3NTDA

Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c531s mutant
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
565
structure length
565
Chain Sequence
MKKILIIGGVAGGASAAARARRLSETAEIIMFERGEYVSFANCGLPYHISGEIAQRSALVLQTPESFKARFNVEVRVKHEVVAIDRAAKLVTVRRLLDGSEYQESYDTLLLSPGAAPIVPPIPGVDNPLTHSLRNIPDMDRILQTIQMNNVEHATVVGGGFIGLEMMESLHHLGIKTTLLELADQVMTPVDREMAGFAHQAIRDQGVDLRLGTALSEVSYQVQTHVASDAAGEDTAHQHIKGHLSLTLSNGELLETDLLIMAIGVRPETQLARDAGLAIGELGGIKVNAMMQTSDPAIYAVGDAVEEQDFVTGQACLVPLAGPANRQGRMAADNMFGREERYQGTQGTAICKVFDLAVGATGKNEKQLKQAGIAFEKVYVHTASHASYYPGAEVVSFKLLFDPVKGTIFGAQAVGKDGIDKRIDVMAVAQRAGMTVEQLQHLELSYAPPYGSAKDVINQAAFVASNIIKGDATPIHFDQIDNLSEDQLLLDVRNPGELQNGGLEGAVNIPVDELRDRMHELPKDKEIIIFSQVGLRGNVAYRQLVNNGYRARNLIGGYRTYKFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization of an NADH-Dependent Persulfide Reductase from Shewanella loihica PV-4: Implications for the Mechanism of Sulfur Respiration via FAD-Dependent Enzymes .
pubmed doi rcsb
source organism Shewanella loihica
molecule tags Oxidoreductase
molecule keywords FAD-dependent pyridine nucleotide-disulphide oxidoreductase
total genus 184
structure length 565
sequence length 565
chains with identical sequence B
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2010-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3ntdA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ntdA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ntdA01
1GRFA 1RP0A 2XVJA 3AWIA 4H4SA 2Q0LA 2GR0A 2GRTA 1D4CA 1GREA 3BI5A 1CWTA 1E7PA 1GOSA 4XXGA 2FSXA 2ZBWA 3PS9A 2R0GA 4A9WA 1K0LA 2WOIA 3R2UA 3UTGA 3CNTA 2WDQA 1S2QA 3AE8A 3BI2A 2WP5A 4OPDA 3UOXA 4Z2TA 4JY3A 2Z5XA 1ELIA 2VZ2A 1IUSA 3NYCA 5CKUA 3UKPA 3UTHA 1VG0A 1YMLA 4ICYA 2GV8A 4RSLA 4EMWA 2QA2A 4U2SA 1D7LA 3VRBA 2C3CA 3I3LA 3GMBA 3K7TA 5KVIA 4ADWA 3SQPA 3DJGX 1O95A 1E0CA 4YWOA 4A7AA 3HZLA 4IA5A 3OLHA 3FS5A 3UOVA 2C3DA 3D1CA 4UDPA 1NHQA 1IUXA 3AD7B 1PJ5A 5JCNA 3DH9A 1IUWA 2Z5YA 4K7ZA 1P2HA 5C2TA 5IPYA 1FCDA 1DJQA 3LJPA 5LAMA 4ZCDA 4BV6A 4YSZA 4FK1C 2XLUA 1ZOYA 3VQRA 1CC2A 4EM3A 2CFYA 2GQWA 4B1BA 4A5LA 4EIQA 1CC4A 1OJ9A 2CDUA 1H7WA 2EQ7A 4B68A 4BK3A 2YLXA 1FECA 1JNZA 4X9NA 4OPIA 3UKHA 2HQMA 3LZXA 3ICRA 1GMXA 1H84A 2ZZBA 2YG6A 3EF6A 1BGNA 2OAMA 4C74A 2Q7VA 4A6NB 1N1PA 3BNUA 4DSGA 1YY5A 1FOHA 2X8CA 3GRTA 1IUVA 2C65A 5HHFA 2AR8A 4YSXA 4UDQA 2C67A 3F4AA 4RG4A 1IJHA 2E1MA 1PXBA 3DJJA 4FX9A 1GTHA 1PBBA 3FBSA 3GDPA 4GDPA 4BJZA 1BGJA 3CGCA 3AXBA 3ILMA 3ITJA 4Y4MA 1CJCA 1JRYA 2XYOA 3IPPA 2XLPA 3MZZA 4K22A 4GF7A 1FEAA 1PBCA 4TLXA 2WP6A 3ATRA 1XHCA 5LAOA 3UKKA 3LADA 2WLRA 4YT0A 2YLWA 2YQUA 5HXIA 1BWCA 2W0HA 3T37A 1B5QA 2WHDA 5DBJA 4GRTA 4Z2RA 5IQ4A 2CVJA 1EBDA 4TM1A 3FG2P 3DMEA 1DXLA 1LQTA 4C3YA 5L46A 4EIPA 4U8PA 3UP4A 1E1NA 2Q6UA 1H4KX 4YTNA 2BC1A 1ZOVA 1BKWA 3UKQA 3UOYA 3M0OA 2DCQA 4EQWA 3FOJA 1NAAA 1FEBA 2R4EA 3H4KA 1YT8A 2YWLA 3NN6X 3G5SA 2WP9A 3P4PA 1HZMA 2X3NA 2BCPA 2YG5A 4GCMA 1CWRA 2GMHA 4USQA 5FS8A 3VRDB 1YMKA 5M10A 1PBFA 1H7XA 2WS3A 1L9CA 1PJ6A 3DGZA 2BXSA 3NYFA 3AE1A 4X4JA 5EBKA 1VEEA 2YG3A 3DK8A 4HB9A 5KOWA 1AOGA 1SEZA 3UOZA 4YTMA 1RHSA 1S2YA 5GSNA 3GDNA 4K5RA 1B4VA 1NHSA 1LJ1A 1GRAA 1S3EA 2R46A 3AEEA 3VR8A 4OPGA 3QSMA 1TDKA 2HHGA 3IHGA 1MO9A 2WDVA 2WU5A 3UTNX 1E1KA 2GMJA 1TDFA 5FMHA 4U8MA 2VOUA 3K7MX 1TDNA 4EMJA 1V59A 4TM3A 1GEUA 1H83A 4Z43A 2DKIA 2VVLG 3AEGA 3P3AA 4NZHA 2YVGA 1URHA 3EAOA 1E39A 3DK9A 3NH3X 3BHFA 3S61A 1ZP0A 1VRQB 3E1TA 3JSKA 3VRAA 1NHRA 3II4A 2I0ZA 2EG3A 3R9UA 1OJCA 3CTYA 2YLTA 1EL8A 2BA9A 3OZ2A 4B69A 3CGEA 2YLSA 4J33A 2EG4A 2PYXA 4CCRA 5HY5A 2EQ8A 4Z25A 4C5OA 2CULA 2XLTA 3VR9A 2WPEA 2WPFA 3BNMA 4LU6A 3PO7A 3SGLA 3AE3A 2QCUA 2YLZA 1Q9IA 1MXTA 2XFOA 4AT0A 1JEHA 3F8PA 2C70A 2YLRA 1NEKA 1Y0PA 3AE7A 3UTEA 4AOXA 3NHVA 3K7QX 3NTAA 3AE4A 1TDEA 2GH5A 2IIDA 2BS2A 3GD3A 3GWDA 3H8IA 4OCGA 1Q1RA 1H82A 1P2EA 2YVJA 5U63A 1DNCA 4EQSA 3AEBA 1Z6LA 4IVOB 1GTEA 2O9ZA 3ALJA 1PS9A 2XFUA 4K5SA 2TMDA 2V5ZA 1YS0A 1YQZA 3AEAA 2X99A 3ADAB 1JRXA 2X50A 3TG1B 3KPFA 4XWZA 1QJDA 2XVIA 5HBLA 3CGBA 4YXDA 4JN9A 1QXNA 1W4XA 3CNDA 2JBVA 4H50A 1VQWA 3S5WA 3UKFA 2MRMA 4WH7A 2APGA 4DGKA 3FPZA 1F8WA 1L9EA 3G5QA 3PVCA 3NT6A 3DGHA 4WCTA 1Y56A 2V3AA 2F5ZA 2VQBA 5JCIA 3NNEA 4K8DA 3D1PA 3SM8A 3GMCA 3LZWA 3F8RA 3NG7X 3IWAA 5LV9A 5M0ZA 2GWFA 4AP3A 5HPAA 1F6MA 3AE9A 3KA7A 1KNPA 3UTFA 1GSNA 1QLBA 1PN0A 5ER0A 5BRTA 2V61A 3LOVA 4O5QA 3C96A 1T3KA 3HWIA 3Q6JA 5JCKA 2V3BA 1NPXA 1OJDA 2YR4A 3EANA 1BZLA 3CIRA 1L9DA 3RP7A 1ZK7A 3RHAA 4ZN0A 1H4MX 1S3BA 2OLOA 3QSEA 1M64A 1ZX9A 3NRNA 4B67A 4CRTA 5U1OA 2QAEA 3AE2A 4IV9A 2GR1A 2BK4A 3EPTA 1JNRA 3ALMA 1BOHA 3L1RA 1Y56B 2Q0KA 2A89A 1TQ1A 1YKJA 1C25A 4NTCA 4D03A 2R4JA 4BK2A 1PJ7A 4CNKA 1E6EA 3G5JA 3HZUA 4J31A 4FDCB 1LVLA 3KVEA 3AD9B 2WLXA 1YQ4A 4IA6A 3ZDNA 4H4VA 2BXRA 4TM4A 1PXCA 4XWRA 2YG7A 1N4WA 2VVMA 2XCGA 3UKLA 1DOEA 4PAAA 3NYEA 4BJYA 1CL0A 2GF3A 4LA1A 3KKJA 3AYIA 4FK1A 1IUUA 1GALA 2YR5A 4H2NA 4JQ9A 5HBPA 4K2XA 3P4QA 5HBQA 4UDRA 1GV4A 5GRTA 2BACA 3P4RA 4HA6A 4U8OA 4A65A 4EM4A 1D7YA 