3NTDA

Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c531s mutant
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
565
structure length
565
Chain Sequence
MKKILIIGGVAGGASAAARARRLSETAEIIMFERGEYVSFANCGLPYHISGEIAQRSALVLQTPESFKARFNVEVRVKHEVVAIDRAAKLVTVRRLLDGSEYQESYDTLLLSPGAAPIVPPIPGVDNPLTHSLRNIPDMDRILQTIQMNNVEHATVVGGGFIGLEMMESLHHLGIKTTLLELADQVMTPVDREMAGFAHQAIRDQGVDLRLGTALSEVSYQVQTHVASDAAGEDTAHQHIKGHLSLTLSNGELLETDLLIMAIGVRPETQLARDAGLAIGELGGIKVNAMMQTSDPAIYAVGDAVEEQDFVTGQACLVPLAGPANRQGRMAADNMFGREERYQGTQGTAICKVFDLAVGATGKNEKQLKQAGIAFEKVYVHTASHASYYPGAEVVSFKLLFDPVKGTIFGAQAVGKDGIDKRIDVMAVAQRAGMTVEQLQHLELSYAPPYGSAKDVINQAAFVASNIIKGDATPIHFDQIDNLSEDQLLLDVRNPGELQNGGLEGAVNIPVDELRDRMHELPKDKEIIIFSQVGLRGNVAYRQLVNNGYRARNLIGGYRTYKFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FAD-dependent pyridine nucleotide-disulphide oxidoreductase
publication title Characterization of an NADH-Dependent Persulfide Reductase from Shewanella loihica PV-4: Implications for the Mechanism of Sulfur Respiration via FAD-Dependent Enzymes .
pubmed doi rcsb
source organism Shewanella loihica
molecule tags Oxidoreductase
total genus 184
structure length 565
sequence length 565
chains with identical sequence B
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2010-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3ntdA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ntdA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ntdA01
2XLUA 1FEAA 2WBAA 1JOAA 2GMHA 3K7TA 3FIMB 3D8XA 1YS0A 1H86A 3UKQA 2WQYA 4YTNA 4A6NB 4J31A 3VRAA 1YT8A 1CF3A 2BC1A 2HHGA 2H89A 3P1WA 2BA9A 4YSZA 3LB8A 1UKVG 3CPHG 3FS5A 5BRTA 5KRQA 2V5ZA 5FMHA 1XPQA 3VQRA 4RSLA 1H4MX 2JTSA 1PDHA 1OJDA 4B63A 2DCQA 2YWLA 5L46A 3TG1B 3KD9A 5U63A 1PJ5A 2QCUA 3FBSA 4GR1A 1GT8A 4A99A 1F3PA 4B64A 1IUVA 4BK2A 2VVMA 5JCNA 1GRHA 1D4DA 1H83A 1M6IA 3IHMA 4O5QA 1FOHA 1PBCA 1E6EA 5EBKA 1UARA 4H4TA 3CGBA 2WOWA 4UP3A 3EAOA 4DGKA 4NTEA 3NK0X 1ZX9A 2H88A 1DJNA 2WLRA 1GESA 1JNRA 4HA6A 3WE0A 1FL2A 1JRYA 5JCLA 4LIIA 4CY8A 1GETA 5JCMA 5U25A 3UTGA 3DGZA 2C75A 2NPXA 3IWAA 1PBEA 4ZN0A 1K0IA 1V59A 5TR3A 3ISHA 3C96A 3RHAA 3UKHA 3ALJA 4ZCCA 3NK2X 3PS9A 4B68A 5EB4A 1FCDA 3Q6JA 1PXBA 2OLOA 1FEBA 1NHRA 2XLSA 1O5WA 2JB1A 2Q7VA 2QAEA 4B65A 2R9ZA 4JN9A 2Q0LA 2JAEA 4Y4MA 3DJJA 4U8MA 3QSMA 5EOWA 1BOHA 3D1PA 2WPCA 1CHUA 3BNMA 4Z25A 4C77A 3HWIA 3B6DA 3I3UA 2YLWA 5U1OA 1CWSA 4EQXA 4YTMA 4FK1C 1PBFA 1H82A 2FJAA 3DJEA 3P4SA 4GDPA 4U8IA 4BJYA 1EBDA 2B9WA 2WESA 3M12A 4IVOB 1NG4A 4XWRA 5JCKA 2MOLA 1E1LA 2XLRA 3DGHA 3RP8A 4F67A 2Y6QA 3AE8A 2ZZCA 1YQ4A 3NN6X 1KSUA 5KOXA 1CWRA 2XFQA 1NEKA 1Y56B 1IUSA 5M0ZA 3IF9A 5LAMA 2RGJA 2R0PA 3CNJA 4NEVA 3REDA 4U8JA 3KU9A 2C3DA 3UOZA 1VEEA 4MJWA 2YR6A 5CKUA 3NYCA 3S5WA 2YQUA 1E1KA 2EG3A 2ORAA 1GERA 2FJBA 2GVCA 4GUVA 4UDQA 4H4QA 2PHHA 3NYEA 1QB0A 2R0CA 3DK4A 1SEZA 2ARDA 1LQUA 5HBLA 4AP1A 2VSWA 2EQ8A 2R0GA 2WU5A 4BJZA 3K7QX 4LA1A 4EQSA 1GMXA 4YKFA 1Z6LA 2R4EA 2Q6UA 3AYJA 3GD3A 3H4KA 3BI4A 4A9WA 1JU2A 2EQ7A 2ZZBA 4H4XA 4Z2RA 3QVRA 1RP0A 3AB1A 3UOVA 4YKGA 1S3EA 3G5JA 2YLSA 1RHDA 4IVMB 3EF6A 3ITJA 5BUKA 4FK1A 3IC9A 2YAUA 2E4GA 3CIRA 3RNMA 1N1PA 3ICTA 1LJ1A 1Q1WA 4H2NA 1GNDA 3LJPA 3UOXA 3H8IA 3UKLA 4DNAA 4NEWA 1H81A 1GTEA 2IVEA 1GOSA 1OJ9A 2GAGB 1CWTA 3TG3A 1IUXA 1XHCA 1YKJA 3CGEA 4OVIA 1HYUA 2O9ZA 3B3RA 3EANA 1L0VA 4BK1A 2EG4A 2TPRA 2JTRA 2FJEA 2JBVA 3UOYA 4K5RA 4FDCB 5EB5A 3L8KA 3AD9B 1MO9A 1YY5A 2DKIA 3K30A 2AQJA 3ZDNA 4NTDA 5J7XA 4CCQA 1PXAA 2ACZA 3UTEA 3AE5A 4GDEA 1ONFA 2GB0A 1B8SA 4J34A 4BV6A 1W4XA 3II4A 2C65A 2C72A 2BXSA 4OPCA 2WLXA 2EQ6A 3M13A 1RYIA 4FX9A 2BK3A 2DKHA 2VRMA 1CC6A 1E7PA 1TRBA 2OAMA 4APNA 3AEFA 2B9XA 1PBBA 2GH5A 1TDNA 3SM8A 5HBQA 2F5ZA 3LZXA 2UZZA 3S61A 2E1MA 3HZUA 4UDPA 2J3NA 3AE4A 1D4EA 4A6NA 2Q0KA 2RGOA 2BXRA 4OPLA 3T37A 5C3JA 3O0HA 2MOIA 3CPJG 4K7ZA 3CNPA 1ZMDA 1BGNA 3UCLA 4WH7A 1GALA 1VDCA 4JNQA 3AWIA 1DOBA 3V76A 1GRGA 2RABA 1PN0A 2WOVA 4Z43A 3NNEA 1LPFA 1PJ7A 2A87A 3I3LA 3JSKA 2C67A 2R46A 2CULA 2JTQA 3QJ4A 3UTHA 3PO7A 3G5QA 4CCRA 3FMWA 3FOJA 3ALLA 4U8OA 1VQWA 3NH3X 1P2HA 4HB9A 3NKSA 4K22A 3NN0X 3VRBA 2BABA 3OLHA 1B37A 1GSNA 4EQWA 2EQ9A 4EMWA 3L1RA 3NHVA 1BKWA 4H4WA 4H4ZA 3VR9A 4AP3A 4B66A 2YLXA 2W0HA 1TDEA 4X4JA 4EM4A 4YT0A 1LQTA 1Y0PA 2X3NA 1IUUA 2WP6A 2ZBWA 3CNDA 1Q9IA 3I6DA 1B5QA 3K7MX 5KVIA 3SGLA 3CNSA 4OPTA 1K4QA 3ATRA 5FS6A 1LV0A 4Z24A 3KKJA 1K0LA 4J33A 1CJ2A 2C70A 2VQBA 2GEWA 2OALA 3EPTA 4K8DA 2PYXA 3NTDA 5LAOA 3AEAA 2QA1A 2V3AA 1BF3A 1O95A 3GMBA 1O94A 3GD4A 1GV4A 1YMLA 1BZLA 1S2YA 3QVPA 3AD8B 4CNJA 1WHBA 2MRMA 1TYPA 2BS4A 2RGHA 4LU6A 1KNPA 4H4VA 4J56A 2XLTA 3NT6A 2WHDA 4H4YA 1YMDA 4YSYA 2VOUA 2XFNA 5FS9A 1BOIA 2UZQA 4H50A 3UKAA 4BK3A 4P9SA 2NVKX 3SFEA 2XLPA 4CNKA 3OC4A 2XFUA 1NG3A 2C3CA 4WCTA 1NHQA 1MXTA 1N4WA 1Y56A 4TM3A 4ZCDA 4A5LA 4OPDA 3G5RA 2YVFA 3GWDA 1E1MA 2BCGG 2XFPA 3QFAA 3V3NA 4AT0A 4Y4LA 1VG9A 4I59A 1NHSA 2IFVA 5JCIA 2IVDA 3DMEA 2XVHA 1PBDA 2FSXA 1H7XA 5KXJA 2GR2A 3P4QA 1CBOA 1NDAA 3AEDA 2B7RA 4U8NA 1L9EA 4H4RA 1YQZA 4Z2UA 4A7AA 1EL8A 2OLNA 4U8PA 2BC0A 3F8RA 4U2SA 2XCGA 1XANA 2GV8A 3UKKA 4IV9A 1GEUA 5HBOA 1T3KA 2GF3A 3PVCA 4OPIA 3VR8A 2GWFA 2Z5XA 4J2WA 1ZK7A 1GTHA 1HZMA 3D1CA 3DK9A 3K9RA 3LADA 1ZOYA 2C76A 3QSSA 4EM3A 1GN0A 1VG0A 1TDKA 2YG4A 3DJGX 5M10A 3AEGA 4YTPA 3MZZA 4TM0A 3UKFA 1E1NA 1ZP0A 1AOGA 2A8XA 1IJHA 2X8GA 4JY2A 1DJQA 2BS3A 1URHA 2GAHB 3GRSA 3V3OA 4B67A 1PJ6A 2Z5YA 2KL3A 1BGJA 1K0JA 4GCMA 4GF7A 4U2LA 3R9UA 1N4VA 1YQ3A 4AOSA 2X8HA 4PAAA 4H4UA 3FLHA 4TLZA 4RG4A 1MOKA 1GRBA 1QXNA 3AXBA 3C4NA 1CJCA 2JK6A 1ZDLA 2WP9A 2C66A 4EQRA 2YLZA 4EIPA 3COXA 4AOXA 4CY6A 2YG7A 1OJTA 2VVLG 1RHSA 2C7GA 3M0OA 1H4KX 3H8LA 1GRTA 3GK5A 3CTYA 2WDRA 5GRTA 1M64A 2R45A 4EMJA 5KOWA 4PABA 3SQPA 4Z26A 3KA7A 3IPPA 3GYJA 1EL7A 1DOCA 1YMKA 4KPRA 3URHA 3AD7B 4GRTA 5J60A 1TQ1A 2WU2A 1OJAA 3ALMA 4J57A 1ZKQA 1OJCA 3AYIA 1NAAA 3RP6A 4H2RA 1TDOA 2CFYA 1JNZA 1NPXA 2GR3A 2OA1A 2B76A 1COYA 2XYOA 1ZMCA 3CPIG 5BULA 4OPUA 1GXFA 2XVIA 4AT2A 4YXDA 5HPAA 3CNTA 1X31B 4ADWA 4N9XA 3AE3A 2BK5A 2E5VA 2X99A 3AYLA 2K0ZA 2X50A 2WPEA 3DH9A 4H2QA 1TYTA 2BS2A 3CN8A 4X9MA 3UP5A 2ZZ0A 3ADAB 5CQFA 1P2EA 3R2UA 1REOA 2VQ7A 5HHFA 3GRTA 1ZY8A 2B7SA 1WV9A 3NHOX 3GYIA 2YM1A 4X9NA 3LOVA 1E0CA 3OZ2A 4A79A 4XXGA 4Z44A 1H6VA 2GR1A 1ORBA 2R4JA 3NG7X 4YWOA 3ZYXA 2YG3A 4C3XA 3Q9TA 1KNRA 1KDGA 3BHFA 4DSHA 3FPZA 3QSEA 4USRA 1BWCA 1F8SA 2YVGA 4E0VA 5KWFA 4K2XA 2A2KA 4TM4A 1CL0A 3P4PA 3GDNA 3KVEA 3NGCX 4U2TA 2YR5A 5IPYA 3F8DA 4A65A 1CC4A 4J36A 5IQ4A 3AE1A 3BI5A 3E1TA 1JRXA 2WDVA 5KVHA 