;  2C75 A;  3UP4 A;  3NTA A;  3CGC A;  3F8P A;  3F8D A;  1IJH A;  4B64 A;  4BK1 A;  2YLR A;  3IF9 A;  3PO7 A;  1DOE A;  1RYI A;  4OVI A;  4UDQ A;  3M0O A;  4G6G A;  3CNS A;  2XLS A;  3RED A;  3UTG A;  3K30 A;  5KOX A;  2Z5Y A;  2JB2 A;  3AEA A;  3AE2 A;  2C70 A;  1DNC A;  3HYW A;  4H7U A;  3QSM A;  1FEB A;  4H4U A;  5CKU A;  3HZU A;  3DK8 A;  4UDR A;  5EOW A;  4BK2 A;  5FMH A;  1F8W A;  2R46 A;  3FMW A;  1TDK A;  4NNJ A;  4YTN A;  1D4E A;  2FJD A;  3UCL A;  3GSI A;  3T0K A;  1YKJ A;  1YY5 A;  1GMX A;  5U63 A;  3AYL A;  1O95 A;  2Q0L A;  2GEW A;  4ZCC A;  4A5L A;  3GD3 A;  3UKP A;  4AOS A;  1RHD A;  1CJ3 A;  1L9D A;  1B37 A;  1PJ5 A;  2WOW A;  1IUU A;  2BXR A;  4REK A;  4YXD A;  5BVA A;  3UKL A;  1GPE A;  2JK6 A;  1GES A;  2R9Z A;  2X3N A;  3LB8 A;  3OLH A;  2YWL A;  2R0G A;  4TM4 A;  4O5U A;  4U2T A;  1ZOV A;  1H7X A;  2WP5 A;  5FS7 A;  3ICT A;  2XDO A;  1ZDL A;  1BZL A;  5KMS A;  4P9S A;  4U8M A;  4OPC A;  2WDR A;  5KNL A;  1NHQ A;  2O9Z A;  4TLZ A;  1CC2 A;  3RNM A;  1V59 A;  3AE1 A;  1ELI A;  3P4P A;  1GRF A;  1H82 A;  5JCI A;  1W4X A;  5KVH A;  3F4A A;  3NYF A;  2Y6R A;  1B4V A;  2GAG B;  4J57 A;  2E4G A;  3WE0 A;  2DKH A;  2YG5 A;  4C74 A;  2WOV A;  2B7S A;  3NIX A;  2GQW A;  4Z26 A;  2B9Y A;  1CWR A;  4GRT A;  3SM8 A;  3ABV A;  3CND A;  3LOV A;  4GF7 A;  2BAC A;  3KA7 A;  1QB0 A;  3NN0 X;  4BUR A;  1N4V A;  5IQ4 A;  1GER A;  2VQ7 A;  5ER0 A;  1BGJ A;  5FS9 A;  1URH A;  2AR8 A;  2GB0 A;  2GR2 A;  2QA2 A;  3KPF A;  2VOU A;  4K8D A;  4A65 A;  2V5Z A;  3H8L A;  3BI4 A;  4H50 A;  3AE5 A;  3CPI G;  2JKC A;  2R0P A;  3DJD A;  2CVJ A;  2WDQ A;  3HZL A;  3KD9 A;  1IUT A;  1E39 A;  3UKF A;  4EM3 A;  2XCG A;  1Y56 B;  2BCP A;  4GDE A;  3CGB A;  3P4R A;  2WQY A;  2BYB A;  4JNQ A;  1KNR A;  2BK5 A;  1E1N A;  1GRH A;  1Q1W A;  1M64 A;  2XVH A;  3AEB A;  2JB1 A;  2R45 A;  5M0Z A;  1RP0 A;  1B8S A;  1K0I A;  2YG6 A;  1N4W A;  2BRY A;  1BOH A;  2NVK X;  2CUL A;  2RGH A;  3NYC A;  5JCN A;  5M10 A;  5CQF A;  3EPT A;  4X9N A;  3HIX A;  3GDN A;  2WLR A;  3AYI A;  2WLX A;  2XFP A;  4Z2T A;  1JNZ A;  3KLJ A;  2XYO A;  1O5W A;  3B3R A;  4H4X A;  1QXN A;  3DME A;  4FK1 A;  3IPO A;  2GV8 A;  2YG3 A;  3SXI A;  2PHH A;  3LZX A;  3O3W A;  4XWZ A;  1EL5 A;  2UZZ A;  2YR6 A;  3SYI A;  3VR9 A;  1LVL A;  4B65 A;  1OJA A;  2GMJ A;  5KXJ A;  4KPR A;  3IWA A;  1S3E