1GPEA 1ONFA 4Z24A 2BC0A 1CJ2A 3WE0A 3LB8A 2GVCA 3M12A 2ZZCA 4CCQA 1ORBA 2JB1A 2R0PA 4H4WA 1OKGA 1CJ3A 2OUCA 4Y4NA 3UP5A 3GWFA 5BULA 3NTDA 5HBOA 4JNQA 4U8IA 3V76A 3NK0X 2IVEA 2WU2A 3TG3A 5C3JA 4GR1A 5HYMA 3I3UA 5BUKA 5FS6A 1NG3A 2A2KA 2X8GA 4F67A 2XFQA 3GYIA 4EQXA 3OP3A 1WHBA 1COYA 2RGJA 3CPJG 1CJ4A 5KRQA 1H86A 3O0HA 1DP2A 3AEFA 1K0JA 3ICTA 4PABA 4BURA 2VSWA 2VQ7A 2JAEA 1VDCA 4EMIA 3AD8B 3H8LA 3CPIG 3F8DA 4APNA 2H89A 4A6NA 3I2VA 2B7RA 4LIIA 3O3WA 4UP3A 2EG4B 2KL3A 1H81A 4U8JA 5FS7A 3BHKA 2MOLA 3DA1A 4GUVA 2H88A 2WBAA 3AEDA 4H4UA 4H4PA 4Y4LA 4JDRA 4TM0A 4E0VA 3UKAA 2YM1A 3ATQA 1NG4A 4OPTA 3AYLA 1LPFA 2QA1A 3C4NA 3G5RA 4P9SA 1RSGA 2E4GA 3COXA 4REKA 1KFYA 2WEUA 3QVRA 4B66A 4B63A 4H4YA 4Z2UA 3TP9A 4DNAA 2EQ9A 1B8SA 1OJAA 1O94A 2YR6A 4OVIA 2B9YA 3ALLA 4C77A 2DKHA 3ABVA 2JTRA 2RABA 3DK4A 1CBOA 3I6DA 1ZMCA 4B65A 1O5WA 2K0ZA 2FBWA 3GK5A 2BS4A 1KSSA 4GDEA 3AAXA 1PHHA 3KD9A 4YKFA 4CNJA 4OPLA 4IVMB 2A87A 2GQFA 3KU9A 4JY2A 1KSUA 4H7UA 5TR3A 1NENA 3IHMA 2XFNA 2VVLA 1EL7A 5IQ1A 3IF9A 1GETA 2ACZA 1GT8A 1X31B 1GERA 4NTEA 1YM9A 2FJEA 2GB0A 3C4AA 1PBDA 2WQYA 4ZCCA 5KXJA 1YMDA 4USRA 2JB2A 4H4XA 3P9UA 4H2RA 3RNMA 1CF3A 1RYIA 1LV0A 1N4UA 3CNJA 4CBQA 3KLJA 1GRHA 3OC4A 4H4QA 4J34A 4I59A 2J6PA 2FJDA 3CPHG 3URHA 4CY6A 1GXFA 3NKSA 2Y6RA 1TDOA 2V60A 2OA1A 4YSYA 1JRZA 2GR2A 3AE6A 3V3OA 4X9MA 4Z44A 3NGCX 4U8KA 3AECA 4B64A 1CWSA 1EL5A 1K4QA 3FMWA 5EOWA 2XLRA 2BK3A 2BS3A 4H2PA 2B9XA 2YVFA 2NVKX 3IWHA 2WESA 3ICSA 3AB1A 4J36A 4CY8A 5CQFA 3RP6A 1DJNA 2BYBA 2PHHA 4AOSA 1IUTA 2XFPA 5KWFA 2XVEA 4U2TA 2ORAA 1GESA 1DOCA 3FLHA 1PDHA 1Q1WA 4H4TA 5FS9A 4TLZA 1QB0A 1H6VA 2RGHA 3GYJA 1TYTA 2GAHB 2A8XA 4KX6A 4U2LA 4ECHA 2JK6A 3AE5A 3BI4A 3QSSA 1L0VA 2GEWA 2OLNA 1FL2A 1KDGA 1DOBA 4OPCA 1E1MA 3B6DA 1HYUA 3NK1X 5JCLA 1F8SA 2C66A 2EQ6A 1K0IA 1ZKQA 5J7XA 1GN0A 1RHDA 4JNAA 2YAUA 5KOXA 4JGTA 3L8KA 1NDAA 1TRBA 2X8HA 4KPRA 2UZZA 2VRMA 2WOVA 1E1LA 1N4VA 3NIXA 2WPCA 5J60A 3GD4A 4D04A 3V3NA 2MOIA 1ZY8A 4BK1A 1REOA 1UKVG 2C73A 1D5TA 1ZMDA 4A99A 4EQRA 2ARDA 1BOIA 2JKCA 5BVAA 1CHUA 4OPUA 3FNJA 2IFDA 1B37A 3QJ4A 4A79A 3CNSA 4WH9A 2XVFA 4C3XA 4J56A 2UZQA 1PXAA 5JCMA 1LQUA 2V6OA 2C64A 3SFDA 1BF3A 1JU2A 2B9WA 2AAQA 3NHOX 3K30A 4MJWA 1GRBA 1PBEA 1OJTA 4U8LA 3NLCA 3GRSA 2Y6QA 3QFBA 4NEWA 4NEVA 2FJBA 2ZZ0A 2YM2A 3B3RA 5U25A 2E5VA 1MOKA 4Z26A 3IPOA 2OALA 1NHPA 2IVDA 4WX1A 1D4DA 3NK2X 4YTPA 2TPRA 2XDOA 3FIMB 4I58A 1XANA 4H2QA 4AT2A 4DSHA 2YG4A 2IFVA 3UCLA 4M52A 2JTSA 2AQJA 2B76A 3D8XA 2GR3A 3IC9A 2XVHA 3Q9TA 4H4ZA 5EB4A 3HIXA 5KVHA 2GAGB 2JTQA 1KF6A 4N9XA 4U8NA 1WV9A 2B7SA 1M6IA 2BCGG 2C7GA 1QO8A 4H4RA 1VG9A 1TYPA 3P1WA 2JB3A 4YKGA 3K9RA 2WDRA 2R9ZA 4J57A 3ISHA 4RG3A 3RP8A 3M13A 3AYJA 3CNPA 1GRGA 2BK5A 4NTDA 1DODA 3CGDA 2NPXA 2J3NA 2WETA 3QFAA 5EB5A 1EL9A 1F3PA 2XLSA 3CN8A 4J2WA 1XDIA 3ZYXA 1LTXR 3REDA 1CC6A 3P4SA 1KNRA 3SFEA 3QVPA 4YSHA 3DJDA 2R45A 2R0CA 3DJEA 1F8RA 1XPQA 2FJAA 2C72A 4O5UA 1ZDLA 1YQ3A 2C75A 2C76A 1D4EA 1GRTA 1GNDA 2BABA 1JOAA 1UARA 2WOWA 4AP1A 2VRLA 3NN0X 2RGOA 3GSIA 3AAYA 3LXDA
chains in the Genus database with same CATH superfamily
1GRFA 1RP0A 2XVJA 3AWIA 4H4SA 2Q0LA 2GR0A 2GRTA 1D4CA 1GREA 3BI5A 1CWTA 1E7PA 1GOSA 4XXGA 2FSXA 2ZBWA 3PS9A 2R0GA 4A9WA 1K0LA 2WOIA 3R2UA 3UTGA 3CNTA 2WDQA 1S2QA 3AE8A 3BI2A 2WP5A 4OPDA 3UOXA 4Z2TA 4JY3A 2Z5XA 1ELIA 2VZ2A 1IUSA 3NYCA 5CKUA 3UKPA 3UTHA 1VG0A 1YMLA 4ICYA 2GV8A 4RSLA 4EMWA 2QA2A 4U2SA 1D7LA 3VRBA 2C3CA 3I3LA 3GMBA 3K7TA 5KVIA 4ADWA 3SQPA 3DJGX 5KMRA 1O95A 1E0CA 4YWOA 4A7AA 3HZLA 4IA5A 3OLHA 3FS5A 3UOVA 2C3DA 3D1CA 4UDPA 1NHQA 1IUXA 3AD7B 1PJ5A 5JCNA 3DH9A 1IUWA 2Z5YA 4K7ZA 1P2HA 5C2TA 5IPYA 1FCDA 1DJQA 3LJPA 5LAMA 4ZCDA 4BV6A 4YSZA 4FK1C 2XLUA 1ZOYA 3SX6A 3VQRA 1CC2A 4EM3A 2CFYA 2GQWA 4B1BA 4A5LA 4EIQA 1CC4A 1OJ9A 2CDUA 1H7WA 2EQ7A 4B68A 4BK3A 2YLXA 1FECA 1JNZA 2C4CA 4X9NA 4OPIA 3UKHA 2HQMA 3LZXA 3ICRA 1GMXA 1H84A 2ZZBA 2YG6A 3EF6A 1BGNA 2OAMA 4C74A 2Q7VA 4A6NB 1N1PA 3BNUA 4G6HA 4DSGA 1YY5A 1FOHA 2X8CA 3GRTA 1IUVA 2C65A 5HHFA 2AR8A 4YSXA 4UDQA 2C67A 3F4AA 4RG4A 1IJHA 2E1MA 1PXBA 3DJJA 4FX9A 1GTHA 1PBBA 3FBSA 3GDPA 4GDPA 4BJZA 1BGJA 3CGCA 3AXBA 3ILMA 3ITJA 4Y4MA 1CJCA 1JRYA 2XYOA 3IPPA 2XLPA 3MZZA 4K22A 4GF7A 1FEAA 1PBCA 4TLXA 2WP6A 3ATRA 1XHCA 5LAOA 3UKKA 3LADA 2WLRA 4YT0A 2YLWA 2YQUA 5HXIA 1BWCA 2W0HA 3T37A 1B5QA 2WHDA 5DBJA 4GRTA 4Z2RA 5IQ4A 3T2ZA 2CVJA 1EBDA 4TM1A 3FG2P 3DMEA 1DXLA 1LQTA 3CMMA 4C3YA 5L46A 4EIPA 4U8PA 3UP4A 1E1NA 2Q6UA 1H4KX 4YTNA 2BC1A 1ZOVA 1BKWA 3UKQA 3UOYA 3M0OA 2DCQA 4EQWA 3FOJA 1NAAA 1FEBA 2R4EA 3H4KA 1YT8A 2YWLA 3NN6X 3G5SA 2WP9A 3P4PA 1HZMA 2X3NA 2BCPA 2YG5A 4GCMA 1CWRA 2GMHA 4USQA 5FS8A 3VRDB 1YMKA 3HYVA 5M10A 1PBFA 3HYWA 1H7XA 2WS3A 1L9CA 1PJ6A 3DGZA 2BXSA 3NYFA 3AE1A 4X4JA 5EBKA 1VEEA 2YG3A 3DK8A 4HB9A 5KOWA 1AOGA 4NWZA 1SEZA 3UOZA 4YTMA 1RHSA 1S2YA 5GSNA 3GDNA 4K5RA 2Q82A 1B4VA 1NHSA 1LJ1A 1GRAA 1S3EA 2R46A 3AEEA 3VR8A 4OPGA 3QSMA 1TDKA 2HHGA 3IHGA 1MO9A 2WDVA 2WU5A 3UTNX 1E1KA 2GMJA 1TDFA 5FMHA 4U8MA 2VOUA 3K7MX 1TDNA 4EMJA 1V59A 4TM3A 1GEUA 1H83A 4Z43A 