2OUCA 3F4AA 3O3WA 4TM1A 4XWZA 2WS3A 2Y6RA 1KF6A 2X8CA 4U8LA 1EL5A 3ABVA 5HXIA 3UTFA 4OCGA 2JB3A 3GMCA 1NHPA 2CDUA 2TMDA 3HIXA 2IIDA 3KPFA 1D4CA 1XDIA 3KLJA 1YM9A 2WEUA 3RP7A 3NIXA 3UKPA 3DA1A 3UP4A 2XVFA 4CRTA 2WDQA 1JEHA 1S2QA 3IPOA 4CBQA 2V6OA 1KSSA 4H4SA 3GWFA 3AAYA 2WETA 2GQWA 2YLTA 5IQ1A 4U8KA 4K5SA 2YG5A 4D03A 2J6PA 4EIQA 1NENA 2C73A 1D7LA 5BVAA 5HY5A 1D7YA 1IUTA 1VRQB 2BACA 2GR0A 4YSXA 3LXDA 4ICYA 2YM2A 3DJDA 4H2PA 4BURA 1C25A 1ELIA 4B69A 4D04A 3GDPA 4NZHA 1B4VA 1TDFA 2YVJA 4KX6A 3AE7A 4WX1A 3ILMA 2V61A 3IHGA 4C5OA 2YG6A 2XVJA 3AAXA 3FG2P 2A89A 3NRNA 3G5SA 3P3AA 4NTCA 1FECA 4Y4NA 3FNJA 1PXCA 1F8RA 2YLRA 1PHHA 4RG3A 3F8PA 3SFDA 1LTXR 2BCPA 1IUWA 4C3YA 3CGCA 4UDRA 3ICRA 1EL9A 2GRTA 3GSIA 1DNCA 3AE6A 2GMJA 4I58A 2AAQA 4DSGA 1Q1RA 1JRZA 5LV9A 2VZ2A 5GSNA 2XFOA 1PS9A 2WOIA 1DOEA 4REKA 2BYBA 5HYMA 3VRDB 2AR8A 2GQFA 2FJDA 1L9DA 3P4RA 1QO8A 3BI2A 4OPGA 2WPFA 2JKCA 1OKGA 1D5TA 1CC2A 2APGA 1QLBA 2HQMA 2FBWA 4ECHA 4C74A 4B1BA 4WH9A 3ATQA 1DODA 1KFYA 2IFDA 4JGTA 3NYFA 3DK8A 2JB2A 2VVLA 4JNAA 2B9YA 5C2TA 3BHKA 2XDOA 3AEBA 4USQA 5FS7A 4YSHA 1H84A 1LVLA 1F8WA 1H7WA 2VRLA 5HBPA 3AECA 3CGDA 1GRFA 3AEEA 2QA2A 3IWHA 2XVEA 1S3BA 2CVJA 4Z2TA 3NLCA 1GPEA 5FS8A 3AE9A 1L9CA 1DP2A 4H7UA 3NTAA 4H4PA 4IA6A 1F6MA 4JQ9A 4TLXA 2BK4A 2EG4B 2C64A 1N4UA 3TP9A 1CJ3A 2I0ZA 2WP5A 5ER0A 4IA5A 4M52A 5DBJA 3OP3A 3I2VA 2YR4A 4JDRA 3C4AA 3UTNX 4O5UA 4JY3A 3NK1X 1GREA 3P9UA 1E39A 1DXLA 3BNUA 1RSGA 1ZOVA 3HZLA 1GRAA 2V60A 3AE2A 4EMIA 1CJ4A 3LZWA 3QFBA 2V3BA 3ICSA 1QJDA
chains in the Genus database with same CATH superfamily
2XLUA 1FEAA 2WBAA 1JOAA 2GMHA 3K7TA 3FIMB 3D8XA 1YS0A 1H86A 3UKQA 4GAVA 2WQYA 4YTNA 4A6NB 4J31A 3VRAA 1YT8A 1CF3A 2BC1A 2HHGA 2H89A 3P1WA 2BA9A 4YSZA 3LB8A 1UKVG 3CPHG 3FS5A 5BRTA 5KRQA 2V5ZA 5FMHA 1XPQA 3VQRA 4RSLA 1H4MX 2JTSA 1PDHA 1OJDA 4B63A 2DCQA 2YWLA 5L46A 3TG1B 3KD9A 5U63A 1PJ5A 2QCUA 3FBSA 4GR1A 1GT8A 4A99A 1F3PA 4B64A 1IUVA 4BK2A 2VVMA 5JCNA 1GRHA 1D4DA 1H83A 1M6IA 3IHMA 4O5QA 1FOHA 1PBCA 1E6EA 5EBKA 1UARA 4H4TA 3CGBA 2WOWA 4UP3A 3EAOA 4DGKA 4NTEA 3NK0X 1ZX9A 2H88A 1DJNA 2WLRA 1GESA 1JNRA 4HA6A 3T2YA 3WE0A 1FL2A 1JRYA 5JCLA 4II3A 4LIIA 4CY8A 1GETA 5JCMA 5U25A 3UTGA 3DGZA 2C75A 2NPXA 3IWAA 1PBEA 3SXIA 4ZN0A 1K0IA 1V59A 5TR3A 3ISHA 3C96A 3RHAA 3UKHA 3ALJA 4ZCCA 3NK2X 3PS9A 4B68A 5EB4A 1FCDA 3Q6JA 1PXBA 2OLOA 1FEBA 1NHRA 2XLSA 1O5WA 2JB1A 2Q7VA 2QAEA 4B65A 2R9ZA 4JN9A 2Q0LA 3HYVA 2JAEA 4Y4MA 3DJJA 4U8MA 3QSMA 5EOWA 1BOHA 3D1PA 2WPCA 1CHUA 3BNMA 4Z25A 4C77A 3HWIA 3B6DA 3I3UA 2YLWA 5U1OA 1CWSA 4EQXA 4YTMA 4FK1C 1PBFA 1H82A 2FJAA 3DJEA 3P4SA 4GDPA 4U8IA 4BJYA 1EBDA 2B9WA 2WESA 3M12A 4IVOB 1NG4A 4XWRA 5JCKA 2MOLA 1E1LA 2XLRA 3DGHA 3RP8A 4F67A 2Q82A 2Y6QA 3AE8A 2ZZCA 1YQ4A 3NN6X 5KMQA 1KSUA 5KOXA 1CWRA 2XFQA 1NEKA 1Y56B 1IUSA 5M0ZA 3IF9A 5LAMA 2RGJA 2R0PA 3CNJA 4G74A 4NEVA 3REDA 4U8JA 3KU9A 2C3DA 3UOZA 1VEEA 4MJWA 2YR6A 5CKUA 3NYCA 3S5WA 2YQUA 3HYWA 1E1KA 2EG3A 2ORAA 1GERA 2FJBA 2GVCA 4GUVA 4UDQA 4H4QA 2PHHA 3NYEA 1QB0A 2R0CA 2C4CA 1SEZA 2ARDA 3DK4A 1LQUA 5HBLA 4AP1A 2VSWA 2EQ8A 2R0GA 2WU5A 4BJZA 3K7QX 4LA1A 4EQSA 1GMXA 4YKFA 1Z6LA 2R4EA 2Q6UA 3AYJA 3GD3A 3H4KA 3BI4A 4A9WA 1JU2A 2EQ7A 2ZZBA 4H4XA 4Z2RA 3QVRA 1RP0A 3AB1A 3UOVA 4YKGA 1S3EA 3G5JA 2YLSA 1RHDA 4IVMB 3T2KA 3EF6A 3ITJA 5BUKA 4FK1A 3IC9A 2YAUA 2E4GA 3CIRA 3RNMA 1N1PA 3ICTA 1LJ1A 1Q1WA 4H2NA 1GNDA 3LJPA 3SY4A 3UOXA 3H8IA 3UKLA 4DNAA 4NEWA 1H81A 1GTEA 2IVEA 1GOSA 1OJ9A 2GAGB 1CWTA 3TG3A 1IUXA 1XHCA 1YKJA 3CGEA 4OVIA 1HYUA 2O9ZA 3B3RA 3EANA 1L0VA 4G73A 4BK1A 2EG4A 2TPRA 2JTRA 2FJEA 2JBVA 3UOYA 4K5RA 4FDCB 5EB5A 3L8KA 3AD9B 1MO9A 1YY5A 2DKIA 3K30A 2AQJA 3ZDNA 4NTDA 5J7XA 4CCQA 1PXAA 2ACZA 3UTEA 3AE5A 4GDEA 1ONFA 2GB0A 1B8SA 4J34A 4BV6A 1W4XA 3II4A 2C65A 2C72A 2BXSA 4OPCA 2WLXA 2EQ6A 3M13A 1RYIA 4FX9A 2BK3A 2DKHA 2VRMA 1CC6A 1E7PA 4NWZA 1TRBA 2OAMA 4APNA 3AEFA 2B9XA 1PBBA 2GH5A 1TDNA 3SM8A 5HBQA 2F5ZA 3LZXA 2UZZA 3S61A 2E1MA 3HZUA 4UDPA 2J3NA 3AE4A 1D4EA 4A6NA 2BRAA 2Q0KA 3SZFA 2RGOA 2BXRA 4OPLA 3T37A 5C3JA 3O0HA 2MOIA 3CPJG 4K7ZA 3CNPA 1ZMDA 1BGNA 3UCLA 4WH7A 1GALA 1VDCA 4JNQA 4II2A 3AWIA 1DOBA 3V76A 1GRGA 2RABA 1PN0A 2WOVA 4Z43A 3NNEA 1LPFA 1PJ7A 2A87A 3I3LA 3JSKA 2C67A 2R46A 2CULA 2JTQA 3QJ4A 3UTHA 3PO7A 3G5QA 4CCRA 3FMWA 3FOJA 3ALLA 4U8OA 1VQWA 3NH3X 1P2HA 4HB9A 3NKSA 4K22A 3NN0X 3VRBA 2BABA 3OLHA 1B37A 1GSNA 4EQWA 2EQ9A 4EMWA 3L1RA 3NHVA 1BKWA 4H4WA 4H4ZA 3VR9A 4AP3A 4B66A 2YLXA 2W0HA 1TDEA 4X4JA 4EM4A 4YT0A 1LQTA 1Y0PA 2X3NA 1IUUA 2WP6A 2ZBWA 3CNDA 1Q9IA 3I6DA 1B5QA 3K7MX 5KVIA 3SGLA 3CNSA 4OPTA 1K4QA 3ATRA 5FS6A 1LV0A 4Z24A 3KKJA 3SX6A 1K0LA 4J33A 1CJ2A 2C70A 2VQBA 2GEWA 2OALA 3EPTA 4K8DA 2PYXA 3NTDA 5LAOA 3AEAA 2QA1A 2V3AA 1BF3A 1O95A 3GMBA 1O94A 3GD4A 1GV4A 1YMLA 1BZLA 1S2YA 3QVPA 3AD8B 4CNJA 1WHBA 2MRMA 1TYPA 2BS4A 2RGHA 4LU6A 1KNPA 4H4VA 4J56A 2XLTA 3NT6A 2WHDA 4H4YA 1YMDA 4YSYA 2VOUA 2XFNA 5FS9A 1BOIA 2UZQA 4H50A 3UKAA 4BK3A 4P9SA 2NVKX 3SFEA 2XLPA 4CNKA 3OC4A 2XFUA 1NG3A 2C3CA 4WCTA 1NHQA 1MXTA 1N4WA 1Y56A 4TM3A 4ZCDA 4A5LA 4OPDA 3G5RA 2YVFA 3GWDA 3T0KA 1E1MA 2BCGG 2XFPA 3QFAA 3V3NA 4AT0A 4Y4LA 1VG9A 4I59A 1NHSA 2IFVA 5JCIA 4NNJA 3DMEA 2IVDA 2XVHA 1PBDA 2FSXA 3SZWA 1H7XA 5KXJA 2GR2A 3P4QA 1CBOA 1NDAA 3AEDA 2B7RA 4G6HA 4U8NA 1L9EA 4H4RA 1YQZA 4Z2UA 4A7AA 1EL8A 2OLNA 4U8PA 2BC0A 3F8RA 4U2SA 2XCGA 5KNLA 1XANA 2BRYA 2GV8A 3UKKA 4IV9A 1GEUA 5HBOA 1T3KA 2GF3A 3PVCA 4OPIA 3T14A 2GWFA 2Z5XA 3VR8A 4J2WA 1ZK7A 1GTHA 1HZMA 3D1CA 3DK9A 3K9RA 3LADA 1ZOYA 2C76A 3QSSA 4EM3A 1GN0A 1VG0A 1TDKA 2YG4A 3DJGX 3CMMA 3AEGA 5M10A 4YTPA 3MZZA 4TM0A 3UKFA 1E1NA 1ZP0A 1AOGA 2A8XA 1IJHA 2X8GA 4JY2A 1DJQA 2BS3A 1URHA 2GAHB 3GRSA 3V3OA 4B67A 1PJ6A 2Z5YA 2KL3A 1BGJA 1K0JA 4GCMA 4GF7A 4U2LA 3R9UA 5KMSA 1N4VA 1YQ3A 4AOSA 2X8HA 4PAAA 4H4UA 3FLHA 4TLZA 4RG4A 1MOKA 1GRBA 1QXNA 3AXBA 3C4NA 1CJCA 2JK6A 1ZDLA 2WP9A 2C66A 4EQRA 2YLZA 4EIPA 4G9KA 3COXA 4AOXA 4CY6A 2YG7A 1OJTA 2VVLG 1RHSA 2C7GA 3M0OA 1H4KX 3H8LA 1GRTA 3GK5A 3CTYA 2WDRA 5GRTA 1M64A 2R45A 3T2ZA 4EMJA 5KOWA 4PABA 3SQPA 4Z26A 3KA7A 3IPPA 3GYJA 1EL7A 1DOCA 1YMKA 4KPRA 3URHA 3AD7B 4GRTA 5J60A 1TQ1A 2WU2A 1OJAA 3ALMA 4J57A 1ZKQA 1OJCA 3AYIA 1NAAA 3RP6A 4H2RA 1TDOA 2CFYA 1JNZA 1NPXA 2GR3A 2OA1A 2B76A 1COYA 2XYOA 1ZMCA 3CPIG 5BULA 4OPUA 1GXFA 2XVIA 4AT2A 4YXDA 5HPAA 3CNTA 1X31B 4ADWA 4N9XA 3AE3A 2BK5A 2E5VA 2X99A 3AYLA 2K0ZA 2X50A 2WPEA 3DH9A 4H2QA 1TYTA 2BS2A 3CN8A 4X9MA 3UP5A 2ZZ0A 3ADAB 5CQFA 1P2EA 3R2UA 1REOA 2VQ7A 5HHFA 3GRTA 1ZY8A 2B7SA 1WV9A 3NHOX 3GYIA 2YM1A 4X9NA 3LOVA 1E0CA 3OZ2A 4A79A 4XXGA 4Z44A 1H6VA 2GR1A 