A;  2V6O A;  1ZOY A;  2A8X A;  3D8X A;  4JY2 A;  3K7M X;  1GRG A;  3NNE A;  4DGK A;  5HBP A;  4H2N A;  4Z2U A;  3QFB A;  2Y6Q A;  3OC4 A;  2FJE A;  3S5W A;  4KX6 A;  1CWS A;  3HWI A;  4C77 A;  3SZF A;  1TDN A;  1E1L A;  3AD7 B;  2ZZB A;  4OPT A;  3AE3 A;  4H4Y A;  5KMP A;  4J56 A;  3DK4 A;  3QFA A;  1XHC A;  1E6E A;  1CBO A;  3L1R A;  4WH9 A;  4U8P A;  2YVJ A;  1NHP A;  4M52 A;  1QJD A;  1GOS A;  3NK0 X;  1XAN A;  2X8G A;  4CY6 A;  2RAB A;  2VVL A;  1KFY A;  5KMQ A;  1YS0 A;  4Y4N A;  3RP8 A;  1N1P A;  3CNP A;  3T31 A;  3I6D A;  2B9X A;  4Z25 A;  3RHA A;  4DNA A;  3KU9 A;  1PHH A;  5U1O A;  1DP2 A;  1PBD A;  3K7T A;  4PAB A;  5HBQ A;  4NWZ A;  2WHD A;  4NEV A;  4O5Q A;  2BS2 A;  2C76 A;  3EAN A;  2WEU A;  4H4W A;  1H6V A;  2UZQ A;  3GWF A;  3GRT A;  2DCQ A;  1D5T A;  1PBB A;  4H2R A;  4JN9 A;  1TDF A;  4YTP A;  3AD8 B;  4B1B A;  4CCR A;  3QVR A;  5BUK A;  5C3J A;  2BCG G;  3G5J A;  3FBS A;  5LAM A;  2HQM A;  1B5Q A;  3NLC A;  2C66 A;  2GR1 A;  2C3D A;  4CBQ A;  4IA5 A;  2JAE A;  1H83 A;  4G74 A;  4NTE A;  4J33 A;  3LZW A;  2VZ2 A;  2YQU A;  1CL0 A;  3TP9 A;  2CFY A;  3IPP A;  4BK3 A;  4K2X A;  1VEE A;  2JTR A;  3ALL A;  2IID A;  2XFQ A;  2C4C A;  3ALJ A;  2GVC A;  2MOI A;  3UP5 A;  1GT8 A;  2GMH A;  4JNA A;  1JRZ A;  2BS3 A;  4G6H A;  2YM2 A;  4X9M A;  4OPG A;  3M12 A;  2YLW A;  4EQS A;  4MJW A;  2EQ6 A;  1WHB A;  3PVC A;  1ZX9 A;  2AQJ A;  2VSW A;  3IHM A;  3GMB A;  4J2W A;  3G5Q A;  1F3P A;  3G5R A;  4J34 A;  1CC4 A;  3GD4 A;  4JQ9 A;  2C73 A;  4CRT A;  1KNP A;  3G5S A;  2WS3 A;  4H4P A;  4U2S A;  5BRT A;  2R0C A;  4OPL A;  3AXB A;  3D1C A;  2X8C A;  2EG3 A;  3LJP A;  1TRB A;  1S2Q A;  1TDO A;  2B7R A;  2EQ8 A;  4JY3 A;  1S2Y A;  4NEW A;  2WP6 A;  1K0L A;  2V61 A;  2WDV A;  2FJB A;  4Z24 A;  3QVP A;  1D4C A;  5J60 A;  3DJG X;  3II4 A;  3UTH A;  3VRB A;  1GXF A;  2OA1 A;  1JRY A;  3CN8 A;  3Q6J A;  5C2T A;  2YM1 A;  2FSX A;  4EMJ A;  1CJ4 A;  2FBW A;  2XVE A;  3DJJ A;  2YLX A;  1PDH A;  1ZP0 A;  3K7Q X;  4D04 A;  3O0H A;  3SY4 A;  4DSG A;  1PJ6 A;  4WX1 A;  2K0Z A;  4CY8 A;  4JDR A;  5HXI A;  3AE8 A;  1DOC A;  1EBD A;  4Z2R A;  4H4V A;  1NAA A;  1XPQ A;  3AD9 B;  4Y4M A;  3V76 A;  1LQT A;  3ICR A;  4C5O A;  2V3B A;  2A87 A;  1GN0 A;  1H84 A;  4G9K A;  1PN0 A;  1PXB A;  3LAD A;  5EB5 A;  3S61 A;  1KSU A;  4U8K A;  1GSN A;  1YT8 A;  