2DKIA 2VVLG 3AEGA 3P3AA 4NZHA 2YVGA 1URHA 3EAOA 5KNLA 1E39A 3DK9A 3NH3X 3BHFA 3S61A 1ZP0A 1VRQB 3E1TA 3JSKA 3VRAA 1NHRA 3II4A 2I0ZA 2EG3A 3R9UA 1OJCA 3CTYA 2YLTA 1EL8A 2BA9A 3OZ2A 4B69A 3CGEA 2YLSA 4J33A 2EG4A 2PYXA 4G6GA 4CCRA 5HY5A 2EQ8A 4Z25A 4C5OA 2CULA 2XLTA 3VR9A 2WPEA 2WPFA 3BNMA 4LU6A 3PO7A 3SGLA 3AE3A 2QCUA 2YLZA 1Q9IA 1MXTA 2XFOA 4AT0A 1JEHA 3F8PA 2BRYA 2C70A 2YLRA 1NEKA 1Y0PA 3AE7A 3UTEA 4AOXA 3NHVA 3K7QX 3NTAA 3AE4A 1TDEA 3T0KA 2GH5A 2IIDA 2BS2A 3GD3A 3GWDA 3H8IA 4OCGA 1Q1RA 1H82A 1P2EA 2YVJA 5U63A 1DNCA 4EQSA 3AEBA 1Z6LA 4IVOB 1GTEA 2O9ZA 3ALJA 1PS9A 2XFUA 4K5SA 2TMDA 2V5ZA 1YS0A 1YQZA 3AEAA 5KMQA 2X99A 3ADAB 1JRXA 2X50A 3TG1B 3KPFA 4XWZA 1QJDA 2XVIA 5HBLA 3CGBA 4YXDA 4JN9A 1QXNA 1W4XA 3CNDA 2JBVA 4H50A 1VQWA 3S5WA 3UKFA 2MRMA 4WH7A 2APGA 4DGKA 3FPZA 1F8WA 1L9EA 3G5QA 3PVCA 3NT6A 3DGHA 4WCTA 1Y56A 2V3AA 2F5ZA 2VQBA 5JCIA 3NNEA 4K8DA 3D1PA 3SM8A 3GMCA 3LZWA 3F8RA 3NG7X 3IWAA 5LV9A 4G74A 5M0ZA 2GWFA 3T2YA 5HPAA 4AP3A 3T31A 1F6MA 3AE9A 3KA7A 1KNPA 3UTFA 1GSNA 1QLBA 1PN0A 5ER0A 5BRTA 2V61A 3LOVA 4O5QA 3C96A 1T3KA 3HWIA 3Q6JA 5JCKA 2V3BA 1NPXA 1OJDA 2YR4A 3EANA 1BZLA 3CIRA 1L9DA 3RP7A 1ZK7A 3RHAA 4ZN0A 1H4MX 1S3BA 2OLOA 3QSEA 1M64A 1ZX9A 3NRNA 4B67A 4CRTA 5U1OA 2QAEA 3AE2A 4IV9A 2GR1A 2BK4A 3EPTA 1JNRA 3ALMA 1BOHA 3L1RA 1Y56B 2Q0KA 2A89A 1TQ1A 1YKJA 1C25A 4NTCA 4D03A 2R4JA 4BK2A 1PJ7A 4CNKA 1E6EA 3G5JA 3HZUA 4J31A 4FDCB 1LVLA 3KVEA 3AD9B 2WLXA 1YQ4A 4IA6A 3ZDNA 4H4VA 2BXRA 4TM4A 1PXCA 4XWRA 2YG7A 1N4WA 2VVMA 2XCGA 3UKLA 1DOEA 4PAAA 3NYEA 4BJYA 1CL0A 2GF3A 4LA1A 3KKJA 3AYIA 4FK1A 1IUUA 1GALA 2YR5A 4H2NA 4JQ9A 5HBPA 4K2XA 3P4QA 5HBQA 3SZFA 4UDRA 1GV4A 5GRTA 2BACA 3P4RA 4HA6A 4U8OA 4A65A 4EM4A 5KMSA 1D7YA 1GPEA 1ONFA 4Z24A 2BC0A 1CJ2A 3WE0A 3LB8A 2GVCA 3M12A 2ZZCA 4CCQA 1ORBA 2JB1A 2R0PA 3KPKA 4H4WA 1OKGA 1CJ3A 2OUCA 4Y4NA 3UP5A 3GWFA 5BULA 3NTDA 5HBOA 4JNQA 4U8IA 3V76A 3NK0X 2IVEA 2WU2A 3TG3A 5C3JA 4GR1A 5HYMA 3I3UA 5BUKA 5FS6A 1NG3A 2A2KA 2X8GA 4F67A 2XFQA 3GYIA 4EQXA 3OP3A 3SY4A 1WHBA 1COYA 2RGJA 3CPJG 1CJ4A 5KRQA 1H86A 3O0HA 1DP2A 3AEFA 1K0JA 3ICTA 4PABA 4BURA 2VSWA 2VQ7A 2JAEA 1VDCA 4EMIA 3AD8B 3H8LA 3CPIG 3F8DA 4APNA 2H89A 4A6NA 3I2VA 2B7RA 4LIIA 3O3WA 4UP3A 2EG4B 2KL3A 1H81A 4U8JA 5FS7A 3BHKA 2MOLA 3DA1A 4GUVA 3SXIA 2H88A 2WBAA 3AEDA 4H4UA 4H4PA 4Y4LA 4JDRA 4TM0A 4E0VA 3UKAA 2YM1A 3ATQA 1NG4A 4OPTA 3AYLA 1LPFA 2QA1A 3C4NA 3G5RA 4P9SA 1RSGA 2E4GA 3COXA 4REKA 1KFYA 2WEUA 3QVRA 4B66A 4B63A 4H4YA 4Z2UA 3TP9A 4DNAA 2EQ9A 1B8SA 1OJAA 1O94A 2YR6A 4OVIA 2B9YA 3ALLA 4C77A 2DKHA 3ABVA 2JTRA 2RABA 3DK4A 1CBOA 3I6DA 1ZMCA 4B65A 1O5WA 2K0ZA 2FBWA 3GK5A 2BS4A 1KSSA 4GDEA 3AAXA 1PHHA 3SZ0A 3KD9A 4YKFA 4CNJA 4OPLA 4IVMB 2A87A 2GQFA 3KU9A 4JY2A 1KSUA 4H7UA 5TR3A 1NENA 3IHMA 2XFNA 2VVLA 3GYXA 1EL7A 5IQ1A 3IF9A 1GETA 2ACZA 1GT8A 1X31B 1GERA 4NTEA 1YM9A 2FJEA 2GB0A 3C4AA 1PBDA 4GAPA 2WQYA 4ZCCA 5KXJA 1YMDA 4USRA 2JB2A 2BRAA 3P9UA 4H2RA 4H4XA 3SYIA 3RNMA 1CF3A 1RYIA 1LV0A 1N4UA 3CNJA 4CBQA 3KLJA 1GRHA 3OC4A 4H4QA 4J34A 4I59A 2J6PA 2FJDA 3CPHG 3URHA 4CY6A 1GXFA 3NKSA 2Y6RA 1TDOA 2V60A 2OA1A 3T14A 4YSYA 1JRZA 2GR2A 3AE6A 4II3A 3V3OA 4NNJA 4X9MA 4Z44A 3NGCX 4U8KA 3AECA 4B64A 1CWSA 1EL5A 1K4QA 3FMWA 5EOWA 2XLRA 2BK3A 2BS3A 4H2PA 2B9XA 2YVFA 2NVKX 3IWHA 2WESA 3ICSA 3AB1A 4J36A 4CY8A 5CQFA 3RP6A 1DJNA 2BYBA 2PHHA 4AOSA 1IUTA 2XFPA 5KWFA 2XVEA 4U2TA 2ORAA 1GESA 4G73A 1DOCA 3FLHA 1PDHA 1Q1WA 4H4TA 5FS9A 4TLZA 1QB0A 1H6VA 4II2A 2RGHA 3GYJA 1TYTA 2GAHB 2A8XA 4KX6A 4U2LA 4ECHA 2JK6A 3AE5A 3BI4A 3QSSA 1L0VA 2GEWA 2OLNA 1FL2A 1KDGA 1DOBA 4OPCA 1E1MA 3B6DA 1HYUA 3NK1X 5JCLA 1F8SA 2C66A 2EQ6A 1K0IA 1ZKQA 5J7XA 1GN0A 1RHDA 4JNAA 2YAUA 5KOXA 4JGTA 3L8KA 1NDAA 1TRBA 2X8HA 4KPRA 2UZZA 2VRMA 2WOVA 1E1LA 1N4VA 4G9KA 3NIXA 2WPCA 5J60A 3GD4A 4D04A 3V3NA 2MOIA 1ZY8A 4BK1A 1REOA 1UKVG 2C73A 1D5TA 1ZMDA 4A99A 4EQRA 2ARDA 4GAVA 1BOIA 2JKCA 5BVAA 1CHUA 4OPUA 3FNJA 2IFDA 1B37A 3QJ4A 4A79A 3CNSA 4WH9A 2XVFA 4C3XA 4J56A 2UZQA 1PXAA 5JCMA 1LQUA 2V6OA 2C64A 3SFDA 1BF3A 1JU2A 2B9WA 2AAQA 3NHOX 3K30A 4MJWA 1GRBA 1PBEA 1OJTA 4U8LA 3NLCA 3GRSA 2Y6QA 3QFBA 4NEWA 4NEVA 2FJBA 2ZZ0A 2YM2A 3B3RA 5U25A 2E5VA 1MOKA 4Z26A 3IPOA 2OALA 1NHPA 2IVDA 4WX1A 1D4DA 3NK2X 4YTPA 2TPRA 2XDOA 3FIMB 4I58A 1XANA 4H2QA 4AT2A 4DSHA 2YG4A 2IFVA 3UCLA 4M52A 2JTSA 2AQJA 3HYXA 2B76A 3D8XA 2GR3A 5KMPA 3IC9A 2XVHA 3Q9TA 4H4ZA 5EB4A 3HIXA 5KVHA 2GAGB 2JTQA 1KF6A 4N9XA 4U8NA 1WV9A 2B7SA 1M6IA 2BCGG 2C7GA 1QO8A 4H4RA 1VG9A 1TYPA 3P1WA 2JB3A 4YKGA 3K9RA 2WDRA 2R9ZA 4J57A 3ISHA 4RG3A 3RP8A 3M13A 3SZCA 3AYJA 3CNPA 1GRGA 2BK5A 4NTDA 1DODA 3CGDA 2NPXA 2J3NA 2WETA 3QFAA 3SZWA 5EB5A 1EL9A 1F3PA 2XLSA 3CN8A 4J2WA 1XDIA 3T2KA 3ZYXA 1LTXR 3REDA 1CC6A 3P4SA 1KNRA 3SFEA 3QVPA 4YSHA 3DJDA 2R45A 2R0CA 3DJEA 1F8RA 1XPQA 2FJAA 2C72A 4O5UA 1ZDLA 1YQ3A 2C75A 2C76A 1D4EA 1GRTA 1GNDA 2BABA 1JOAA 1UARA 2WOWA 4AP1A 2VRLA 3NN0X 2RGOA 3GSIA 3AAYA 3LXDA
chains in the Genus database with same CATH topology