1ORBA 2R4JA 3NG7X 4YWOA 3ZYXA 2YG3A 4C3XA 3Q9TA 1KNRA 1KDGA 3BHFA 3SYIA 4DSHA 3FPZA 3QSEA 4USRA 1BWCA 1F8SA 2YVGA 4E0VA 5KWFA 4K2XA 2A2KA 4TM4A 1CL0A 3P4PA 3GDNA 3KVEA 3NGCX 4U2TA 2YR5A 5IPYA 3F8DA 4A65A 3SZCA 1CC4A 4J36A 5IQ4A 3AE1A 3BI5A 3E1TA 1JRXA 2WDVA 5KVHA 2OUCA 3F4AA 3O3WA 4TM1A 4XWZA 2WS3A 2Y6RA 4GAPA 1KF6A 2X8CA 4U8LA 1EL5A 3ABVA 5HXIA 3UTFA 4OCGA 2JB3A 3GMCA 1NHPA 2CDUA 2TMDA 3HIXA 2IIDA 3HYXA 1D4CA 3KPFA 1XDIA 3KLJA 1YM9A 2WEUA 3RP7A 3NIXA 3UKPA 3DA1A 3UP4A 2XVFA 4CRTA 2WDQA 1JEHA 1S2QA 3IPOA 4CBQA 2V6OA 1KSSA 4H4SA 3GWFA 3AAYA 2WETA 2GQWA 2YLTA 5IQ1A 4U8KA 4K5SA 2YG5A 3SZ0A 2J6PA 4D03A 1NENA 2C73A 1D7LA 5BVAA 5HY5A 1D7YA 1IUTA 1VRQB 2BACA 2GR0A 4YSXA 3LXDA 4ICYA 2YM2A 3DJDA 4H2PA 4BURA 1C25A 1ELIA 4B69A 4D04A 3GDPA 4NZHA 1B4VA 1TDFA 2YVJA 4KX6A 3AE7A 4WX1A 3ILMA 2V61A 3IHGA 4C5OA 2YG6A 2XVJA 3AAXA 3FG2P 2A89A 3NRNA 3G5SA 3P3AA 4NTCA 1FECA 4G6GA 4Y4NA 3FNJA 1PXCA 1F8RA 2YLRA 1PHHA 3KPKA 3F8PA 4RG3A 3SFDA 4EIQA 5KMRA 1LTXR 2BCPA 1IUWA 4C3YA 3CGCA 4UDRA 3ICRA 1EL9A 2GRTA 3GSIA 1DNCA 3AE6A 2GMJA 4I58A 2AAQA 4DSGA 1Q1RA 1JRZA 5LV9A 2VZ2A 5GSNA 2XFOA 1PS9A 2WOIA 1DOEA 3GYXA 2BYBA 4REKA 5HYMA 3VRDB 2AR8A 2GQFA 2FJDA 1L9DA 3P4RA 1QO8A 3BI2A 4OPGA 2WPFA 2JKCA 1OKGA 1D5TA 1CC2A 2APGA 1QLBA 2HQMA 2FBWA 4ECHA 4C74A 4B1BA 4WH9A 3ATQA 1DODA 1KFYA 2IFDA 4JGTA 3NYFA 3DK8A 2JB2A 2VVLA 4JNAA 2B9YA 5C2TA 3BHKA 2XDOA 3AEBA 4USQA 5FS7A 4YSHA 1H84A 1LVLA 1F8WA 1H7WA 2VRLA 5HBPA 3AECA 3CGDA 1GRFA 3AEEA 2QA2A 3IWHA 2XVEA 1S3BA 2CVJA 4Z2TA 3NLCA 1GPEA 5FS8A 3AE9A 1L9CA 1DP2A 4H7UA 3NTAA 4H4PA 4IA6A 1F6MA 4JQ9A 4TLXA 2BK4A 2EG4B 2C64A 1N4UA 3TP9A 1CJ3A 2I0ZA 3T31A 2WP5A 5ER0A 4IA5A 4M52A 5DBJA 3OP3A 3I2VA 2YR4A 4JDRA 3C4AA 3UTNX 4O5UA 4JY3A 3NK1X 1GREA 3P9UA 1E39A 5KMPA 1DXLA 3BNUA 1RSGA 1ZOVA 3HZLA 1GRAA 2V60A 3AE2A 4EMIA 1CJ4A 3LZWA 3QFBA 2V3BA 3ICSA 1QJDA
chains in the Genus database with same CATH topology
2XLUA 1FEAA 2WBAA 1JOAA 2GMHA 3K7TA 3FIMB 3D8XA 1YS0A 1H86A 3UKQA 4GAVA 2WQYA 4YTNA 4A6NB 4J31A 3VRAA 1YT8A 1CF3A 2BC1A 2HHGA 2H89A 3P1WA 2BA9A 4YSZA 3LB8A 1UKVG 3CPHG 3FS5A 5BRTA 5KRQA 2V5ZA 5FMHA 1XPQA 3VQRA 4RSLA 1H4MX 2JTSA 1PDHA 1OJDA 4B63A 2DCQA 2YWLA 5L46A 3TG1B 3KD9A 5U63A 1PJ5A 2QCUA 3FBSA 4GR1A 1GT8A 4A99A 1F3PA 4B64A 1IUVA 4BK2A 2VVMA 5JCNA 1GRHA 1D4DA 1H83A 1M6IA 3IHMA 4O5QA 1FOHA 1PBCA 1E6EA 5EBKA 1UARA 4H4TA 3CGBA 2WOWA 4UP3A 3EAOA 4DGKA 4NTEA 3NK0X 1ZX9A 2H88A 1DJNA 2WLRA 1GESA 1JNRA 4HA6A 3T2YA 3WE0A 1FL2A 1JRYA 5JCLA 4II3A 4LIIA 4CY8A 1GETA 5JCMA 5U25A 3UTGA 3DGZA 2C75A 2NPXA 3IWAA 1PBEA 3SXIA 4ZN0A 1K0IA 1V59A 5TR3A 3ISHA 3C96A 3RHAA 3UKHA 3ALJA 4ZCCA 3NK2X 3PS9A 4B68A 5EB4A 1FCDA 3Q6JA 1PXBA 2OLOA 1FEBA 1NHRA 2XLSA 1O5WA 2JB1A 2Q7VA 2QAEA 4B65A 2R9ZA 4JN9A 2Q0LA 3HYVA 2JAEA 4Y4MA 3DJJA 4U8MA 3QSMA 5EOWA 1BOHA 3D1PA 2WPCA 1CHUA 3BNMA 4Z25A 4C77A 3HWIA 3B6DA 3I3UA 2YLWA 5U1OA 1CWSA 4EQXA 4YTMA 4FK1C 1PBFA 1H82A 2FJAA 3DJEA 3P4SA 4GDPA 4U8IA 4BJYA 1EBDA 2B9WA 2WESA 3M12A 4IVOB 1NG4A 4XWRA 5JCKA 2MOLA 1E1LA 2XLRA 3DGHA 3RP8A 4F67A 2Y6QA 3AE8A 2ZZCA 1YQ4A 3NN6X 5KMQA 1KSUA 5KOXA 1CWRA 2XFQA 1NEKA 1Y56B 1IUSA 5M0ZA 3IF9A 5LAMA 2RGJA 2R0PA 3CNJA 4G74A 4NEVA 3REDA 4U8JA 3KU9A 2C3DA 3UOZA 1VEEA 4MJWA 2YR6A 5CKUA 3NYCA 3S5WA 2YQUA 3HYWA 1E1KA 2EG3A 2ORAA 1GERA 2FJBA 2GVCA 4GUVA 4UDQA 4H4QA 2PHHA 3NYEA 1QB0A 2R0CA 2C4CA 1SEZA 2ARDA 3DK4A 1LQUA 5HBLA 4AP1A 2VSWA 2EQ8A 2R0GA 2WU5A 4BJZA 3K7QX 4LA1A 4EQSA 1GMXA 4YKFA 1Z6LA 2R4EA 2Q6UA 3AYJA 3GD3A 3H4KA 3BI4A 4A9WA 1JU2A 2EQ7A 2ZZBA 4H4XA 4Z2RA 3QVRA 1RP0A 3AB1A 3UOVA 4YKGA 1S3EA 3G5JA 2YLSA 1RHDA 4IVMB 3T2KA 3EF6A 3ITJA 5BUKA 4FK1A 3IC9A 2YAUA 2E4GA 3CIRA 3RNMA 1N1PA 3ICTA 1LJ1A 1Q1WA 4H2NA 1GNDA 3LJPA 3SY4A 3UOXA 3H8IA 3UKLA 4DNAA 4NEWA 1H81A 1GTEA 2IVEA 1GOSA 1OJ9A 2GAGB 1CWTA 3TG3A 1IUXA 1XHCA 1YKJA 3CGEA 4OVIA 1HYUA 2O9ZA 3B3RA 3EANA 1L0VA 4G73A 4BK1A 2EG4A 2TPRA 2JTRA 2FJEA 2JBVA 3UOYA 4K5RA 4FDCB 5EB5A 3L8KA 3AD9B 1MO9A 1YY5A 2DKIA 3K30A 2AQJA 3ZDNA 4NTDA 5J7XA 4CCQA 1PXAA 2ACZA 3UTEA 3AE5A 4GDEA 1ONFA 2GB0A 1B8SA 4J34A 4BV6A 1W4XA 3II4A 2C65A 2C72A 2BXSA 4OPCA 2WLXA 2EQ6A 3M13A 1RYIA 4FX9A 2BK3A 2DKHA 2VRMA 1CC6A 1E7PA 4NWZA 1TRBA 2OAMA 4APNA 3AEFA 2B9XA 1PBBA 2GH5A 1TDNA 3SM8A 5HBQA 2F5ZA 3LZXA 2UZZA 3S61A 2E1MA 3HZUA 4UDPA 2J3NA 3AE4A 1D4EA 4A6NA 2BRAA 2Q0KA 3SZFA 2RGOA 2BXRA 4OPLA 3T37A 5C3JA 3O0HA 2MOIA 3CPJG 4K7ZA 3CNPA 1ZMDA 1BGNA 3UCLA 4WH7A 1GALA 1VDCA 4JNQA 4II2A 3AWIA 1DOBA 3V76A 1GRGA 2RABA 1PN0A 2WOVA 4Z43A 3NNEA 1LPFA 1PJ7A 2A87A 3I3LA 3JSKA 2C67A 2R46A 2CULA 2JTQA 3QJ4A 3UTHA 3PO7A 3G5QA 4CCRA 3FMWA 3FOJA 3ALLA 4U8OA 1VQWA 3NH3X 1P2HA 4HB9A 3NKSA 4K22A 3NN0X 3VRBA 2BABA 3OLHA 1B37A 1GSNA 4EQWA 2EQ9A 4EMWA 3L1RA 3NHVA 1BKWA 4H4WA 4H4ZA 3VR9A 4AP3A 4B66A 2YLXA 2W0HA 1TDEA 4X4JA 4EM4A 4YT0A 1LQTA 1Y0PA 2X3NA 1IUUA 2WP6A 2ZBWA 3CNDA 1Q9IA 3I6DA 1B5QA 3K7MX 5KVIA 3SGLA 3CNSA 4OPTA 1K4QA 3ATRA 5FS6A 1LV0A 4Z24A 3KKJA 3SX6A 1K0LA 4J33A 1CJ2A 2C70A 2VQBA 2GEWA 2OALA 3EPTA 4K8DA 2PYXA 3NTDA 5LAOA 3AEAA 2QA1A 2V3AA 1BF3A 1O95A 3GMBA 1O94A 3GD4A 1GV4A 1YMLA 1BZLA 1S2YA 3QVPA 3AD8B 4CNJA 1WHBA 2MRMA 1TYPA 2BS4A 2RGHA 4LU6A 1KNPA 4H4VA 4J56A 2XLTA 3NT6A 2WHDA 4H4YA 1YMDA 4YSYA 2VOUA 2XFNA 5FS9A 1BOIA 2UZQA 4H50A 3UKAA 4BK3A 4P9SA 2NVKX 3SFEA 2XLPA 4CNKA 3OC4A 2XFUA 1NG3A 2C3CA 4WCTA 1NHQA 1MXTA 1N4WA 1Y56A 4TM3A 4ZCDA 4A5LA 4OPDA 3G5RA 2YVFA 3GWDA 3T0KA 1E1MA 2BCGG 2XFPA 3QFAA 3V3NA 4AT0A 4Y4LA 1VG9A 4I59A 1NHSA 2IFVA 5JCIA 4NNJA 3DMEA 2IVDA 2XVHA 1PBDA 2FSXA 3SZWA 1H7XA 5KXJA 2GR2A 3P4QA 1CBOA 1NDAA 3AEDA 2B7RA 4G6HA 4U8NA 1L9EA 4H4RA 1YQZA 4Z2UA 4A7AA 1EL8A 2OLNA 4U8PA 2BC0A 3F8RA 4U2SA 2XCGA 5KNLA 1XANA 2BRYA 2GV8A 3UKKA 4IV9A 1GEUA 5HBOA 1T3KA 2GF3A 3PVCA 4OPIA 3T14A 2GWFA 2Z5XA 3VR8A 4J2WA 1ZK7A 1GTHA 1HZMA 3D1CA 3DK9A 3K9RA 3LADA 1ZOYA 2C76A 3QSSA 4EM3A 1GN0A 1VG0A 1TDKA 2YG4A 3DJGX 3CMMA 3AEGA 5M10A 4YTPA 3MZZA 4TM0A 3UKFA 1E1NA 1ZP0A 1AOGA 2A8XA 1IJHA 2X8GA 4JY2A 1DJQA 2BS3A 1URHA 2GAHB 3GRSA 3V3OA 4B67A 1PJ6A 2Z5YA 2KL3A 1BGJA 1K0JA 4GCMA 4GF7A 4U2LA 3R9UA 5KMSA 1N4VA 1YQ3A 4AOSA 2X8HA 4PAAA 4H4UA 3FLHA 4TLZA 4RG4A 1MOKA 1GRBA 1QXNA 3AXBA 3C4NA 1CJCA 2JK6A 1ZDLA 2WP9A 2C66A 4EQRA 2YLZA 4EIPA 4G9KA 3COXA 4AOXA 4CY6A 2YG7A 1OJTA 2VVLG 1RHSA 2C7GA 3M0OA 1H4KX 3H8LA 1GRTA 3GK5A 3CTYA 2WDRA 5GRTA 1M64A 2R45A 3T2ZA 4EMJA 5KOWA 4PABA 3SQPA 4Z26A 3KA7A 3IPPA 3GYJA 1EL7A 1DOCA 1YMKA 4KPRA 3URHA 3AD7B 4GRTA 5J60A 1TQ1A 2WU2A 1OJAA 3ALMA 4J57A 1ZKQA 1OJCA 3AYIA 1NAAA 3RP6A 4H2RA 1TDOA 2CFYA 1JNZA 1NPXA 2GR3A 2OA1A 2B76A 1COYA 2XYOA 1ZMCA 