1CJC A;  2OLN A;  4B67 A;  5HBO A;  2X50 A;  1BF3 A;  2VRM A;  3P3A A;  4H2P A;  1YM9 A;  1MXT A;  4HA6 A;  1TYT A;  4C3Y A;  4TM0 A;  5J7X A;  1H86 A;  3UOY A;  2GAH B;  3UKK A;  2F5Z A;  2JB3 A;  2IFV A;  4ICY A;  1CC6 A;  3IC9 A;  4U8L A;  1H4M X;  1WV9 A;  1YML A;  2BXS A;  3AEF A;  4A6N B;  4HB9 A;  3QSE A;  4IVM B;  1D7Y A;  4EIP A;  5JCM A;  3Q9T A;  3V3N A;  2R4J A;  2BK4 A;  1GRE A;  1VG9 A;  4N9X A;  5JCL A;  1CHU A;  1E1K A;  3CPJ G;  1TYP A;  5KVI A;  1LQU A;  3BI2 A;  2TMD A;  3ATQ A;  3FIM B;  1DOB A;  3ICS A;  2W0H A;  3GK5 A;  3KKJ A;  2BS4 A;  4GCM A;  3TG3 A;  3FPZ A;  4H2Q A;  4UDP A;  1KF6 A;  3UTE A;  1ONF A;  3GDP A;  2YVF A;  5TR3 A;  3BNM A;  1H4K X;  1L9E A;  1SEZ A;  3UOX A;  4I59 A;  3KPK A;  4C3X A;  3F8R A;  3BHF A;  3FNJ A;  3CPH G;  1VG0 A;  3CTY A;  1JEH A;  3IHG A;  3UTN X;  4UP3 A;  1PBE A;  1P2E A;  4A9W A;  4B63 A;  1MO9 A;  4GDP A;  2H88 A;  2GWF A;  2BC0 A;  1YMK A;  2OAM A;  4I58 A;  4U2L A;  3UKH A;  2XLP A;  3R2U A;  1DJQ A;  1OJ9 A;  2RGO A;  4H4S A;  1JOA A;  4E0V A;  1CJ2 A;  1PXA A;  4PAA A;  4A6N A;  2YLT A;  1ZK7 A;  1REO A;  2OLO A;  3ALM A;  3OP3 A;  3CGD A;  2VVM A;  2XFO A;  1F6M A;  1HYU A;  2WET A;  4USQ A;  3VRA A;  1FOH A;  3QJ4 A;  4II2 A;  1COY A;  2ACZ A;  3GYX A;  3ISH A;  1P2H A;  3UKA A;  4ECH A;  1LV0 A;  1YQZ A;  3COX A;  4EQR A;  3M13 A;  4J31 A;  3NT6 A;  2ORA A;  1NG3 A;  4GR1 A;  3UOZ A;  3BHK A;  2GH5 A;  3I2V A;  5BUL A;  3CNJ A;  3TG1 B;  3GMC A;  4TM3 A;  4EIQ A;  3HYV A;  3NKS A;  2GQF A;  3BNU A;  2MOL A;  1AOG A;  3LXD A;  2BK3 A;  2OUC A;  4BV6 A;  1O94 A;  1BOI A;  1Z6L A;  1PXC A;  4LA1 A;  3VRD B;  1M6I A;  2YR5 A;  4JGT A;  4OPU A;  3ATR A;  4GAV A;  4XXG A;  4YKG A;  2GF3 A;  2ARD A;  1BWC A;  1LJ1 A;  1IUX A;  2C65 A;  4YKF A;  4EMW A;  1IUW A;  2KL3 A;  3HYX A;  2I0Z A;  4A79 A;  3AEE A;  2GRT A;  4GAP A;  1IUS A;  4TLX A;  2Q0K A;  2QAE A;  5HHF A;  1YMD A;  5LAO A;  1NG4 A;  2H89 A;  3OZ2 A;  2V3A A;  3SZ0 A;  2BAB A;  1NHS A;  4K22 A;  5HPA A;  3RP6 A;  1F8S A;  2FJA A;  4CNJ A;  2B9W A;  1ORB A;  4YSH A;  4ZN0 A;  5HYM A;  1E1M A;  3AAY A;  4B68 A;  2APG A;  3P4S A;  1FL2 A;  3AB1 A;  3E1T A;  3FG2 P;  2WU5 A;  1L0V A;  1GAL A;  1RHS A;  2E1M A;  2WBA A;  3AE9 A;  2VVL G;  4YTM A;  4CCQ A;  2C7G A;  3ZDN A;  2B76 A;  2JTS A;  3R9U A;  3DH9 A;  1FEA A;  