1GRFA 1RP0A 2XVJA 3AWIA 4H4SA 2Q0LA 2GR0A 2GRTA 1D4CA 1GREA 3BI5A 1CWTA 1E7PA 1GOSA 4XXGA 2FSXA 2ZBWA 3PS9A 2R0GA 4A9WA 1K0LA 2WOIA 3R2UA 3UTGA 3CNTA 2WDQA 1S2QA 3AE8A 3BI2A 2WP5A 4OPDA 3UOXA 4Z2TA 4JY3A 2Z5XA 1ELIA 2VZ2A 1IUSA 3NYCA 5CKUA 3UKPA 3UTHA 1VG0A 1YMLA 4ICYA 2GV8A 4RSLA 4EMWA 2QA2A 4U2SA 1D7LA 3VRBA 2C3CA 3I3LA 3GMBA 3K7TA 5KVIA 4ADWA 3SQPA 3DJGX 5KMRA 1O95A 1E0CA 4YWOA 4A7AA 3HZLA 4IA5A 3OLHA 3FS5A 3UOVA 2C3DA 3D1CA 4UDPA 1NHQA 1IUXA 3AD7B 1PJ5A 5JCNA 3DH9A 1IUWA 2Z5YA 4K7ZA 1P2HA 5C2TA 5IPYA 1FCDA 1DJQA 3LJPA 5LAMA 4ZCDA 4BV6A 4YSZA 4FK1C 2XLUA 1ZOYA 3SX6A 3VQRA 1CC2A 4EM3A 2CFYA 2GQWA 4B1BA 4A5LA 4EIQA 1CC4A 1OJ9A 2CDUA 1H7WA 2EQ7A 4B68A 4BK3A 2YLXA 1FECA 1JNZA 2C4CA 4X9NA 4OPIA 3UKHA 2HQMA 3LZXA 3ICRA 1GMXA 1H84A 2ZZBA 2YG6A 3EF6A 1BGNA 2OAMA 4C74A 2Q7VA 4A6NB 1N1PA 3BNUA 4G6HA 4DSGA 1YY5A 1FOHA 2X8CA 3GRTA 1IUVA 2C65A 5HHFA 2AR8A 4YSXA 4UDQA 2C67A 3F4AA 4RG4A 1IJHA 2E1MA 1PXBA 3DJJA 4FX9A 1GTHA 1PBBA 3FBSA 3GDPA 4GDPA 4BJZA 1BGJA 3CGCA 3AXBA 3ILMA 3ITJA 4Y4MA 1CJCA 1JRYA 2XYOA 3IPPA 2XLPA 3MZZA 4K22A 4GF7A 1FEAA 1PBCA 4TLXA 2WP6A 3ATRA 1XHCA 5LAOA 3UKKA 3LADA 2WLRA 4YT0A 2YLWA 2YQUA 5HXIA 1BWCA 2W0HA 3T37A 1B5QA 2WHDA 5DBJA 4GRTA 4Z2RA 5IQ4A 3T2ZA 2CVJA 1EBDA 4TM1A 3FG2P 3DMEA 1DXLA 1LQTA 3CMMA 4C3YA 5L46A 4EIPA 4U8PA 3UP4A 1E1NA 2Q6UA 1H4KX 4YTNA 2BC1A 1ZOVA 1BKWA 3UKQA 3UOYA 3M0OA 2DCQA 4EQWA 3FOJA 1NAAA 1FEBA 2R4EA 3H4KA 1YT8A 2YWLA 3NN6X 3G5SA 2WP9A 3P4PA 1HZMA 2X3NA 2BCPA 2YG5A 4GCMA 1CWRA 2GMHA 4USQA 5FS8A 3VRDB 1YMKA 3HYVA 5M10A 1PBFA 3HYWA 1H7XA 2WS3A 1L9CA 1PJ6A 3DGZA 2BXSA 3NYFA 3AE1A 4X4JA 5EBKA 1VEEA 2YG3A 3DK8A 4HB9A 5KOWA 1AOGA 4NWZA 1SEZA 3UOZA 4YTMA 1RHSA 1S2YA 5GSNA 3GDNA 4K5RA 1B4VA 1NHSA 1LJ1A 1GRAA 1S3EA 2R46A 3AEEA 3VR8A 4OPGA 3QSMA 1TDKA 2HHGA 3IHGA 1MO9A 2WDVA 2WU5A 3UTNX 1E1KA 2GMJA 1TDFA 5FMHA 4U8MA 2VOUA 3K7MX 1TDNA 4EMJA 1V59A 4TM3A 1GEUA 1H83A 4Z43A 2DKIA 2VVLG 3AEGA 3P3AA 4NZHA 2YVGA 1URHA 3EAOA 5KNLA 1E39A 3DK9A 3NH3X 3BHFA 3S61A 1ZP0A 1VRQB 3E1TA 3JSKA 3VRAA 1NHRA 3II4A 2I0ZA 2EG3A 3R9UA 1OJCA 3CTYA 2YLTA 1EL8A 2BA9A 3OZ2A 4B69A 3CGEA 2YLSA 4J33A 2EG4A 2PYXA 4G6GA 4CCRA 5HY5A 2EQ8A 4Z25A 4C5OA 2CULA 2XLTA 3VR9A 2WPEA 2WPFA 3BNMA 4LU6A 3PO7A 3SGLA 3AE3A 2QCUA 2YLZA 1Q9IA 1MXTA 2XFOA 4AT0A 1JEHA 3F8PA 2BRYA 2C70A 2YLRA 1NEKA 1Y0PA 3AE7A 3UTEA 4AOXA 3NHVA 3K7QX 3NTAA 3AE4A 1TDEA 3T0KA 2GH5A 2IIDA 2BS2A 3GD3A 3GWDA 3H8IA 4OCGA 1Q1RA 1H82A 1P2EA 2YVJA 5U63A 1DNCA 4EQSA 3AEBA 1Z6LA 4IVOB 1GTEA 2O9ZA 3ALJA 1PS9A 2XFUA 4K5SA 2TMDA 2V5ZA 1YS0A 1YQZA 3AEAA 5KMQA 2X99A 3ADAB 1JRXA 2X50A 3TG1B 3KPFA 4XWZA 1QJDA 2XVIA 5HBLA 3CGBA 4YXDA 4JN9A 1QXNA 1W4XA 3CNDA 2JBVA 4H50A 1VQWA 3S5WA 3UKFA 2MRMA 4WH7A 2APGA 4DGKA 3FPZA 1F8WA 1L9EA 3G5QA 3PVCA 3NT6A 3DGHA 4WCTA 1Y56A 2V3AA 2F5ZA 2VQBA 5JCIA 3NNEA 4K8DA 3D1PA 3SM8A 3GMCA 3LZWA 3F8RA 3NG7X 3IWAA 5LV9A 4G74A 5M0ZA 2GWFA 3T2YA 5HPAA 4AP3A 3T31A 1F6MA 3AE9A 3KA7A 1KNPA 3UTFA 1GSNA 1QLBA 1PN0A 5ER0A 5BRTA 2V61A 3LOVA 4O5QA 3C96A 1T3KA 3HWIA 3Q6JA 5JCKA 2V3BA 1NPXA 1OJDA 2YR4A 3EANA 1BZLA 3CIRA 1L9DA 3RP7A 1ZK7A 3RHAA 4ZN0A 1H4MX 1S3BA 2OLOA 3QSEA 1M64A 1ZX9A 3NRNA 4B67A 4CRTA 5U1OA 2QAEA 3AE2A 4IV9A 2GR1A 2BK4A 3EPTA 1JNRA 3ALMA 1BOHA 3L1RA 1Y56B 2Q0KA 2A89A 1TQ1A 1YKJA 1C25A 4NTCA 4D03A 2R4JA 4BK2A 1PJ7A 4CNKA 1E6EA 3G5JA 3HZUA 4J31A 4FDCB 1LVLA 3KVEA 3AD9B 2WLXA 1YQ4A 4IA6A 3ZDNA 4H4VA 2BXRA 4TM4A 1PXCA 4XWRA 2YG7A 1N4WA 2VVMA 2XCGA 3UKLA 1DOEA 4PAAA 3NYEA 4BJYA 1CL0A 2GF3A 4LA1A 3KKJA 3AYIA 4FK1A 1IUUA 1GALA 2YR5A 4H2NA 4JQ9A 5HBPA 4K2XA 3P4QA 5HBQA 3SZFA 4UDRA 1GV4A 5GRTA 2BACA 3P4RA 4HA6A 4U8OA 4A65A 4EM4A 5KMSA 1D7YA 1GPEA 1ONFA 4Z24A 2BC0A 1CJ2A 3WE0A 3LB8A 2GVCA 3M12A 2ZZCA 4CCQA 1ORBA 2JB1A 2R0PA 3KPKA 4H4WA 1OKGA 1CJ3A 2OUCA 4Y4NA 3UP5A 3GWFA 5BULA 3NTDA 5HBOA 4JNQA 4U8IA 3V76A 3NK0X 2IVEA 2WU2A 3TG3A 5C3JA 4GR1A 5HYMA 3I3UA 5BUKA 5FS6A 1NG3A 2A2KA 2X8GA 4F67A 2XFQA 3GYIA 4EQXA 3OP3A 3SY4A 1WHBA 1COYA 2RGJA 3CPJG 1CJ4A 5KRQA 1H86A 3O0HA 1DP2A 3AEFA 1K0JA 3ICTA 4PABA 4BURA 2VSWA 2VQ7A 2JAEA 1VDCA 4EMIA 3AD8B 3H8LA 3CPIG 3F8DA 4APNA 2H89A 4A6NA 3I2VA 2B7RA 4LIIA 3O3WA 4UP3A 2EG4B 2KL3A 1H81A 4U8JA 5FS7A 3BHKA 2MOLA 3DA1A 4GUVA 3SXIA 2H88A 2WBAA 3AEDA 4H4UA 4H4PA 4Y4LA 4JDRA 4TM0A 4E0VA 3UKAA 2YM1A 3ATQA 1NG4A 4OPTA 3AYLA 1LPFA 2QA1A 3C4NA 3G5RA 4P9SA 1RSGA 2E4GA 3COXA 4REKA 1KFYA 2WEUA 3QVRA 4B66A 4B63A 4H4YA 4Z2UA 3TP9A 4DNAA 2EQ9A 1B8SA 1OJAA 1O94A 2YR6A 4OVIA 2B9YA 3ALLA 4C77A 2DKHA 3ABVA 2JTRA 2RABA 3DK4A 1CBOA 3I6DA 1ZMCA 4B65A 1O5WA 2K0ZA 2FBWA 3GK5A 2BS4A 1KSSA 4GDEA 3AAXA 1PHHA 3SZ0A 3KD9A 4YKFA 4CNJA 4OPLA 4IVMB 2A87A 2GQFA 3KU9A 4JY2A 1KSUA 4H7UA 5TR3A 1NENA 3IHMA 2XFNA 2VVLA 3GYXA 1EL7A 5IQ1A 3IF9A 1GETA 2ACZA 1GT8A 1X31B 1GERA 4NTEA 1YM9A 2FJEA 2GB0A 3C4AA 1PBDA 4GAPA 2WQYA 4ZCCA 5KXJA 1YMDA 4USRA 2JB2A 2BRAA 3P9UA 4H2RA 4H4XA 3SYIA 3RNMA 1CF3A 1RYIA 1LV0A 1N4UA 3CNJA 4CBQA 3KLJA 1GRHA 3OC4A 4H4QA 4J34A 4I59A 2J6PA 2FJDA 3CPHG 3URHA 4CY6A 1GXFA 3NKSA 2Y6RA 1TDOA 2V60A 2OA1A 3T14A 4YSYA 1JRZA 2GR2A 3AE6A 4II3A 3V3OA 4NNJA 4X9MA 4Z44A 3NGCX 4U8KA 3AECA 4B64A 1CWSA 1EL5A 