3CPIG 5BULA 4OPUA 1GXFA 2XVIA 4AT2A 4YXDA 5HPAA 3CNTA 1X31B 4ADWA 4N9XA 3AE3A 2BK5A 2E5VA 2X99A 3AYLA 2K0ZA 2X50A 2WPEA 3DH9A 4H2QA 1TYTA 2BS2A 3CN8A 4X9MA 3UP5A 2ZZ0A 3ADAB 5CQFA 1P2EA 3R2UA 1REOA 2VQ7A 5HHFA 3GRTA 1ZY8A 2B7SA 1WV9A 3NHOX 3GYIA 2YM1A 4X9NA 3LOVA 1E0CA 3OZ2A 4A79A 4XXGA 4Z44A 1H6VA 2GR1A 1ORBA 2R4JA 3NG7X 4YWOA 3ZYXA 2YG3A 4C3XA 3Q9TA 1KNRA 1KDGA 3BHFA 3SYIA 4DSHA 3FPZA 3QSEA 4USRA 1BWCA 1F8SA 2YVGA 4E0VA 5KWFA 4K2XA 2A2KA 4TM4A 1CL0A 3P4PA 3GDNA 3KVEA 3NGCX 4U2TA 2YR5A 5IPYA 3F8DA 4A65A 3SZCA 1CC4A 4J36A 5IQ4A 3AE1A 3BI5A 3E1TA 1JRXA 2WDVA 5KVHA 2OUCA 3F4AA 3O3WA 4TM1A 4XWZA 2WS3A 2Y6RA 4GAPA 1KF6A 2X8CA 4U8LA 1EL5A 3ABVA 5HXIA 3UTFA 4OCGA 2JB3A 3GMCA 1NHPA 2CDUA 2TMDA 3HIXA 2IIDA 3HYXA 1D4CA 3KPFA 1XDIA 3KLJA 1YM9A 2WEUA 3RP7A 3NIXA 3UKPA 3DA1A 3UP4A 2XVFA 4CRTA 2WDQA 1JEHA 1S2QA 3IPOA 4CBQA 2V6OA 1KSSA 4H4SA 3GWFA 3AAYA 2WETA 2GQWA 2YLTA 5IQ1A 4U8KA 4K5SA 2YG5A 3SZ0A 2J6PA 4D03A 1NENA 2C73A 1D7LA 5BVAA 5HY5A 1D7YA 1IUTA 1VRQB 2BACA 2GR0A 4YSXA 3LXDA 4ICYA 2YM2A 3DJDA 4H2PA 4BURA 1C25A 1ELIA 4B69A 4D04A 3GDPA 4NZHA 1B4VA 1TDFA 2YVJA 4KX6A 3AE7A 4WX1A 3ILMA 2V61A 3IHGA 4C5OA 2YG6A 2XVJA 3AAXA 3FG2P 2A89A 3NRNA 3G5SA 3P3AA 4NTCA 1FECA 4G6GA 4Y4NA 3FNJA 1PXCA 1F8RA 2YLRA 1PHHA 3KPKA 3F8PA 4RG3A 3SFDA 4EIQA 5KMRA 1LTXR 2BCPA 1IUWA 4C3YA 3CGCA 4UDRA 3ICRA 1EL9A 2GRTA 3GSIA 1DNCA 3AE6A 2GMJA 4I58A 2AAQA 4DSGA 1Q1RA 1JRZA 5LV9A 2VZ2A 5GSNA 2XFOA 1PS9A 2WOIA 1DOEA 3GYXA 2BYBA 4REKA 5HYMA 3VRDB 2AR8A 2GQFA 2FJDA 1L9DA 3P4RA 1QO8A 3BI2A 4OPGA 2WPFA 2JKCA 1OKGA 1D5TA 1CC2A 2APGA 1QLBA 2HQMA 2FBWA 4ECHA 4C74A 4B1BA 4WH9A 3ATQA 1DODA 1KFYA 2IFDA 4JGTA 3NYFA 3DK8A 2JB2A 2VVLA 4JNAA 2B9YA 5C2TA 3BHKA 2XDOA 3AEBA 4USQA 5FS7A 4YSHA 1H84A 1LVLA 1F8WA 1H7WA 2VRLA 5HBPA 3AECA 3CGDA 1GRFA 3AEEA 2QA2A 3IWHA 2XVEA 1S3BA 2CVJA 4Z2TA 3NLCA 1GPEA 5FS8A 3AE9A 1L9CA 1DP2A 4H7UA 3NTAA 4H4PA 4IA6A 1F6MA 4JQ9A 4TLXA 2BK4A 2EG4B 2C64A 1N4UA 3TP9A 1CJ3A 2I0ZA 3T31A 2WP5A 5ER0A 4IA5A 4M52A 5DBJA 3OP3A 3I2VA 2YR4A 4JDRA 3C4AA 3UTNX 4O5UA 4JY3A 3NK1X 1GREA 3P9UA 1E39A 5KMPA 1DXLA 3BNUA 1RSGA 1ZOVA 3HZLA 1GRAA 2V60A 3AE2A 4EMIA 1CJ4A 3LZWA 3QFBA 2V3BA 3ICSA 1QJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLU A;  1FEA A;  2WBA A;  1JOA A;  2GMH A;  3K7T A;  3FIM B;  3D8X A;  1YS0 A;  1H86 A;  3UKQ A;  2WQY A;  4YTN A;  4A6N B;  4J31 A;  3VRA A;  1YT8 A;  1CF3 A;  2BC1 A;  2HHG A;  2H89 A;  3P1W A;  2BA9 A;  4YSZ A;  3LB8 A;  1UKV G;  3CPH G;  3FS5 A;  5BRT A;  5KRQ A;  2V5Z A;  5FMH A;  1XPQ A;  3VQR A;  4RSL A;  1H4M X;  2JTS A;  1PDH A;  1OJD A;  4B63 A;  2DCQ A;  2YWL A;  5L46 A;  3TG1 B;  3KD9 A;  5U63 A;  1PJ5 A;  2QCU A;  3FBS A;  4GR1 A;  1GT8 A;  4A99 A;  1F3P A;  4B64 A;  1IUV A;  4BK2 A;  2VVM A;  5JCN A;  1GRH A;  1D4D A;  1H83 A;  1M6I A;  3IHM A;  4O5Q A;  1FOH A;  1PBC A;  1E6E A;  5EBK A;  1UAR A;  4H4T A;  3CGB A;  2WOW A;  4UP3 A;  3EAO A;  4DGK A;  4NTE A;  3NK0 X;  1ZX9 A;  2H88 A;  1DJN A;  2WLR A;  1GES A;  1JNR A;  4HA6 A;  3WE0 A;  1FL2 A;  1JRY A;  5JCL A;  4LII A;  4CY8 A;  1GET A;  5JCM A;  5U25 A;  3UTG A;  3DGZ A;  2C75 A;  2NPX A;  3IWA A;  1PBE A;  4ZN0 A;  1K0I A;  1V59 A;  5TR3 A;  3ISH A;  3C96 A;  3RHA A;  3UKH A;  3ALJ A;  4ZCC A;  3NK2 X;  3PS9 A;  4B68 A;  5EB4 A;  1FCD A;  3Q6J A;  1PXB A;  2OLO A;  1FEB A;  1NHR A;  2XLS A;  1O5W A;  2JB1 A;  2Q7V A;  2QAE A;  4B65 A;  2R9Z A;  4JN9 A;  2Q0L A;  2JAE A;  4Y4M A;  3DJJ A;  4U8M A;  3QSM A;  5EOW A;  1BOH A;  3D1P A;  2WPC A;  1CHU A;  3BNM A;  4Z25 A;  4C77 A;  3HWI A;  3B6D A;  3I3U A;  2YLW A;  5U1O A;  1CWS A;  4EQX A;  4YTM A;  4FK1 C;  1PBF A;  1H82 A;  2FJA A;  3DJE A;  3P4S A;  4GDP A;  4U8I A;  4BJY A;  1EBD A;  2B9W A;  2WES A;  3M12 A;  4IVO B;  1NG4 A;  4XWR A;  5JCK A;  2MOL A;  1E1L A;  2XLR A;  3DGH A;  3RP8 A;  4F67 A;  2Y6Q A;  3AE8 A;  2ZZC A;  1YQ4 A;  3NN6 X;  1KSU A;  5KOX A;  1CWR A;  2XFQ A;  1NEK A;  1Y56 B;  1IUS A;  5M0Z A;  3IF9 A;  5LAM A;  2RGJ A;  2R0P A;  3CNJ A;  4NEV A;  3RED A;  4U8J A;  3KU9 A;  2C3D A;  3UOZ A;  1VEE A;  4MJW A;  2YR6 A;  5CKU A;  3NYC A;  3S5W A;  2YQU A;  1E1K A;  2EG3 A;  2ORA A;  1GER A;  2FJB A;  2GVC A;  4GUV A;  4UDQ A;  4H4Q A;  2PHH A;  3NYE A;  1QB0 A;  2R0C A;  3DK4 A;  1SEZ A;  2ARD A;  1LQU A;  5HBL A;  4AP1 A;  2VSW A;  2EQ8 A;  2R0G A;  2WU5 A;  4BJZ A;  3K7Q X;  4LA1 A;  4EQS A;  1GMX A;  4YKF A;  1Z6L A;  2R4E A;  2Q6U A;  3AYJ A;  3GD3 A;  3H4K A;  3BI4 A;  4A9W A;  1JU2 A;  2EQ7 A;  2ZZB A;  4H4X A;  4Z2R A;  3QVR A;  1RP0 A;  3AB1 A;  3UOV A;  4YKG A;  1S3E A;  3G5J A;  2YLS A;  1RHD A;  4IVM B;  3EF6 A;  3ITJ A;  5BUK A;  4FK1 A;  3IC9 A;  2YAU A;  2E4G A;  3CIR A;  3RNM A;  1N1P A;  3ICT A;  1LJ1 A;  1Q1W A;  4H2N A;  1GND A;  3LJP A;  3UOX A;  3H8I A;  3UKL A;  4DNA A;  4NEW A;  1H81 A;  1GTE A;  2IVE A;  1GOS A;  1OJ9 A;  2GAG B;  1CWT A;  3TG3 A;  1IUX A;  1XHC A;  1YKJ A;  3CGE A;  4OVI A;  1HYU A;  2O9Z A;  3B3R A;  3EAN A;  1L0V A;  4BK1 A;  2EG4 A;  2TPR A;  2JTR A;  2FJE A;  2JBV A;  3UOY A;  4K5R A;  4FDC B;  5EB5 A;  3L8K A;  3AD9 B;  1MO9 A;  1YY5 A;  2DKI A;  3K30 A;  2AQJ A;  3ZDN A;  4NTD A;  5J7X A;  4CCQ A;  1PXA A;  2ACZ A;  3UTE A;  3AE5 A;  4GDE A;  1ONF A;  2GB0 A;  1B8S A;  4J34 A;  4BV6 A;  1W4X A;  3II4 A;  2C65 A;  2C72 A;  2BXS A;  4OPC A;  2WLX A;  2EQ6 A;  3M13 A;  1RYI A;  4FX9 A;  2BK3 A;  2DKH A;  2VRM A;  1CC6 A;  1E7P A;  1TRB A;  2OAM A;  4APN A;  3AEF A;  2B9X A;  1PBB A;  2GH5 A;  1TDN A;  3SM8 A;  5HBQ A;  2F5Z A;  3LZX A;  2UZZ A;  3S61 A;  2E1M A;  3HZU A;  4UDP A;  2J3N A;  3AE4 A;  1D4E A;  4A6N A;  2Q0K A;  2RGO A;  2BXR A;  4OPL A;  3T37 A;  5C3J A;  3O0H A;  2MOI A;  3CPJ G;  4K7Z A;  3CNP A;  1ZMD A;  1BGN A;  3UCL A;  4WH7 A;  1GAL A;  1VDC A;  4JNQ A;  3AWI A;  1DOB A;  3V76 A;  1GRG A;  2RAB A;  1PN0 A;  2WOV A;  4Z43 A;  3NNE A;  1LPF A;  1PJ7 A;  2A87 A;  3I3L A;  3JSK A;  2C67 A;  2R46 A;  2CUL A;  2JTQ A;  3QJ4 A;  3UTH A;  3PO7 A;  3G5Q A;  4CCR A;  3FMW A;  3FOJ A;  3ALL A;  4U8O A;  1VQW A;  3NH3 X;  1P2H A;  4HB9 A;  3NKS A;  4K22 A;  3NN0 X;  3VRB A;  2BAB A;  3OLH A;  1B37 A;  1GSN A;  4EQW A;  2EQ9 A;  4EMW A;  3L1R A;  3NHV A;  1BKW A;  4H4W A;  4H4Z A;  3VR9 A;  4AP3 A;  4B66 A;  2YLX A;  2W0H A;  1TDE A;  4X4J A;  4EM4 A;  4YT0 A;  1LQT A;  1Y0P A;  2X3N A;  1IUU A;  2WP6 A;  2ZBW A;  3CND A;  1Q9I A;  3I6D A;  1B5Q A;  3K7M X;  5KVI A;  3SGL A;  3CNS A;  4OPT A;  1K4Q A;  3ATR