2YLZ A;  4EMI A;  3RP7 A;  2CDU A;  1H7W A;  4YSY A;  3SX6 A;  3AYJ A;  4ZCD A;  2R4E A;  1UAR A;  2J6P A;  2YAU A;  4U8I A;  4TM1 A;  2WP9 A;  3NYE A;  5IPY A;  4WCT A;  3T37 A;  5JCK A;  3V3O A;  1GRB A;  1K4Q A;  2Q7V A;  3B6D A;  3AED A;  4Z43 A;  2C67 A;  2WPC A;  5DBJ A;  5EBK A;  2YVG A;  1OJT A;  1OJD A;  2WPE A;  4WH7 A;  2BC1 A;  3ADA B;  3ITJ A;  1CWT A;  2AAQ A;  3AE7 A;  1H81 A;  3NRN A;  4U8O A;  2X99 A;  2IVD A;  1D7L A;  1JNR A;  2XLU A;  2Q6U A;  4H4R A;  3H8I A;  3ZYX A;  4K7Z A;  5HY5 A;  3P4Q A;  2WU2 A;  3T14 A;  1BGN A;  4BJZ A;  4OPI A;  1T3K A;  1Q1R A;  2E5V A;  1NPX A;  2XVJ A;  4FK1 C;  1MOK A;  3NH3 X;  4Z44 A;  4OPD A;  2NPX A;  1VRQ B;  1E7P A;  2VRL A;  3NN6 X;  2JTQ A;  4X4J A;  2TPR A;  3CNT A;  5GRT A;  3P9U A;  2C64 A;  4YSZ A;  2XFU A;  4Y4L A;  2EG4 B;  1DXL A;  1EL9 A;  1NEN A;  3GYJ A;  4USR A;  3GRS A;  1QO8 A;  2RGJ A;  1GRA A;  2YLS A;  2XVI A;  4NTD A;  1LTX R;  3NTD A;  3NHO X;  4U8J A;  4BJY A;  3K9R A;  1NEK A;  4EQW A;  2ZBW A;  1DJN A;  3AEC A;  2HHG A;  3T2Y A;  1ZMC A;  3MZZ A;  1LPF A;  4FDC B;  1PBC A;  3FS5 A;  3I3L A;  5U25 A;  4CNK A;  4II3 A;  1VQW A;  3CGE A;  2BA9 A;  4J36 A;  3SGL A;  1TQ1 A;  3VR8 A;  3IWH A;  4B69 A;  4FX9 A;  1KDG A;  1GET A;  3H4K A;  3SZC A;  1YQ4 A;  4RSL A;  3T2K A;  3UTF A;  2A2K A;  3NG7 X;  3NK1 X;  3URH A;  2XFN A;  1ZY8 A;  4AOX A;  3D1P A;  2JBV A;  1GTE A;  1RSG A;  2WPF A;  2YR4 A;  3DGZ A;  5KOW A;  5KMR A;  3SFD A;  4D03 A;  3FLH A;  1OJC A;  1PS9 A;  2GR3 A;  3C96 A;  1FCD A;  3EAO A;  3CIR A;  4LU6 A;  5KRQ A;  1PJ7 A;  1HZM A;  3CMM A;  1GTH A;  1N4U A;  3JSK A;  1BKW A;  3AE4 A;  4AP1 A;  2VQB A;  2XLT A;  2EG4 A;  4YT0 A;  3SQP A;  1PBF A;  3DA1 A;  3C4A A;  4AT2 A;  1Y0P A;  1CF3 A;  1FEC A;  1JRX A;  2V60 A;  1JU2 A;  5LV9 A;  2EQ9 A;  1X31 B;  2C3C A;  3T2Z A;  5KWF A;  2ZZC A;  2IFD A;  4AP3 A;  4YSX A;  3GWD A;  3NHV A;  2ZZ0 A;  4LII A;  1NDA A;  3SZW A;  4K5R A;  3AAX A;  1F8R A;  1EL8 A;  1Y56 A;  4H4T A;  1IUV A;  4AT0 A;  2OAL A;  3C4N A;  2C72 A;  1UKV G;  3ILM A;  3FOJ A;  2MRM A;  2XLR A;  5GSN A;  3VQR A;  4RG4 A;  4A99 A;  1VDC A;  4F67 A;  3I3U A;  5FS8 A;  1GRT A;  2X8H A;  3GYI A;  4A7A A;  3EF6 A;  4YWO A;  3PS9 A;  4RG3 A;  4DSH A;  5FS6 A;  1GV4 A;  4XWR A;  4NTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...