1K4QA 3FMWA 5EOWA 2XLRA 2BK3A 2BS3A 4H2PA 2B9XA 2YVFA 2NVKX 3IWHA 2WESA 3ICSA 3AB1A 4J36A 4CY8A 5CQFA 3RP6A 1DJNA 2BYBA 2PHHA 4AOSA 1IUTA 2XFPA 5KWFA 2XVEA 4U2TA 2ORAA 1GESA 4G73A 1DOCA 3FLHA 1PDHA 1Q1WA 4H4TA 5FS9A 4TLZA 1QB0A 1H6VA 4II2A 2RGHA 3GYJA 1TYTA 2GAHB 2A8XA 4KX6A 4U2LA 4ECHA 2JK6A 3AE5A 3BI4A 3QSSA 1L0VA 2GEWA 2OLNA 1FL2A 1KDGA 1DOBA 4OPCA 1E1MA 3B6DA 1HYUA 3NK1X 5JCLA 1F8SA 2C66A 2EQ6A 1K0IA 1ZKQA 5J7XA 1GN0A 1RHDA 4JNAA 2YAUA 5KOXA 4JGTA 3L8KA 1NDAA 1TRBA 2X8HA 4KPRA 2UZZA 2VRMA 2WOVA 1E1LA 1N4VA 4G9KA 3NIXA 2WPCA 5J60A 3GD4A 4D04A 3V3NA 2MOIA 1ZY8A 4BK1A 1REOA 1UKVG 2C73A 1D5TA 1ZMDA 4A99A 4EQRA 2ARDA 4GAVA 1BOIA 2JKCA 5BVAA 1CHUA 4OPUA 3FNJA 2IFDA 1B37A 3QJ4A 4A79A 3CNSA 4WH9A 2XVFA 4C3XA 4J56A 2UZQA 1PXAA 5JCMA 1LQUA 2V6OA 2C64A 3SFDA 1BF3A 1JU2A 2B9WA 2AAQA 3NHOX 3K30A 4MJWA 1GRBA 1PBEA 1OJTA 4U8LA 3NLCA 3GRSA 2Y6QA 3QFBA 4NEWA 4NEVA 2FJBA 2ZZ0A 2YM2A 3B3RA 5U25A 2E5VA 1MOKA 4Z26A 3IPOA 2OALA 1NHPA 2IVDA 4WX1A 1D4DA 3NK2X 4YTPA 2TPRA 2XDOA 3FIMB 4I58A 1XANA 4H2QA 4AT2A 4DSHA 2YG4A 2IFVA 3UCLA 4M52A 2JTSA 2AQJA 3HYXA 2B76A 3D8XA 2GR3A 5KMPA 3IC9A 2XVHA 3Q9TA 4H4ZA 5EB4A 3HIXA 5KVHA 2GAGB 2JTQA 1KF6A 4N9XA 4U8NA 1WV9A 2B7SA 1M6IA 2BCGG 2C7GA 1QO8A 4H4RA 1VG9A 1TYPA 3P1WA 2JB3A 4YKGA 3K9RA 2WDRA 2R9ZA 4J57A 3ISHA 4RG3A 3RP8A 3M13A 3SZCA 3AYJA 3CNPA 1GRGA 2BK5A 4NTDA 1DODA 3CGDA 2NPXA 2J3NA 2WETA 3QFAA 3SZWA 5EB5A 1EL9A 1F3PA 2XLSA 3CN8A 4J2WA 1XDIA 3T2KA 3ZYXA 1LTXR 3REDA 1CC6A 3P4SA 1KNRA 3SFEA 3QVPA 4YSHA 3DJDA 2R45A 2R0CA 3DJEA 1F8RA 1XPQA 2FJAA 2C72A 4O5UA 1ZDLA 1YQ3A 2C75A 2C76A 1D4EA 1GRTA 1GNDA 2BABA 1JOAA 1UARA 2WOWA 4AP1A 2VRLA 3NN0X 2RGOA 3GSIA 3AAYA 3LXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GRF A;  1RP0 A;  2XVJ A;  3AWI A;  4H4S A;  2Q0L A;  2GR0 A;  2GRT A;  1D4C A;  1GRE A;  3BI5 A;  1CWT A;  1E7P A;  1GOS A;  4XXG A;  2FSX A;  2ZBW A;  3PS9 A;  2R0G A;  4A9W A;  1K0L A;  2WOI A;  3R2U A;  3UTG A;  3CNT A;  2WDQ A;  1S2Q A;  3AE8 A;  3BI2 A;  2WP5 A;  4OPD A;  3UOX A;  4Z2T A;  4JY3 A;  2Z5X A;  1ELI A;  2VZ2 A;  1IUS A;  3NYC A;  5CKU A;  3UKP A;  3UTH A;  1VG0 A;  1YML A;  4ICY A;  2GV8 A;  4RSL A;  4EMW A;  2QA2 A;  4U2S A;  1D7L A;  3VRB A;  2C3C A;  3I3L A;  3GMB A;  3K7T A;  5KVI A;  4ADW A;  3SQP A;  3DJG X;  1O95 A;  1E0C A;  4YWO A;  4A7A A;  3HZL A;  4IA5 A;  3OLH A;  3FS5 A;  3UOV A;  2C3D A;  3D1C A;  4UDP A;  1NHQ A;  1IUX A;  3AD7 B;  1PJ5 A;  5JCN A;  3DH9 A;  1IUW A;  2Z5Y A;  4K7Z A;  1P2H A;  5C2T A;  5IPY A;  1FCD A;  1DJQ A;  3LJP A;  5LAM A;  4ZCD A;  4BV6 A;  4YSZ A;  4FK1 C;  2XLU A;  1ZOY A;  3VQR A;  1CC2 A;  4EM3 A;  2CFY A;  2GQW A;  4B1B A;  4A5L A;  4EIQ A;  1CC4 A;  1OJ9 A;  2CDU A;  1H7W A;  2EQ7 A;  4B68 A;  4BK3 A;  2YLX A;  1FEC A;  1JNZ A;  4X9N A;  4OPI A;  3UKH A;  2HQM A;  3LZX A;  3ICR A;  1GMX A;  1H84 A;  2ZZB A;  2YG6 A;  3EF6 A;  1BGN A;  2OAM A;  4C74 A;  2Q7V A;  4A6N B;  1N1P A;  3BNU A;  4DSG A;  1YY5 A;  1FOH A;  2X8C A;  3GRT A;  1IUV A;  2C65 A;  5HHF A;  2AR8 A;  4YSX A;  4UDQ A;  2C67 A;  3F4A A;  4RG4 A;  1IJH A;  2E1M A;  1PXB A;  3DJJ A;  4FX9 A;  1GTH A;  1PBB A;  3FBS A;  3GDP A;  4GDP A;  4BJZ A;  1BGJ A;  3CGC A;  3AXB A;  3ILM A;  3ITJ A;  4Y4M A;  1CJC A;  1JRY A;  2XYO A;  3IPP A;  2XLP A;  3MZZ A;  4K22 A;  4GF7 A;  1FEA A;  1PBC A;  4TLX A;  2WP6 A;  3ATR A;  1XHC A;  5LAO A;  3UKK A;  3LAD A;  2WLR A;  4YT0 A;  2YLW A;  2YQU A;  5HXI A;  1BWC A;  2W0H A;  3T37 A;  1B5Q A;  2WHD A;  5DBJ A;  4GRT A;  4Z2R A;  5IQ4 A;  2CVJ A;  1EBD A;  4TM1 A;  3FG2 P;  3DME A;  1DXL A;  1LQT A;  4C3Y A;  5L46 A;  4EIP A;  4U8P A;  3UP4 A;  1E1N A;  2Q6U A;  1H4K X;  4YTN A;  2BC1 A;  1ZOV A;  1BKW A;  3UKQ A;  3UOY A;  3M0O A;  2DCQ A;  4EQW A;  3FOJ A;  1NAA A;  1FEB A;  2R4E A;  3H4K A;  1YT8 A;  2YWL A;  3NN6 X;  3G5S A;  2WP9 A;  3P4P A;  1HZM A;  2X3N A;  2BCP A;  2YG5 A;  4GCM A;  1CWR A;  2GMH A;  4USQ A;  5FS8 A;  3VRD B;  1YMK A;  5M10 A;  1PBF A;  1H7X A;  2WS3 A;  1L9C A;  1PJ6 A;  3DGZ A;  2BXS A;  3NYF A;  3AE1 A;  4X4J A;  5EBK A;  1VEE A;  2YG3 A;  3DK8 A;  4HB9 A;  5KOW A;  1AOG A;  1SEZ A;  3UOZ A;  4YTM A;  1RHS A;  1S2Y A;  5GSN A;  3GDN A;  4K5R A;  1B4V A;  1NHS A;  1LJ1 A;  1GRA A;  1S3E A;  2R46 A;  3AEE A;  3VR8 A;  4OPG A;  3QSM A;  1TDK A;  2HHG A;  3IHG A;  1MO9 A;  2WDV A;  2WU5 A;  3UTN X;  1E1K A;  2GMJ A;  1TDF A;  5FMH A;  4U8M A;  2VOU A;  3K7M X;  1TDN A;  4EMJ A;  1V59 A;  4TM3 A;  1GEU A;  1H83 A;  4Z43 A;  2DKI A;  2VVL G;  3AEG A;  3P3A A;  4NZH A;  2YVG A;  1URH A;  3EAO A;  1E39 A;  3DK9 A;  3NH3 X;  3BHF A;  3S61 A;  1ZP0 A;  1VRQ B;  3E1T A;  3JSK A;  3VRA A;  1NHR A;  3II4 A;  2I0Z A;  2EG3 A;  3R9U A;  1OJC A;  3CTY A;  2YLT A;  1EL8 A;  2BA9 A;  3OZ2 A;  4B69 A;  3CGE A;  2YLS A;  4J33 A;  2EG4 A;  2PYX A;  4CCR A;  5HY5 A;  2EQ8 A;  4Z25 A;  4C5O A;  2CUL A;  2XLT A;  3VR9 A;  2WPE A;  2WPF A;  3BNM A;  4LU6 A;  3PO7 A;  3SGL A;  3AE3 A;  2QCU A;  