A;  5FS6 A;  1LV0 A;  4Z24 A;  3KKJ A;  1K0L A;  4J33 A;  1CJ2 A;  2C70 A;  2VQB A;  2GEW A;  2OAL A;  3EPT A;  4K8D A;  2PYX A;  3NTD A;  5LAO A;  3AEA A;  2QA1 A;  2V3A A;  1BF3 A;  1O95 A;  3GMB A;  1O94 A;  3GD4 A;  1GV4 A;  1YML A;  1BZL A;  1S2Y A;  3QVP A;  3AD8 B;  4CNJ A;  1WHB A;  2MRM A;  1TYP A;  2BS4 A;  2RGH A;  4LU6 A;  1KNP A;  4H4V A;  4J56 A;  2XLT A;  3NT6 A;  2WHD A;  4H4Y A;  1YMD A;  4YSY A;  2VOU A;  2XFN A;  5FS9 A;  1BOI A;  2UZQ A;  4H50 A;  3UKA A;  4BK3 A;  4P9S A;  2NVK X;  3SFE A;  2XLP A;  4CNK A;  3OC4 A;  2XFU A;  1NG3 A;  2C3C A;  4WCT A;  1NHQ A;  1MXT A;  1N4W A;  1Y56 A;  4TM3 A;  4ZCD A;  4A5L A;  4OPD A;  3G5R A;  2YVF A;  3GWD A;  1E1M A;  2BCG G;  2XFP A;  3QFA A;  3V3N A;  4AT0 A;  4Y4L A;  1VG9 A;  4I59 A;  1NHS A;  2IFV A;  5JCI A;  2IVD A;  3DME A;  2XVH A;  1PBD A;  2FSX A;  1H7X A;  5KXJ A;  2GR2 A;  3P4Q A;  1CBO A;  1NDA A;  3AED A;  2B7R A;  4U8N A;  1L9E A;  4H4R A;  1YQZ A;  4Z2U A;  4A7A A;  1EL8 A;  2OLN A;  4U8P A;  2BC0 A;  3F8R A;  4U2S A;  2XCG A;  1XAN A;  2GV8 A;  3UKK A;  4IV9 A;  1GEU A;  5HBO A;  1T3K A;  2GF3 A;  3PVC A;  4OPI A;  3VR8 A;  2GWF A;  2Z5X A;  4J2W A;  1ZK7 A;  1GTH A;  1HZM A;  3D1C A;  3DK9 A;  3K9R A;  3LAD A;  1ZOY A;  2C76 A;  3QSS A;  4EM3 A;  1GN0 A;  1VG0 A;  1TDK A;  2YG4 A;  3DJG X;  5M10 A;  3AEG A;  4YTP A;  3MZZ A;  4TM0 A;  3UKF A;  1E1N A;  1ZP0 A;  1AOG A;  2A8X A;  1IJH A;  2X8G A;  4JY2 A;  1DJQ A;  2BS3 A;  1URH A;  2GAH B;  3GRS A;  3V3O A;  4B67 A;  1PJ6 A;  2Z5Y A;  2KL3 A;  1BGJ A;  1K0J A;  4GCM A;  4GF7 A;  4U2L A;  3R9U A;  1N4V A;  1YQ3 A;  4AOS A;  2X8H A;  4PAA A;  4H4U A;  3FLH A;  4TLZ A;  4RG4 A;  1MOK A;  1GRB A;  1QXN A;  3AXB A;  3C4N A;  1CJC A;  2JK6 A;  1ZDL A;  2WP9 A;  2C66 A;  4EQR A;  2YLZ A;  4EIP A;  3COX A;  4AOX A;  4CY6 A;  2YG7 A;  1OJT A;  2VVL G;  1RHS A;  2C7G A;  3M0O A;  1H4K X;  3H8L A;  1GRT A;  3GK5 A;  3CTY A;  2WDR A;  5GRT A;  1M64 A;  2R45 A;  4EMJ A;  5KOW A;  4PAB A;  3SQP A;  4Z26 A;  3KA7 A;  3IPP A;  3GYJ A;  1EL7 A;  1DOC A;  1YMK A;  4KPR A;  3URH A;  3AD7 B;  4GRT A;  5J60 A;  1TQ1 A;  2WU2 A;  1OJA A;  3ALM A;  4J57 A;  1ZKQ A;  1OJC A;  3AYI A;  1NAA A;  3RP6 A;  4H2R A;  1TDO A;  2CFY A;  1JNZ A;  1NPX A;  2GR3 A;  2OA1 A;  2B76 A;  1COY A;  2XYO A;  1ZMC A;  3CPI G;  5BUL A;  4OPU A;  1GXF A;  2XVI A;  4AT2 A;  4YXD A;  5HPA A;  3CNT A;  1X31 B;  4ADW A;  4N9X A;  3AE3 A;  2BK5 A;  2E5V A;  2X99 A;  3AYL A;  2K0Z A;  2X50 A;  2WPE A;  3DH9 A;  4H2Q A;  1TYT A;  2BS2 A;  3CN8 A;  4X9M A;  3UP5 A;  2ZZ0 A;  3ADA B;  5CQF A;  1P2E A;  3R2U A;  1REO A;  2VQ7 A;  5HHF A;  3GRT A;  1ZY8 A;  2B7S A;  1WV9 A;  3NHO X;  3GYI A;  2YM1 A;  4X9N A;  3LOV A;  1E0C A;  3OZ2 A;  4A79 A;  4XXG A;  4Z44 A;  1H6V A;  2GR1 A;  1ORB A;  2R4J A;  3NG7 X;  4YWO A;  3ZYX A;  2YG3 A;  4C3X A;  3Q9T A;  1KNR A;  1KDG A;  3BHF A;  4DSH A;  3FPZ A;  3QSE A;  4USR A;  1BWC A;  1F8S A;  2YVG A;  4E0V A;  5KWF A;  4K2X A;  2A2K A;  4TM4 A;  1CL0 A;  3P4P A;  3GDN A;  3KVE A;  3NGC X;  4U2T A;  2YR5 A;  5IPY A;  3F8D A;  4A65 A;  1CC4 A;  4J36 A;  5IQ4 A;  3AE1 A;  3BI5 A;  3E1T A;  1JRX A;  2WDV A;  5KVH A;  2OUC A;  3F4A A;  3O3W A;  4TM1 A;  4XWZ A;  2WS3 A;  2Y6R A;  1KF6 A;  2X8C A;  4U8L A;  1EL5 A;  3ABV A;  5HXI A;  3UTF A;  4OCG A;  2JB3 A;  3GMC A;  1NHP A;  2CDU A;  2TMD A;  3HIX A;  2IID A;  3KPF A;  1D4C A;  1XDI A;  3KLJ A;  1YM9 A;  2WEU A;  3RP7 A;  3NIX A;  3UKP A;  3DA1 A;  3UP4 A;  2XVF A;  4CRT A;  2WDQ A;  1JEH A;  1S2Q A;  3IPO A;  4CBQ A;  2V6O A;  1KSS A;  4H4S A;  3GWF A;  3AAY A;  2WET A;  2GQW A;  2YLT A;  5IQ1 A;  4U8K A;  4K5S A;  2YG5 A;  4D03 A;  2J6P A;  4EIQ A;  1NEN A;  2C73 A;  1D7L A;  5BVA A;  5HY5 A;  1D7Y A;  1IUT A;  1VRQ B;  2BAC A;  2GR0 A;  4YSX A;  3LXD A;  4ICY A;  2YM2 A;  3DJD A;  4H2P A;  4BUR A;  1C25 A;  1ELI A;  4B69 A;  4D04 A;  3GDP A;  4NZH A;  1B4V A;  1TDF A;  2YVJ A;  4KX6 A;  3AE7 A;  4WX1 A;  3ILM A;  2V61 A;  3IHG A;  4C5O A;  2YG6 A;  2XVJ A;  3AAX A;  3FG2 P;  2A89 A;  3NRN A;  3G5S A;  3P3A A;  4NTC A;  1FEC A;  4Y4N A;  3FNJ A;  1PXC A;  1F8R A;  2YLR A;  1PHH A;  4RG3 A;  3F8P A;  3SFD A;  1LTX R;  2BCP A;  1IUW A;  4C3Y A;  3CGC A;  4UDR A;  3ICR A;  1EL9 A;  2GRT A;  3GSI A;  1DNC A;  3AE6 A;  2GMJ A;  4I58 A;  2AAQ A;  4DSG A;  1Q1R A;  1JRZ A;  5LV9 A;  2VZ2 A;  5GSN A;  2XFO A;  1PS9 A;  2WOI A;  1DOE A;  4REK A;  2BYB A;  5HYM A;  3VRD B;  2AR8 A;  2GQF A;  2FJD A;  1L9D A;  3P4R A;  1QO8 A;  3BI2 A;  4OPG A;  2WPF A;  2JKC A;  1OKG A;  1D5T A;  1CC2 A;  2APG A;  1QLB A;  2HQM A;  2FBW A;  4ECH A;  4C74 A;  4B1B A;  4WH9 A;  3ATQ A;  1DOD A;  1KFY A;  2IFD A;  4JGT A;  3NYF A;  3DK8 A;  2JB2 A;  2VVL A;  4JNA A;  2B9Y A;  5C2T A;  3BHK A;  2XDO A;  3AEB A;  4USQ A;  5FS7 A;  4YSH A;  1H84 A;  1LVL A;  1F8W A;  1H7W A;  2VRL A;  5HBP A;  3AEC A;  3CGD A;  1GRF A;  3AEE A;  2QA2 A;  3IWH A;  2XVE A;  1S3B A;  2CVJ A;  4Z2T A;  3NLC A;  1GPE A;  5FS8 A;  3AE9 A;  1L9C A;  1DP2 A;  4H7U A;  3NTA A;  4H4P A;  4IA6 A;  1F6M A;  4JQ9 A;  4TLX A;  2BK4 A;  2EG4 B;  2C64 A;  1N4U A;  3TP9 A;  1CJ3 A;  2I0Z A;  2WP5 A;  5ER0 A;  4IA5 A;  4M52 A;  5DBJ A;  3OP3 A;  3I2V A;  2YR4 A;  4JDR A;  3C4A A;  3UTN X;  4O5U A;  4JY3 A;  3NK1 X;  1GRE A;  3P9U A;  1E39 A;  1DXL A;  3BNU A;  1RSG A;  1ZOV A;  3HZL A;  1GRA A;  2V60 A;  3AE2 A;  4EMI A;  1CJ4 A;  3LZW A;  3QFB A;  2V3B A;  3ICS A;  1QJD A; 
#chains in the Genus database with same CATH topology