2YLZ A;  1Q9I A;  1MXT A;  2XFO A;  4AT0 A;  1JEH A;  3F8P A;  2C70 A;  2YLR A;  1NEK A;  1Y0P A;  3AE7 A;  3UTE A;  4AOX A;  3NHV A;  3K7Q X;  3NTA A;  3AE4 A;  1TDE A;  2GH5 A;  2IID A;  2BS2 A;  3GD3 A;  3GWD A;  3H8I A;  4OCG A;  1Q1R A;  1H82 A;  1P2E A;  2YVJ A;  5U63 A;  1DNC A;  4EQS A;  3AEB A;  1Z6L A;  4IVO B;  1GTE A;  2O9Z A;  3ALJ A;  1PS9 A;  2XFU A;  4K5S A;  2TMD A;  2V5Z A;  1YS0 A;  1YQZ A;  3AEA A;  2X99 A;  3ADA B;  1JRX A;  2X50 A;  3TG1 B;  3KPF A;  4XWZ A;  1QJD A;  2XVI A;  5HBL A;  3CGB A;  4YXD A;  4JN9 A;  1QXN A;  1W4X A;  3CND A;  2JBV A;  4H50 A;  1VQW A;  3S5W A;  3UKF A;  2MRM A;  4WH7 A;  2APG A;  4DGK A;  3FPZ A;  1F8W A;  1L9E A;  3G5Q A;  3PVC A;  3NT6 A;  3DGH A;  4WCT A;  1Y56 A;  2V3A A;  2F5Z A;  2VQB A;  5JCI A;  3NNE A;  4K8D A;  3D1P A;  3SM8 A;  3GMC A;  3LZW A;  3F8R A;  3NG7 X;  3IWA A;  5LV9 A;  5M0Z A;  2GWF A;  4AP3 A;  5HPA A;  1F6M A;  3AE9 A;  3KA7 A;  1KNP A;  3UTF A;  1GSN A;  1QLB A;  1PN0 A;  5ER0 A;  5BRT A;  2V61 A;  3LOV A;  4O5Q A;  3C96 A;  1T3K A;  3HWI A;  3Q6J A;  5JCK A;  2V3B A;  1NPX A;  1OJD A;  2YR4 A;  3EAN A;  1BZL A;  3CIR A;  1L9D A;  3RP7 A;  1ZK7 A;  3RHA A;  4ZN0 A;  1H4M X;  1S3B A;  2OLO A;  3QSE A;  1M64 A;  1ZX9 A;  3NRN A;  4B67 A;  4CRT A;  5U1O A;  2QAE A;  3AE2 A;  4IV9 A;  2GR1 A;  2BK4 A;  3EPT A;  1JNR A;  3ALM A;  1BOH A;  3L1R A;  1Y56 B;  2Q0K A;  2A89 A;  1TQ1 A;  1YKJ A;  1C25 A;  4NTC A;  4D03 A;  2R4J A;  4BK2 A;  1PJ7 A;  4CNK A;  1E6E A;  3G5J A;  3HZU A;  4J31 A;  4FDC B;  1LVL A;  3KVE A;  3AD9 B;  2WLX A;  1YQ4 A;  4IA6 A;  3ZDN A;  4H4V A;  2BXR A;  4TM4 A;  1PXC A;  4XWR A;  2YG7 A;  1N4W A;  2VVM A;  2XCG A;  3UKL A;  1DOE A;  4PAA A;  3NYE A;  4BJY A;  1CL0 A;  2GF3 A;  4LA1 A;  3KKJ A;  3AYI A;  4FK1 A;  1IUU A;  1GAL A;  2YR5 A;  4H2N A;  4JQ9 A;  5HBP A;  4K2X A;  3P4Q A;  5HBQ A;  4UDR A;  1GV4 A;  5GRT A;  2BAC A;  3P4R A;  4HA6 A;  4U8O A;  4A65 A;  4EM4 A;  1D7Y A;  1GPE A;  1ONF A;  4Z24 A;  2BC0 A;  1CJ2 A;  3WE0 A;  3LB8 A;  2GVC A;  3M12 A;  2ZZC A;  4CCQ A;  1ORB A;  2JB1 A;  2R0P A;  4H4W A;  1OKG A;  1CJ3 A;  2OUC A;  4Y4N A;  3UP5 A;  3GWF A;  5BUL A;  3NTD A;  5HBO A;  4JNQ A;  4U8I A;  3V76 A;  3NK0 X;  2IVE A;  2WU2 A;  3TG3 A;  5C3J A;  4GR1 A;  5HYM A;  3I3U A;  5BUK A;  5FS6 A;  1NG3 A;  2A2K A;  2X8G A;  4F67 A;  2XFQ A;  3GYI A;  4EQX A;  3OP3 A;  1WHB A;  1COY A;  2RGJ A;  3CPJ G;  1CJ4 A;  5KRQ A;  1H86 A;  3O0H A;  1DP2 A;  3AEF A;  1K0J A;  3ICT A;  4PAB A;  4BUR A;  2VSW A;  2VQ7 A;  2JAE A;  1VDC A;  4EMI A;  3AD8 B;  3H8L A;  3CPI G;  3F8D A;  4APN A;  2H89 A;  4A6N A;  3I2V A;  2B7R A;  4LII A;  3O3W A;  4UP3 A;  2EG4 B;  2KL3 A;  1H81 A;  4U8J A;  5FS7 A;  3BHK A;  2MOL A;  3DA1 A;  4GUV A;  2H88 A;  2WBA A;  3AED A;  4H4U A;  4H4P A;  4Y4L A;  4JDR A;  4TM0 A;  4E0V A;  3UKA A;  2YM1 A;  3ATQ A;  1NG4 A;  4OPT A;  3AYL A;  1LPF A;  2QA1 A;  3C4N A;  3G5R A;  4P9S A;  1RSG A;  2E4G A;  3COX A;  4REK A;  1KFY A;  2WEU A;  3QVR A;  4B66 A;  4B63 A;  4H4Y A;  4Z2U A;  3TP9 A;  4DNA A;  2EQ9 A;  1B8S A;  1OJA A;  1O94 A;  2YR6 A;  4OVI A;  2B9Y A;  3ALL A;  4C77 A;  2DKH A;  3ABV A;  2JTR A;  2RAB A;  3DK4 A;  1CBO A;  3I6D A;  1ZMC A;  4B65 A;  1O5W A;  2K0Z A;  2FBW A;  3GK5 A;  2BS4 A;  1KSS A;  4GDE A;  3AAX A;  1PHH A;  3KD9 A;  4YKF A;  4CNJ A;  4OPL A;  4IVM B;  2A87 A;  2GQF A;  3KU9 A;  4JY2 A;  1KSU A;  4H7U A;  5TR3 A;  1NEN A;  3IHM A;  2XFN A;  2VVL A;  1EL7 A;  5IQ1 A;  3IF9 A;  1GET A;  2ACZ A;  1GT8 A;  1X31 B;  1GER A;  4NTE A;  1YM9 A;  2FJE A;  2GB0 A;  3C4A A;  1PBD A;  2WQY A;  4ZCC A;  5KXJ A;  1YMD A;  4USR A;  2JB2 A;  4H4X A;  3P9U A;  4H2R A;  3RNM A;  1CF3 A;  1RYI A;  1LV0 A;  1N4U A;  3CNJ A;  4CBQ A;  3KLJ A;  1GRH A;  3OC4 A;  4H4Q A;  4J34 A;  4I59 A;  2J6P A;  2FJD A;  3CPH G;  3URH A;  4CY6 A;  1GXF A;  3NKS A;  2Y6R A;  1TDO A;  2V60 A;  2OA1 A;  4YSY A;  1JRZ A;  2GR2 A;  3AE6 A;  3V3O A;  4X9M A;  4Z44 A;  3NGC X;  4U8K A;  3AEC A;  4B64 A;  1CWS A;  1EL5 A;  1K4Q A;  3FMW A;  5EOW A;  2XLR A;  2BK3 A;  2BS3 A;  4H2P A;  2B9X A;  2YVF A;  2NVK X;  3IWH A;  2WES A;  3ICS A;  3AB1 A;  4J36 A;  4CY8 A;  5CQF A;  3RP6 A;  1DJN A;  2BYB A;  2PHH A;  4AOS A;  1IUT A;  2XFP A;  5KWF A;  2XVE A;  4U2T A;  2ORA A;  1GES A;  1DOC A;  3FLH A;  1PDH A;  1Q1W A;  4H4T A;  5FS9 A;  4TLZ A;  1QB0 A;  1H6V A;  2RGH A;  3GYJ A;  1TYT A;  2GAH B;  2A8X A;  4KX6 A;  4U2L A;  4ECH A;  2JK6 A;  3AE5 A;  3BI4 A;  3QSS A;  1L0V A;  2GEW A;  2OLN A;  1FL2 A;  1KDG A;  1DOB A;  4OPC A;  1E1M A;  3B6D A;  1HYU A;  3NK1 X;  5JCL A;  1F8S A;  2C66 A;  2EQ6 A;  1K0I A;  1ZKQ A;  5J7X A;  1GN0 A;  1RHD A;  4JNA A;  2YAU A;  5KOX A;  4JGT A;  3L8K A;  1NDA A;  1TRB A;  2X8H A;  4KPR A;  2UZZ A;  2VRM A;  2WOV A;  1E1L A;  1N4V A;  3NIX A;  2WPC A;  5J60 A;  3GD4 A;  4D04 A;  3V3N A;  2MOI A;  1ZY8 A;  4BK1 A;  1REO A;  1UKV G;  2C73 A;  1D5T A;  