 2XLU A;  1FEA A;  2WBA A;  1JOA A;  2GMH A;  3K7T A;  3FIM B;  3D8X A;  1YS0 A;  1H86 A;  3UKQ A;  4GAV A;  2WQY A;  4YTN A;  4A6N B;  4J31 A;  3VRA A;  1YT8 A;  1CF3 A;  2BC1 A;  2HHG A;  2H89 A;  3P1W A;  2BA9 A;  4YSZ A;  3LB8 A;  1UKV G;  3CPH G;  3FS5 A;  5BRT A;  5KRQ A;  2V5Z A;  5FMH A;  1XPQ A;  3VQR A;  4RSL A;  1H4M X;  2JTS A;  1PDH A;  1OJD A;  4B63 A;  2DCQ A;  2YWL A;  5L46 A;  3TG1 B;  3KD9 A;  5U63 A;  1PJ5 A;  2QCU A;  3FBS A;  4GR1 A;  1GT8 A;  4A99 A;  1F3P A;  4B64 A;  1IUV A;  4BK2 A;  2VVM A;  5JCN A;  1GRH A;  1D4D A;  1H83 A;  1M6I A;  3IHM A;  4O5Q A;  1FOH A;  1PBC A;  1E6E A;  5EBK A;  1UAR A;  4H4T A;  3CGB A;  2WOW A;  4UP3 A;  3EAO A;  4DGK A;  4NTE A;  3NK0 X;  1ZX9 A;  2H88 A;  1DJN A;  2WLR A;  1GES A;  1JNR A;  4HA6 A;  3T2Y A;  3WE0 A;  1FL2 A;  1JRY A;  5JCL A;  4II3 A;  4LII A;  4CY8 A;  1GET A;  5JCM A;  5U25 A;  3UTG A;  3DGZ A;  2C75 A;  2NPX A;  3IWA A;  1PBE A;  3SXI A;  4ZN0 A;  1K0I A;  1V59 A;  5TR3 A;  3ISH A;  3C96 A;  3RHA A;  3UKH A;  3ALJ A;  4ZCC A;  3NK2 X;  3PS9 A;  4B68 A;  5EB4 A;  1FCD A;  3Q6J A;  1PXB A;  2OLO A;  1FEB A;  1NHR A;  2XLS A;  1O5W A;  2JB1 A;  2Q7V A;  2QAE A;  4B65 A;  2R9Z A;  4JN9 A;  2Q0L A;  3HYV A;  2JAE A;  4Y4M A;  3DJJ A;  4U8M A;  3QSM A;  5EOW A;  1BOH A;  3D1P A;  2WPC A;  1CHU A;  3BNM A;  4Z25 A;  4C77 A;  3HWI A;  3B6D A;  3I3U A;  2YLW A;  5U1O A;  1CWS A;  4EQX A;  4YTM A;  4FK1 C;  1PBF A;  1H82 A;  2FJA A;  3DJE A;  3P4S A;  4GDP A;  4U8I A;  4BJY A;  1EBD A;  2B9W A;  2WES A;  3M12 A;  4IVO B;  1NG4 A;  4XWR A;  5JCK A;  2MOL A;  1E1L A;  2XLR A;  3DGH A;  3RP8 A;  4F67 A;  2Q82 A;  2Y6Q A;  3AE8 A;  2ZZC A;  1YQ4 A;  3NN6 X;  5KMQ A;  1KSU A;  5KOX A;  1CWR A;  2XFQ A;  1NEK A;  1Y56 B;  1IUS A;  5M0Z A;  3IF9 A;  5LAM A;  2RGJ A;  2R0P A;  3CNJ A;  4G74 A;  4NEV A;  3RED A;  4U8J A;  3KU9 A;  2C3D A;  3UOZ A;  1VEE A;  4MJW A;  2YR6 A;  5CKU A;  3NYC A;  3S5W A;  2YQU A;  3HYW A;  1E1K A;  2EG3 A;  2ORA A;  1GER A;  2FJB A;  2GVC A;  4GUV A;  4UDQ A;  4H4Q A;  2PHH A;  3NYE A;  1QB0 A;  2R0C A;  2C4C A;  1SEZ A;  2ARD A;  3DK4 A;  1LQU A;  5HBL A;  4AP1 A;  2VSW A;  2EQ8 A;  2R0G A;  2WU5 A;  4BJZ A;  3K7Q X;  4LA1 A;  4EQS A;  1GMX A;  4YKF A;  1Z6L A;  2R4E A;  2Q6U A;  3AYJ A;  3GD3 A;  3H4K A;  3BI4 A;  4A9W A;  1JU2 A;  2EQ7 A;  2ZZB A;  4H4X A;  4Z2R A;  3QVR A;  1RP0 A;  3AB1 A;  3UOV A;  4YKG A;  1S3E A;  3G5J A;  2YLS A;  1RHD A;  4IVM B;  3T2K A;  3EF6 A;  3ITJ A;  5BUK A;  4FK1 A;  3IC9 A;  2YAU A;  2E4G A;  3CIR A;  3RNM A;  1N1P A;  3ICT A;  1LJ1 A;  1Q1W A;  4H2N A;  1GND A;  3LJP A;  3SY4 A;  3UOX A;  3H8I A;  3UKL A;  4DNA A;  4NEW A;  1H81 A;  1GTE A;  2IVE A;  1GOS A;  1OJ9 A;  2GAG B;  1CWT A;  3TG3 A;  1IUX A;  1XHC A;  1YKJ A;  3CGE A;  4OVI A;  1HYU A;  2O9Z A;  3B3R A;  3EAN A;  1L0V A;  4G73 A;  4BK1 A;  2EG4 A;  2TPR A;  2JTR A;  2FJE A;  2JBV A;  3UOY A;  4K5R A;  4FDC B;  5EB5 A;  3L8K A;  3AD9 B;  1MO9 A;  1YY5 A;  2DKI A;  3K30 A;  2AQJ A;  3ZDN A;  4NTD A;  5J7X A;  4CCQ A;  1PXA A;  2ACZ A;  3UTE A;  3AE5 A;  4GDE A;  1ONF A;  2GB0 A;  1B8S A;  4J34 A;  4BV6 A;  1W4X A;  3II4 A;  2C65 A;  2C72 A;  2BXS A;  4OPC A;  2WLX A;  2EQ6 A;  3M13 A;  1RYI A;  4FX9 A;  2BK3 A;  2DKH A;  2VRM A;  1CC6 A;  1E7P A;  4NWZ A;  1TRB A;  2OAM A;  4APN A;  3AEF A;  2B9X A;  1PBB A;  2GH5 A;  1TDN A;  3SM8 A;  5HBQ A;  2F5Z A;  3LZX A;  2UZZ A;  3S61 A;  2E1M A;  3HZU A;  4UDP A;  2J3N A;  3AE4 A;  1D4E A;  4A6N A;  2BRA A;  2Q0K A;  3SZF A;  2RGO A;  2BXR A;  4OPL A;  3T37 A;  5C3J A;  3O0H A;  2MOI A;  3CPJ G;  4K7Z A;  3CNP A;  1ZMD A;  1BGN A;  3UCL A;  4WH7 A;  1GAL A;  1VDC A;  4JNQ A;  4II2 A;  3AWI A;  1DOB A;  3V76 A;  1GRG A;  2RAB A;  1PN0 A;  2WOV A;  4Z43 A;  3NNE A;  1LPF A;  1PJ7 A;  2A87 A;  3I3L A;  3JSK A;  2C67 A;  2R46 A;  2CUL A;  2JTQ A;  3QJ4 A;  3UTH A;  3PO7 A;  3G5Q A;  4CCR A;  3FMW A;  3FOJ A;  3ALL A;  4U8O A;  1VQW A;  3NH3 X;  1P2H A;  4HB9 A;  3NKS A;  4K22 A;  3NN0 X;  3VRB A;  2BAB A;  3OLH A;  1B37 A;  1GSN A;  4EQW A;  2EQ9 A;  4EMW A;  3L1R A;  3NHV A;  1BKW A;  4H4W A;  4H4Z A;  3VR9 A;  4AP3 A;  4B66 A;  2YLX A;  2W0H A;  1TDE A;  4X4J A;  4EM4 A;  4YT0 A;  1LQT A;  1Y0P A;  2X3N A;  1IUU A;  2WP6 A;  2ZBW A;  3CND A;  1Q9I A;  3I6D A;  1B5Q A;  3K7M X;  5KVI A;  3SGL A;  3CNS A;  4OPT A;  1K4Q A;  3ATR A;  5FS6 A;  1LV0 A;  4Z24 A;  3KKJ A;  3SX6 A;  1K0L A;  4J33 A;  1CJ2 A;  2C70 A;  2VQB A;  2GEW A;  2OAL A;  3EPT A;  4K8D A;  2PYX A;  3NTD A;  5LAO A;  3AEA A;  2QA1 A;  2V3A A;  1BF3 A;  1O95 A;  3GMB A;  1O94 A;  3GD4 A;  1GV4 A;  1YML A;  1BZL A;  1S2Y A;  3QVP A;  3AD8 B;  4CNJ A;  1WHB A;  2MRM A;  1TYP A;  2BS4 A;  2RGH A;  4LU6 A;  1KNP A;  4H4V A;  4J56 A;  2XLT A;  3NT6 A;  2WHD A;  4H4Y A;  1YMD A;  4YSY A;  2VOU A;  2XFN A;  5FS9 A;  1BOI A;  2UZQ A;  4H50 A;  3UKA A;  4BK3 A;  4P9S A;  2NVK X;  3SFE A;  2XLP A;  4CNK A;  3OC4 A;  2XFU A;  1NG3 A;  2C3C A;  4WCT A;  1NHQ A;  1MXT A;  1N4W A;  1Y56 A;  4TM3 A;  4ZCD A;  4A5L A;  4OPD A;  3G5R A;  2YVF A;  3GWD A;  3T0K A;  1E1M A;  2BCG G;  2XFP A;  3QFA A;  3V3N A;  4AT0 A;  4Y4L A;  1VG9 A;  4I59 A;  1NHS A;  2IFV A;  5JCI A;  4NNJ A;  3DME A;  2IVD A;  2XVH A;  1PBD A;  2FSX A;  3SZW A;  1H7X A;  5KXJ A;  2GR2 A;  3P4Q A;  1CBO A;  1NDA A;  3AED A;  2B7R A;  4G6H A;  4U8N A;  1L9E A;  4H4R A;  1YQZ A;  4Z2U A;  4A7A A;  1EL8 A;  2OLN A;  4U8P A;  2BC0 A;  3F8R A;  4U2S A;  2XCG A;  5KNL A;  1XAN A;  2BRY A;  2GV8 A;  3UKK A;  4IV9 A;  1GEU A;  5HBO A;  1T3K A;  2GF3 A;  3PVC A;  4OPI A;  3T14 A;  2GWF A;  2Z5X A;  3VR8 A;  4J2W A;  1ZK7 A;  1GTH A;  1HZM A;  3D1C A;  3DK9 A;  3K9R A;  3LAD A;  1ZOY A;  2C76 A;  3QSS A;  4EM3 A;  1GN0 A;  1VG0 A;  1TDK A;  2YG4 A;  3DJG X;  3CMM A;  3AEG A;  5M10 A;  4YTP A;  3MZZ A;  4TM0 A;  3UKF A;  1E1N A;  1ZP0 A;  1AOG A;  2A8X A;  1IJH A;  2X8G A;  4JY2 A;  1DJQ A;  2BS3 A;  1URH A;  2GAH B;  3GRS A;  3V3O A;  4B67 A;  1PJ6 A;  2Z5Y A;  2KL3 A;  1BGJ A;  1K0J A;  4GCM A;  4GF7 A;  4U2L A;  3R9U A;  5KMS A;  1N4V A;  1YQ3 A;  4AOS A;  2X8H A;  4PAA A;  4H4U A;  3FLH A;  4TLZ A;  4RG4 A;  1MOK A;  1GRB A;  1QXN A;  3AXB A;  3C4N A;  1CJC A;  2JK6 A;  1ZDL A;  2WP9 A;  2C66 A;  4EQR A;  2YLZ A;  4EIP A;  4G9K A;  3COX A;  4AOX A;  4CY6 A;  2YG7 A;  1OJT A;  2VVL G;  1RHS A;  2C7G A;  3M0O A;  1H4K X;  3H8L A;  1GRT A;  3GK5 A;  3CTY A;  2WDR A;  5GRT A;  1M64 A;  2R45 A;  3T2Z A;  4EMJ A;  5KOW A;  4PAB A;  3SQP A;  4Z26 A;  3KA7 A;  3IPP A;  3GYJ A;  1EL7 A;  1DOC A;  1YMK A;  4KPR A;  3URH A;  3AD7 B;  4GRT A;  5J60 A;  1TQ1 A;  2WU2 A;  1OJA A;  3ALM A;  4J57 A;  1ZKQ A;  1OJC A;  3AYI A;  1NAA A;  3RP6 A;  4H2R A;  1TDO A;  2CFY A;  1JNZ A;  1NPX A;  2GR3 A;  2OA1 A;  2B76 A;  1COY A;  2XYO A;  1ZMC A;  3CPI G;  5BUL A;  4OPU A;  1GXF A;  2XVI A;  4AT2 A;  4YXD A;  5HPA A;  3CNT A;  1X31 B;  4ADW A;  4N9X A;  3AE3 A;  2BK5 A;  2E5V A;  2X99 A;  3AYL A;  2K0Z A;  2X50 A;  2WPE A;  3DH9 A;  4H2Q A;  1TYT A;  2BS2 A;  3CN8 A;  4X9M A;  3UP5 A;  2ZZ0 A;  3ADA B;  5CQF A;  1P2E A;  3R2U A;  1REO A;  2VQ7 A;  5HHF A;  3GRT A;  1ZY8 A;  2B7S A;  1WV9 A;  3NHO X;  3GYI A;  2YM1 A;  4X9N A;  3LOV A;  1E0C A;  3OZ2 A;  4A79 A;  4XXG A;  4Z44 A;  1H6V A;  2GR1 A;  1ORB A;  2R4J A;  3NG7 X;  4YWO A;  3ZYX A;  2YG3 A;  4C3X A;  3Q9T A;  1KNR A;  1KDG A;  3BHF A;  3SYI A;  4DSH A;  3FPZ A;  3QSE A;  4USR A;  1BWC A;  1F8S A;  2YVG A;  4E0V A;  5KWF A;  4K2X A;  2A2K A;  4TM4 A;  1CL0 A;  3P4P A;  3GDN A;  3KVE A;  3NGC X;  4U2T A;  2YR5 A;  5IPY A;  3F8D A;  4A65 A;  3SZC A;  1CC4 A;  4J36 A;  5IQ4 A;  3AE1 A;  3BI5 A;  3E1T A;  1JRX A;  2WDV A;  5KVH A;  2OUC A;  3F4A A;  3O3W A;  4TM1 A;  4XWZ A;  2WS3 A;  2Y6R A;  4GAP A;  1KF6 A;  2X8C A;  4U8L A;  1EL5 A;  3ABV A;  5HXI A;  3UTF A;  4OCG A;  2JB3 A;  3GMC A;  1NHP A;  2CDU A;  2TMD A;  3HIX A;  2IID A;  3HYX A;  1D4C A;  3KPF A;  1XDI A;  3KLJ A;  1YM9 A;  2WEU A;  3RP7 A;  3NIX A;  3UKP A;  3DA1 A;  3UP4 A;  2XVF A;  4CRT A;  2WDQ A;  1JEH A;  1S2Q A;  3IPO A;  4CBQ A;  2V6O A;  1KSS A;  4H4S A;  3GWF A;  3AAY A;  2WET A;  2GQW A;  2YLT A;  5IQ1 A;  4U8K A;  4K5S A;  2YG5 A;  3SZ0 A;  2J6P A;  4D03 A;  1NEN A;  2C73 A;  1D7L A;  5BVA A;  5HY5 A;  1D7Y A;  1IUT A;  1VRQ B;  2BAC A;  2GR0 A;  4YSX A;  3LXD A;  4ICY A;  2YM2 A;  3DJD A;  4H2P A;  4BUR A;  1C25 A;  1ELI A;  4B69 A;  4D04 A;  3GDP A;  4NZH A;  1B4V A;  1TDF A;  2YVJ A;  4KX6 A;  3AE7 A;  4WX1 A;  3ILM A;  2V61 A;  3IHG A;  4C5O A;  2YG6 A;  2XVJ A;  3AAX A;  3FG2 P;  2A89 A;  3NRN A;  3G5S A;  3P3A A;  4NTC A;  1FEC A;  4G6G A;  4Y4N A;  3FNJ A;  1PXC A;  1F8R A;  2YLR A;  1PHH A;  3KPK A;  3F8P A;  4RG3 A;  3SFD A;  4EIQ A;  5KMR A;  1LTX R;  2BCP A;  1IUW A;  4C3Y A;  3CGC A;  4UDR A;  3ICR A;  1EL9 A;  2GRT A;  3GSI A;  1DNC A;  3AE6 A;  2GMJ A;  4I58 A;  2AAQ A;  4DSG A;  1Q1R A;  1JRZ A;  5LV9 A;  2VZ2 A;  5GSN A;  2XFO A;  1PS9 A;  2WOI A;  1DOE A;  3GYX A;  2BYB A;  4REK A;  5HYM A;  3VRD B;  2AR8 A;  2GQF A;  2FJD A;  1L9D A;  3P4R A;  1QO8 A;  3BI2 A;  4OPG A;  2WPF A;  2JKC A;  1OKG A;  1D5T A;  1CC2 A;  2APG A;  1QLB A;  2HQM A;  2FBW A;  4ECH A;  4C74 A;  4B1B A;  4WH9 A;  3ATQ A;  1DOD A;  1KFY A;  2IFD A;  4JGT A;  3NYF A;  3DK8 A;  2JB2 A;  2VVL A;  4JNA A;  2B9Y A;  5C2T A;  3BHK A;  2XDO A;  3AEB A;  4USQ A;  5FS7 A;  4YSH A;  1H84 A;  1LVL A;  1F8W A;  1H7W A;  2VRL A;  5HBP A;  3AEC A;  3CGD A;  1GRF A;  3AEE A;  2QA2 A;  3IWH A;  2XVE A;  1S3B A;  2CVJ A;  4Z2T A;  3NLC A;  1GPE A;  5FS8 A;  3AE9 A;  1L9C A;  1DP2 A;  4H7U A;  3NTA A;  4H4P A;  4IA6 A;  1F6M A;  4JQ9 A;  4TLX A;  2BK4 A;  2EG4 B;  2C64 A;  1N4U A;  3TP9 A;  1CJ3 A;  2I0Z A;  3T31 A;  2WP5 A;  5ER0 A;  4IA5 A;  4M52 A;  5DBJ A;  3OP3 A;  3I2V A;  2YR4 A;  4JDR A;  3C4A A;  3UTN X;  4O5U A;  4JY3 A;  3NK1 X;  1GRE A;  3P9U A;  1E39 A;  5KMP A;  1DXL A;  3BNU A;  1RSG A;  1ZOV A;  3HZL A;  1GRA A;  2V60 A;  3AE2 A;  4EMI A;  1CJ4 A;  3LZW A;  3QFB A;  2V3B A;  3ICS A;  1QJD A; 
#chains in the Genus database with same CATH homology
 2XLU A;  1FEA A;  2WBA A;  1JOA A;  2GMH A;  3K7T A;  3FIM B;  3D8X A;  1YS0 A;  1H86 A;  3UKQ A;  4GAV A;  2WQY A;  4YTN A;  4A6N B;  4J31 A;  3VRA A;  1YT8 A;  1CF3 A;  2BC1 A;  2HHG A;  2H89 A;  3P1W A;  2BA9 A;  4YSZ A;  3LB8 A;  1UKV G;  3CPH G;  3FS5 A;  5BRT A;  5KRQ A;  2V5Z A;  5FMH A;  1XPQ A;  3VQR A;  4RSL A;  1H4M X;  2JTS A;  1PDH A;  1OJD A;  4B63 A;  2DCQ A;  2YWL A;  5L46 A;  3TG1 B;  3KD9 A;  5U63 A;  1PJ5 A;  2QCU A;  3FBS A;  4GR1 A;  1GT8 A;  4A99 A;  1F3P A;  4B64 A;  1IUV A;  4BK2 A;  2VVM A;  5JCN A;  1GRH A;  1D4D A;  1H83 A;  1M6I A;  3IHM A;  4O5Q A;  1FOH A;  1PBC A;  1E6E A;  5EBK A;  1UAR A;  4H4T A;  3CGB A;  2WOW A;  4UP3 A;  3EAO A;  4DGK A;  4NTE A;  3NK0 X;  1ZX9 A;  2H88 A;  1DJN A;  2WLR A;  1GES A;  1JNR A;  4HA6 A;  3T2Y A;  3WE0 A;  1FL2 A;  1JRY A;  5JCL A;  4II3 A;  4LII A;  4CY8 A;  1GET A;  5JCM A;  5U25 A;  3UTG A;  3DGZ A;  2C75 A;  2NPX A;  3IWA A;  1PBE A;  3SXI A;  4ZN0 A;  1K0I A;  1V59 A;  5TR3 A;  3ISH A;  3C96 A;  3RHA A;  3UKH A;  3ALJ A;  4ZCC A;  3NK2 X;  3PS9 A;  4B68 A;  5EB4 A;  1FCD A;  3Q6J A;  1PXB A;  2OLO A;  1FEB A;  1NHR A;  2XLS A;  1O5W A;  2JB1 A;  2Q7V A;  2QAE A;  4B65 A;  2R9Z A;  4JN9 A;  2Q0L A;  3HYV A;  2JAE A;  4Y4M A;  3DJJ A;  4U8M A;  3QSM A;  5EOW A;  1BOH A;  3D1P A;  2WPC A;  1CHU A;  3BNM A;  4Z25 A;  4C77 A;  3HWI A;  3B6D A;  3I3U A;  2YLW A;  5U1O A;  1CWS A;  4EQX A;  4YTM A;  4FK1 C;  1PBF A;  1H82 A;  2FJA A;  3DJE A;  3P4S A;  4GDP A;  4U8I A;  4BJY A;  1EBD A;  2B9W A;  2WES A;  3M12 A;  4IVO B;  1NG4 A;  4XWR A;  5JCK A;  2MOL A;  1E1L A;  2XLR A;  3DGH A;  3RP8 A;  4F67 A;  2Y6Q A;  3AE8 A;  2ZZC A;  1YQ4 A;  3NN6 X;  5KMQ A;  1KSU A;  5KOX A;  1CWR A;  2XFQ A;  1NEK A;  1Y56 B;  1IUS A;  5M0Z A;  3IF9 A;  5LAM A;  2RGJ A;  2R0P A;  3CNJ A;  4G74 A;  4NEV A;  3RED A;  4U8J A;  3KU9 A;  2C3D A;  3UOZ A;  1VEE A;  4MJW A;  2YR6 A;  5CKU A;  3NYC A;  3S5W A;  2YQU A;  3HYW A;  1E1K A;  2EG3 A;  2ORA A;  1GER A;  2FJB A;  2GVC A;  4GUV A;  4UDQ A;  4H4Q A;  2PHH A;  3NYE A;  1QB0 A;  2R0C A;  2C4C A;  1SEZ A;  2ARD A;  3DK4 A;  1LQU A;  5HBL A;  4AP1 A;  2VSW A;  2EQ8 A;  2R0G A;  2WU5 A;  4BJZ A;  3K7Q X;  4LA1 A;  4EQS A;  1GMX A;  4YKF A;  1Z6L A;  2R4E A;  2Q6U A;  3AYJ A;  3GD3 A;  3H4K A;  3BI4 A;  4A9W A;  1JU2 A;  2EQ7 A;  2ZZB A;  4H4X A;  4Z2R A;  3QVR A;  1RP0 A;  3AB1 A;  3UOV A;  4YKG A;  1S3E A;  3G5J A;  2YLS A;  1RHD A;  4IVM B;  3T2K A;  3EF6 A;  3ITJ A;  5BUK A;  4FK1 A;  3IC9 A;  2YAU A;  2E4G A;  3CIR A;  3RNM A;  1N1P A;  3ICT A;  1LJ1 A;  1Q1W A;  4H2N A;  1GND A;  3LJP A;  3SY4 A;  3UOX A;  3H8I A;  3UKL A;  4DNA A;  4NEW A;  1H81 A;  1GTE A;  2IVE A;  1GOS A;  1OJ9 A;  2GAG B;  1CWT A;  3TG3 A;  1IUX A;  1XHC A;  1YKJ A;  3CGE A;  4OVI A;  1HYU A;  2O9Z A;  3B3R A;  3EAN A;  1L0V A;  4G73 A;  4BK1 A;  2EG4 A;  2TPR A;  2JTR A;  2FJE A;  2JBV A;  3UOY A;  4K5R A;  4FDC B;  5EB5 A;  3L8K A;  3AD9 B;  1MO9 A;  1YY5 A;  2DKI A;  3K30 A;  2AQJ A;  3ZDN A;  4NTD A;  5J7X A;  4CCQ A;  1PXA A;  2ACZ A;  3UTE A;  3AE5 A;  4GDE A;  1ONF A;  2GB0 A;  1B8S A;  4J34 A;  4BV6 A;  1W4X A;  3II4 A;  2C65 A;  2C72 A;  2BXS A;  4OPC A;  2WLX A;  2EQ6 A;  3M13 A;  1RYI A;  4FX9 A;  2BK3 A;  2DKH A;  2VRM A;  1CC6 A;  1E7P A;  4NWZ A;  1TRB A;  2OAM A;  4APN A;  3AEF A;  2B9X A;  1PBB A;  2GH5 A;  1TDN A;  3SM8 A;  5HBQ A;  2F5Z A;  3LZX A;  2UZZ A;  3S61 A;  2E1M A;  3HZU A;  4UDP A;  2J3N A;  3AE4 A;  1D4E A;  4A6N A;  2BRA A;  2Q0K A;  3SZF A;  2RGO A;  2BXR A;  4OPL A;  3T37 A;  5C3J A;  3O0H A;  2MOI A;  3CPJ G;  4K7Z A;  3CNP A;  1ZMD A;  1BGN A;  3UCL A;  4WH7 A;  1GAL A;  