1ZMD A;  4A99 A;  4EQR A;  2ARD A;  1BOI A;  2JKC A;  5BVA A;  1CHU A;  4OPU A;  3FNJ A;  2IFD A;  1B37 A;  3QJ4 A;  4A79 A;  3CNS A;  4WH9 A;  2XVF A;  4C3X A;  4J56 A;  2UZQ A;  1PXA A;  5JCM A;  1LQU A;  2V6O A;  2C64 A;  3SFD A;  1BF3 A;  1JU2 A;  2B9W A;  2AAQ A;  3NHO X;  3K30 A;  4MJW A;  1GRB A;  1PBE A;  1OJT A;  4U8L A;  3NLC A;  3GRS A;  2Y6Q A;  3QFB A;  4NEW A;  4NEV A;  2FJB A;  2ZZ0 A;  2YM2 A;  3B3R A;  5U25 A;  2E5V A;  1MOK A;  4Z26 A;  3IPO A;  2OAL A;  1NHP A;  2IVD A;  4WX1 A;  1D4D A;  3NK2 X;  4YTP A;  2TPR A;  2XDO A;  3FIM B;  4I58 A;  1XAN A;  4H2Q A;  4AT2 A;  4DSH A;  2YG4 A;  2IFV A;  3UCL A;  4M52 A;  2JTS A;  2AQJ A;  2B76 A;  3D8X A;  2GR3 A;  3IC9 A;  2XVH A;  3Q9T A;  4H4Z A;  5EB4 A;  3HIX A;  5KVH A;  2GAG B;  2JTQ A;  1KF6 A;  4N9X A;  4U8N A;  1WV9 A;  2B7S A;  1M6I A;  2BCG G;  2C7G A;  1QO8 A;  4H4R A;  1VG9 A;  1TYP A;  3P1W A;  2JB3 A;  4YKG A;  3K9R A;  2WDR A;  2R9Z A;  4J57 A;  3ISH A;  4RG3 A;  3RP8 A;  3M13 A;  3AYJ A;  3CNP A;  1GRG A;  2BK5 A;  4NTD A;  1DOD A;  3CGD A;  2NPX A;  2J3N A;  2WET A;  3QFA A;  5EB5 A;  1EL9 A;  1F3P A;  2XLS A;  3CN8 A;  4J2W A;  1XDI A;  3ZYX A;  1LTX R;  3RED A;  1CC6 A;  3P4S A;  1KNR A;  3SFE A;  3QVP A;  4YSH A;  3DJD A;  2R45 A;  2R0C A;  3DJE A;  1F8R A;  1XPQ A;  2FJA A;  2C72 A;  4O5U A;  1ZDL A;  1YQ3 A;  2C75 A;  2C76 A;  1D4E A;  1GRT A;  1GND A;  2BAB A;  1JOA A;  1UAR A;  2WOW A;  4AP1 A;  2VRL A;  3NN0 X;  2RGO A;  3GSI A;  3AAY A;  3LXD A; 
#chains in the Genus database with same CATH topology
 1GRF A;  1RP0 A;  2XVJ A;  3AWI A;  4H4S A;  2Q0L A;  2GR0 A;  2GRT A;  1D4C A;  1GRE A;  3BI5 A;  1CWT A;  1E7P A;  1GOS A;  4XXG A;  2FSX A;  2ZBW A;  3PS9 A;  2R0G A;  4A9W A;  1K0L A;  2WOI A;  3R2U A;  3UTG A;  3CNT A;  2WDQ A;  1S2Q A;  3AE8 A;  3BI2 A;  2WP5 A;  4OPD A;  3UOX A;  4Z2T A;  4JY3 A;  2Z5X A;  1ELI A;  2VZ2 A;  1IUS A;  3NYC A;  5CKU A;  3UKP A;  3UTH A;  1VG0 A;  1YML A;  4ICY A;  2GV8 A;  4RSL A;  4EMW A;  2QA2 A;  4U2S A;  1D7L A;  3VRB A;  2C3C A;  3I3L A;  3GMB A;  3K7T A;  5KVI A;  4ADW A;  3SQP A;  3DJG X;  5KMR A;  1O95 A;  1E0C A;  4YWO A;  4A7A A;  3HZL A;  4IA5 A;  3OLH A;  3FS5 A;  3UOV A;  2C3D A;  3D1C A;  4UDP A;  1NHQ A;  1IUX A;  3AD7 B;  1PJ5 A;  5JCN A;  3DH9 A;  1IUW A;  2Z5Y A;  4K7Z A;  1P2H A;  5C2T A;  5IPY A;  1FCD A;  1DJQ A;  3LJP A;  5LAM A;  4ZCD A;  4BV6 A;  4YSZ A;  4FK1 C;  2XLU A;  1ZOY A;  3SX6 A;  3VQR A;  1CC2 A;  4EM3 A;  2CFY A;  2GQW A;  4B1B A;  4A5L A;  4EIQ A;  1CC4 A;  1OJ9 A;  2CDU A;  1H7W A;  2EQ7 A;  4B68 A;  4BK3 A;  2YLX A;  1FEC A;  1JNZ A;  2C4C A;  4X9N A;  4OPI A;  3UKH A;  2HQM A;  3LZX A;  3ICR A;  1GMX A;  1H84 A;  2ZZB A;  2YG6 A;  3EF6 A;  1BGN A;  2OAM A;  4C74 A;  2Q7V A;  4A6N B;  1N1P A;  3BNU A;  4G6H A;  4DSG A;  1YY5 A;  1FOH A;  2X8C A;  3GRT A;  1IUV A;  2C65 A;  5HHF A;  2AR8 A;  4YSX A;  4UDQ A;  2C67 A;  3F4A A;  4RG4 A;  1IJH A;  2E1M A;  1PXB A;  3DJJ A;  4FX9 A;  1GTH A;  1PBB A;  3FBS A;  3GDP A;  4GDP A;  4BJZ A;  1BGJ A;  3CGC A;  3AXB A;  3ILM A;  3ITJ A;  4Y4M A;  1CJC A;  1JRY A;  2XYO A;  3IPP A;  2XLP A;  3MZZ A;  4K22 A;  4GF7 A;  1FEA A;  1PBC A;  4TLX A;  2WP6 A;  3ATR A;  1XHC A;  5LAO A;  3UKK A;  3LAD A;  2WLR A;  4YT0 A;  2YLW A;  2YQU A;  5HXI A;  1BWC A;  2W0H A;  3T37 A;  1B5Q A;  2WHD A;  5DBJ A;  4GRT A;  4Z2R A;  5IQ4 A;  3T2Z A;  2CVJ A;  1EBD A;  4TM1 A;  3FG2 P;  3DME A;  1DXL A;  1LQT A;  3CMM A;  4C3Y A;  5L46 A;  4EIP A;  4U8P A;  3UP4 A;  1E1N A;  2Q6U A;  1H4K X;  4YTN A;  2BC1 A;  1ZOV A;  1BKW A;  3UKQ A;  3UOY A;  3M0O A;  2DCQ A;  4EQW A;  3FOJ A;  1NAA A;  1FEB A;  2R4E A;  3H4K A;  1YT8 A;  2YWL A;  3NN6 X;  3G5S A;  2WP9 A;  3P4P A;  1HZM A;  2X3N A;  2BCP A;  2YG5 A;  4GCM A;  1CWR A;  2GMH A;  4USQ A;  5FS8 A;  3VRD B;  1YMK A;  3HYV A;  5M10 A;  1PBF A;  3HYW A;  1H7X A;  2WS3 A;  1L9C A;  1PJ6 A;  3DGZ A;  2BXS A;  3NYF A;  3AE1 A;  4X4J A;  5EBK A;  1VEE A;  2YG3 A;  3DK8 A;  4HB9 A;  5KOW A;  1AOG A;  4NWZ A;  1SEZ A;  3UOZ A;  4YTM A;  1RHS A;  1S2Y A;  5GSN A;  3GDN A;  4K5R A;  2Q82 A;  1B4V A;  1NHS A;  1LJ1 A;  1GRA A;  1S3E A;  2R46 A;  3AEE A;  3VR8 A;  4OPG A;  3QSM A;  1TDK A;  2HHG A;  3IHG A;  1MO9 A;  2WDV A;  2WU5 A;  3UTN X;  1E1K A;  2GMJ A;  1TDF A;  5FMH A;  4U8M A;  2VOU A;  3K7M X;  1TDN A;  4EMJ A;  1V59 A;  4TM3 A;  1GEU A;  1H83 A;  4Z43 A;  2DKI A;  2VVL G;  3AEG A;  3P3A A;  4NZH A;  2YVG A;  1URH A;  3EAO A;  5KNL A;  1E39 A;  3DK9 A;  3NH3 X;  3BHF A;  3S61 A;  1ZP0 A;  1VRQ B;  3E1T A;  3JSK A;  3VRA A;  1NHR A;  3II4 A;  2I0Z A;  2EG3 A;  3R9U A;  1OJC A;  3CTY A;  2YLT A;  1EL8 A;  2BA9 A;  3OZ2 A;  4B69 A;  3CGE A;  2YLS A;  4J33 A;  2EG4 A;  2PYX A;  4G6G A;  4CCR A;  5HY5 A;  2EQ8 A;  4Z25 A;  4C5O A;  2CUL A;  2XLT A;  3VR9 A;  2WPE A;  2WPF A;  3BNM A;  4LU6 A;  3PO7 A;  3SGL A;  3AE3 A;  2QCU A;  2YLZ A;  1Q9I A;  1MXT A;  2XFO A;  