1VDC A;  4JNQ A;  4II2 A;  3AWI A;  1DOB A;  3V76 A;  1GRG A;  2RAB A;  1PN0 A;  2WOV A;  4Z43 A;  3NNE A;  1LPF A;  1PJ7 A;  2A87 A;  3I3L A;  3JSK A;  2C67 A;  2R46 A;  2CUL A;  2JTQ A;  3QJ4 A;  3UTH A;  3PO7 A;  3G5Q A;  4CCR A;  3FMW A;  3FOJ A;  3ALL A;  4U8O A;  1VQW A;  3NH3 X;  1P2H A;  4HB9 A;  3NKS A;  4K22 A;  3NN0 X;  3VRB A;  2BAB A;  3OLH A;  1B37 A;  1GSN A;  4EQW A;  2EQ9 A;  4EMW A;  3L1R A;  3NHV A;  1BKW A;  4H4W A;  4H4Z A;  3VR9 A;  4AP3 A;  4B66 A;  2YLX A;  2W0H A;  1TDE A;  4X4J A;  4EM4 A;  4YT0 A;  1LQT A;  1Y0P A;  2X3N A;  1IUU A;  2WP6 A;  2ZBW A;  3CND A;  1Q9I A;  3I6D A;  1B5Q A;  3K7M X;  5KVI A;  3SGL A;  3CNS A;  4OPT A;  1K4Q A;  3ATR A;  5FS6 A;  1LV0 A;  4Z24 A;  3KKJ A;  3SX6 A;  1K0L A;  4J33 A;  1CJ2 A;  2C70 A;  2VQB A;  2GEW A;  2OAL A;  3EPT A;  4K8D A;  2PYX A;  3NTD A;  5LAO A;  3AEA A;  2QA1 A;  2V3A A;  1BF3 A;  1O95 A;  3GMB A;  1O94 A;  3GD4 A;  1GV4 A;  1YML A;  1BZL A;  1S2Y A;  3QVP A;  3AD8 B;  4CNJ A;  1WHB A;  2MRM A;  1TYP A;  2BS4 A;  2RGH A;  4LU6 A;  1KNP A;  4H4V A;  4J56 A;  2XLT A;  3NT6 A;  2WHD A;  4H4Y A;  1YMD A;  4YSY A;  2VOU A;  2XFN A;  5FS9 A;  1BOI A;  2UZQ A;  4H50 A;  3UKA A;  4BK3 A;  4P9S A;  2NVK X;  3SFE A;  2XLP A;  4CNK A;  3OC4 A;  2XFU A;  1NG3 A;  2C3C A;  4WCT A;  1NHQ A;  1MXT A;  1N4W A;  1Y56 A;  4TM3 A;  4ZCD A;  4A5L A;  4OPD A;  3G5R A;  2YVF A;  3GWD A;  3T0K A;  1E1M A;  2BCG G;  2XFP A;  3QFA A;  3V3N A;  4AT0 A;  4Y4L A;  1VG9 A;  4I59 A;  1NHS A;  2IFV A;  5JCI A;  4NNJ A;  3DME A;  2IVD A;  2XVH A;  1PBD A;  2FSX A;  3SZW A;  1H7X A;  5KXJ A;  2GR2 A;  3P4Q A;  1CBO A;  1NDA A;  3AED A;  2B7R A;  4G6H A;  4U8N A;  1L9E A;  4H4R A;  1YQZ A;  4Z2U A;  4A7A A;  1EL8 A;  2OLN A;  4U8P A;  2BC0 A;  3F8R A;  4U2S A;  2XCG A;  5KNL A;  1XAN A;  2BRY A;  2GV8 A;  3UKK A;  4IV9 A;  1GEU A;  5HBO A;  1T3K A;  2GF3 A;  3PVC A;  4OPI A;  3T14 A;  2GWF A;  2Z5X A;  3VR8 A;  4J2W A;  1ZK7 A;  1GTH A;  1HZM A;  3D1C A;  3DK9 A;  3K9R A;  3LAD A;  1ZOY A;  2C76 A;  3QSS A;  4EM3 A;  1GN0 A;  1VG0 A;  1TDK A;  2YG4 A;  3DJG X;  3CMM A;  3AEG A;  5M10 A;  4YTP A;  3MZZ A;  4TM0 A;  3UKF A;  1E1N A;  1ZP0 A;  1AOG A;  2A8X A;  1IJH A;  2X8G A;  4JY2 A;  1DJQ A;  2BS3 A;  1URH A;  2GAH B;  3GRS A;  3V3O A;  4B67 A;  1PJ6 A;  2Z5Y A;  2KL3 A;  1BGJ A;  1K0J A;  4GCM A;  4GF7 A;  4U2L A;  3R9U A;  5KMS A;  1N4V A;  1YQ3 A;  4AOS A;  2X8H A;  4PAA A;  4H4U A;  3FLH A;  4TLZ A;  4RG4 A;  1MOK A;  1GRB A;  1QXN A;  3AXB A;  3C4N A;  1CJC A;  2JK6 A;  1ZDL A;  2WP9 A;  2C66 A;  4EQR A;  2YLZ A;  4EIP A;  4G9K A;  3COX A;  4AOX A;  4CY6 A;  2YG7 A;  1OJT A;  2VVL G;  1RHS A;  2C7G A;  3M0O A;  1H4K X;  3H8L A;  1GRT A;  3GK5 A;  3CTY A;  2WDR A;  5GRT A;  1M64 A;  2R45 A;  3T2Z A;  4EMJ A;  5KOW A;  4PAB A;  3SQP A;  4Z26 A;  3KA7 A;  3IPP A;  3GYJ A;  1EL7 A;  1DOC A;  1YMK A;  4KPR A;  3URH A;  3AD7 B;  4GRT A;  5J60 A;  1TQ1 A;  2WU2 A;  1OJA A;  3ALM A;  4J57 A;  1ZKQ A;  1OJC A;  3AYI A;  1NAA A;  3RP6 A;  4H2R A;  1TDO A;  2CFY A;  1JNZ A;  1NPX A;  2GR3 A;  2OA1 A;  2B76 A;  1COY A;  2XYO A;  1ZMC A;  3CPI G;  5BUL A;  4OPU A;  1GXF A;  2XVI A;  4AT2 A;  4YXD A;  5HPA A;  3CNT A;  1X31 B;  4ADW A;  4N9X A;  3AE3 A;  2BK5 A;  2E5V A;  2X99 A;  3AYL A;  2K0Z A;  2X50 A;  2WPE A;  3DH9 A;  4H2Q A;  1TYT A;  2BS2 A;  3CN8 A;  4X9M A;  3UP5 A;  2ZZ0 A;  3ADA B;  5CQF A;  1P2E A;  3R2U A;  1REO A;  2VQ7 A;  5HHF A;  3GRT A;  1ZY8 A;  2B7S A;  1WV9 A;  3NHO X;  3GYI A;  2YM1 A;  4X9N A;  3LOV A;  1E0C A;  3OZ2 A;  4A79 A;  4XXG A;  4Z44 A;  1H6V A;  2GR1 A;  1ORB A;  2R4J A;  3NG7 X;  4YWO A;  3ZYX A;  2YG3 A;  4C3X A;  3Q9T A;  1KNR A;  1KDG A;  3BHF A;  3SYI A;  4DSH A;  3FPZ A;  3QSE A;  4USR A;  1BWC A;  1F8S A;  2YVG A;  4E0V A;  5KWF A;  4K2X A;  2A2K A;  4TM4 A;  1CL0 A;  3P4P A;  3GDN A;  3KVE A;  3NGC X;  4U2T A;  2YR5 A;  5IPY A;  3F8D A;  4A65 A;  3SZC A;  1CC4 A;  4J36 A;  5IQ4 A;  3AE1 A;  3BI5 A;  3E1T A;  1JRX A;  2WDV A;  5KVH A;  2OUC A;  3F4A A;  3O3W A;  4TM1 A;  4XWZ A;  2WS3 A;  2Y6R A;  4GAP A;  1KF6 A;  2X8C A;  4U8L A;  1EL5 A;  3ABV A;  5HXI A;  3UTF A;  4OCG A;  2JB3 A;  3GMC A;  1NHP A;  2CDU A;  2TMD A;  3HIX A;  2IID A;  3HYX A;  1D4C A;  3KPF A;  1XDI A;  3KLJ A;  1YM9 A;  2WEU A;  3RP7 A;  3NIX A;  3UKP A;  3DA1 A;  3UP4 A;  2XVF A;  4CRT A;  2WDQ A;  1JEH A;  1S2Q A;  3IPO A;  4CBQ A;  2V6O A;  1KSS A;  4H4S A;  3GWF A;  3AAY A;  2WET A;  2GQW A;  2YLT A;  5IQ1 A;  4U8K A;  4K5S A;  2YG5 A;  3SZ0 A;  2J6P A;  4D03 A;  1NEN A;  2C73 A;  1D7L A;  5BVA A;  5HY5 A;  1D7Y A;  1IUT A;  1VRQ B;  2BAC A;  2GR0 A;  4YSX A;  3LXD A;  4ICY A;  2YM2 A;  3DJD A;  4H2P A;  4BUR A;  1C25 A;  1ELI A;  4B69 A;  4D04 A;  3GDP A;  4NZH A;  1B4V A;  1TDF A;  2YVJ A;  4KX6 A;  3AE7 A;  4WX1 A;  3ILM A;  2V61 A;  3IHG A;  4C5O A;  2YG6 A;  2XVJ A;  3AAX A;  3FG2 P;  2A89 A;  3NRN A;  3G5S A;  3P3A A;  4NTC A;  1FEC A;  4G6G A;  4Y4N A;  3FNJ A;  1PXC A;  1F8R A;  2YLR A;  1PHH A;  3KPK A;  3F8P A;  4RG3 A;  3SFD A;  4EIQ A;  5KMR A;  1LTX R;  2BCP A;  1IUW A;  4C3Y A;  3CGC A;  4UDR A;  3ICR A;  1EL9 A;  2GRT A;  3GSI A;  1DNC A;  3AE6 A;  2GMJ A;  4I58 A;  2AAQ A;  4DSG A;  1Q1R A;  1JRZ A;  5LV9 A;  2VZ2 A;  5GSN A;  2XFO A;  1PS9 A;  2WOI A;  1DOE A;  3GYX A;  2BYB A;  4REK A;  5HYM A;  3VRD B;  2AR8 A;  2GQF A;  2FJD A;  1L9D A;  3P4R A;  1QO8 A;  3BI2 A;  4OPG A;  2WPF A;  2JKC A;  1OKG A;  1D5T A;  1CC2 A;  2APG A;  1QLB A;  2HQM A;  2FBW A;  4ECH A;  4C74 A;  4B1B A;  4WH9 A;  3ATQ A;  1DOD A;  1KFY A;  2IFD A;  4JGT A;  3NYF A;  3DK8 A;  2JB2 A;  2VVL A;  4JNA A;  2B9Y A;  5C2T A;  3BHK A;  2XDO A;  3AEB A;  4USQ A;  5FS7 A;  4YSH A;  1H84 A;  1LVL A;  1F8W A;  1H7W A;  2VRL A;  5HBP A;  3AEC A;  3CGD A;  1GRF A;  3AEE A;  2QA2 A;  3IWH A;  2XVE A;  1S3B A;  2CVJ A;  4Z2T A;  3NLC A;  1GPE A;  5FS8 A;  3AE9 A;  1L9C A;  1DP2 A;  4H7U A;  3NTA A;  4H4P A;  4IA6 A;  1F6M A;  4JQ9 A;  4TLX A;  2BK4 A;  2EG4 B;  2C64 A;  1N4U A;  3TP9 A;  1CJ3 A;  2I0Z A;  3T31 A;  2WP5 A;  5ER0 A;  4IA5 A;  4M52 A;  5DBJ A;  3OP3 A;  3I2V A;  2YR4 A;  4JDR A;  3C4A A;  3UTN X;  4O5U A;  4JY3 A;  3NK1 X;  1GRE A;  3P9U A;  1E39 A;  5KMP A;  1DXL A;  3BNU A;  1RSG A;  1ZOV A;  3HZL A;  1GRA A;  2V60 A;  3AE2 A;  4EMI A;  1CJ4 A;  3LZW A;  3QFB A;  2V3B A;  3ICS A;  1QJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...