4AT0 A;  1JEH A;  3F8P A;  2BRY A;  2C70 A;  2YLR A;  1NEK A;  1Y0P A;  3AE7 A;  3UTE A;  4AOX A;  3NHV A;  3K7Q X;  3NTA A;  3AE4 A;  1TDE A;  3T0K A;  2GH5 A;  2IID A;  2BS2 A;  3GD3 A;  3GWD A;  3H8I A;  4OCG A;  1Q1R A;  1H82 A;  1P2E A;  2YVJ A;  5U63 A;  1DNC A;  4EQS A;  3AEB A;  1Z6L A;  4IVO B;  1GTE A;  2O9Z A;  3ALJ A;  1PS9 A;  2XFU A;  4K5S A;  2TMD A;  2V5Z A;  1YS0 A;  1YQZ A;  3AEA A;  5KMQ A;  2X99 A;  3ADA B;  1JRX A;  2X50 A;  3TG1 B;  3KPF A;  4XWZ A;  1QJD A;  2XVI A;  5HBL A;  3CGB A;  4YXD A;  4JN9 A;  1QXN A;  1W4X A;  3CND A;  2JBV A;  4H50 A;  1VQW A;  3S5W A;  3UKF A;  2MRM A;  4WH7 A;  2APG A;  4DGK A;  3FPZ A;  1F8W A;  1L9E A;  3G5Q A;  3PVC A;  3NT6 A;  3DGH A;  4WCT A;  1Y56 A;  2V3A A;  2F5Z A;  2VQB A;  5JCI A;  3NNE A;  4K8D A;  3D1P A;  3SM8 A;  3GMC A;  3LZW A;  3F8R A;  3NG7 X;  3IWA A;  5LV9 A;  4G74 A;  5M0Z A;  2GWF A;  3T2Y A;  5HPA A;  4AP3 A;  3T31 A;  1F6M A;  3AE9 A;  3KA7 A;  1KNP A;  3UTF A;  1GSN A;  1QLB A;  1PN0 A;  5ER0 A;  5BRT A;  2V61 A;  3LOV A;  4O5Q A;  3C96 A;  1T3K A;  3HWI A;  3Q6J A;  5JCK A;  2V3B A;  1NPX A;  1OJD A;  2YR4 A;  3EAN A;  1BZL A;  3CIR A;  1L9D A;  3RP7 A;  1ZK7 A;  3RHA A;  4ZN0 A;  1H4M X;  1S3B A;  2OLO A;  3QSE A;  1M64 A;  1ZX9 A;  3NRN A;  4B67 A;  4CRT A;  5U1O A;  2QAE A;  3AE2 A;  4IV9 A;  2GR1 A;  2BK4 A;  3EPT A;  1JNR A;  3ALM A;  1BOH A;  3L1R A;  1Y56 B;  2Q0K A;  2A89 A;  1TQ1 A;  1YKJ A;  1C25 A;  4NTC A;  4D03 A;  2R4J A;  4BK2 A;  1PJ7 A;  4CNK A;  1E6E A;  3G5J A;  3HZU A;  4J31 A;  4FDC B;  1LVL A;  3KVE A;  3AD9 B;  2WLX A;  1YQ4 A;  4IA6 A;  3ZDN A;  4H4V A;  2BXR A;  4TM4 A;  1PXC A;  4XWR A;  2YG7 A;  1N4W A;  2VVM A;  2XCG A;  3UKL A;  1DOE A;  4PAA A;  3NYE A;  4BJY A;  1CL0 A;  2GF3 A;  4LA1 A;  3KKJ A;  3AYI A;  4FK1 A;  1IUU A;  1GAL A;  2YR5 A;  4H2N A;  4JQ9 A;  5HBP A;  4K2X A;  3P4Q A;  5HBQ A;  3SZF A;  4UDR A;  1GV4 A;  5GRT A;  2BAC A;  3P4R A;  4HA6 A;  4U8O A;  4A65 A;  4EM4 A;  5KMS A;  1D7Y A;  1GPE A;  1ONF A;  4Z24 A;  2BC0 A;  1CJ2 A;  3WE0 A;  3LB8 A;  2GVC A;  3M12 A;  2ZZC A;  4CCQ A;  1ORB A;  2JB1 A;  2R0P A;  3KPK A;  4H4W A;  1OKG A;  1CJ3 A;  2OUC A;  4Y4N A;  3UP5 A;  3GWF A;  5BUL A;  3NTD A;  5HBO A;  4JNQ A;  4U8I A;  3V76 A;  3NK0 X;  2IVE A;  2WU2 A;  3TG3 A;  5C3J A;  4GR1 A;  5HYM A;  3I3U A;  5BUK A;  5FS6 A;  1NG3 A;  2A2K A;  2X8G A;  4F67 A;  2XFQ A;  3GYI A;  4EQX A;  3OP3 A;  3SY4 A;  1WHB A;  1COY A;  2RGJ A;  3CPJ G;  1CJ4 A;  5KRQ A;  1H86 A;  3O0H A;  1DP2 A;  3AEF A;  1K0J A;  3ICT A;  4PAB A;  4BUR A;  2VSW A;  2VQ7 A;  2JAE A;  1VDC A;  4EMI A;  3AD8 B;  3H8L A;  3CPI G;  3F8D A;  4APN A;  2H89 A;  4A6N A;  3I2V A;  2B7R A;  4LII A;  3O3W A;  4UP3 A;  2EG4 B;  2KL3 A;  1H81 A;  4U8J A;  5FS7 A;  3BHK A;  2MOL A;  3DA1 A;  4GUV A;  3SXI A;  2H88 A;  2WBA A;  3AED A;  4H4U A;  4H4P A;  4Y4L A;  4JDR A;  4TM0 A;  4E0V A;  3UKA A;  2YM1 A;  3ATQ A;  1NG4 A;  4OPT A;  3AYL A;  1LPF A;  2QA1 A;  3C4N A;  3G5R A;  4P9S A;  1RSG A;  2E4G A;  3COX A;  4REK A;  1KFY A;  2WEU A;  3QVR A;  4B66 A;  4B63 A;  4H4Y A;  4Z2U A;  3TP9 A;  4DNA A;  2EQ9 A;  1B8S A;  1OJA A;  1O94 A;  2YR6 A;  4OVI A;  2B9Y A;  3ALL A;  4C77 A;  2DKH A;  3ABV A;  2JTR A;  2RAB A;  3DK4 A;  1CBO A;  3I6D A;  1ZMC A;  4B65 A;  1O5W A;  2K0Z A;  2FBW A;  3GK5 A;  2BS4 A;  1KSS A;  4GDE A;  3AAX A;  1PHH A;  3SZ0 A;  3KD9 A;  4YKF A;  4CNJ A;  4OPL A;  4IVM B;  2A87 A;  2GQF A;  3KU9 A;  4JY2 A;  1KSU A;  4H7U A;  5TR3 A;  1NEN A;  3IHM A;  2XFN A;  2VVL A;  3GYX A;  1EL7 A;  5IQ1 A;  3IF9 A;  1GET A;  2ACZ A;  1GT8 A;  1X31 B;  1GER A;  4NTE A;  1YM9 A;  2FJE A;  2GB0 A;  3C4A A;  1PBD A;  4GAP A;  2WQY A;  4ZCC A;  5KXJ A;  1YMD A;  4USR A;  2JB2 A;  2BRA A;  3P9U A;  4H2R A;  4H4X A;  3SYI A;  3RNM A;  1CF3 A;  1RYI A;  1LV0 A;  1N4U A;  3CNJ A;  4CBQ A;  3KLJ A;  1GRH A;  3OC4 A;  4H4Q A;  4J34 A;  4I59 A;  2J6P A;  2FJD A;  3CPH G;  3URH A;  4CY6 A;  1GXF A;  3NKS A;  2Y6R A;  1TDO A;  2V60 A;  2OA1 A;  3T14 A;  4YSY A;  1JRZ A;  2GR2 A;  3AE6 A;  4II3 A;  3V3O A;  4NNJ A;  4X9M A;  4Z44 A;  3NGC X;  4U8K A;  3AEC A;  4B64 A;  1CWS A;  1EL5 A;  1K4Q A;  3FMW A;  5EOW A;  2XLR A;  2BK3 A;  2BS3 A;  4H2P A;  2B9X A;  2YVF A;  2NVK X;  3IWH A;  2WES A;  3ICS A;  3AB1 A;  4J36 A;  4CY8 A;  5CQF A;  3RP6 A;  1DJN A;  2BYB A;  2PHH A;  4AOS A;  1IUT A;  2XFP A;  5KWF A;  2XVE A;  4U2T A;  2ORA A;  1GES A;  4G73 A;  1DOC A;  3FLH A;  1PDH A;  1Q1W A;  4H4T A;  5FS9 A;  4TLZ A;  1QB0 A;  1H6V A;  4II2 A;  2RGH A;  3GYJ A;  1TYT A;  2GAH B;  2A8X A;  4KX6 A;  4U2L A;  4ECH A;  2JK6 A;  3AE5 A;  3BI4 A;  3QSS A;  1L0V A;  2GEW A;  2OLN A;  1FL2 A;  1KDG A;  1DOB A;  4OPC A;  1E1M A;  3B6D A;  1HYU A;  3NK1 X;  5JCL A;  1F8S A;  2C66 A;  2EQ6 A;  1K0I A;  1ZKQ A;  5J7X A;  1GN0 A;  1RHD A;  4JNA A;  2YAU A;  5KOX A;  4JGT A;  3L8K A;  1NDA A;  1TRB A;  2X8H A;  4KPR A;  2UZZ A;  2VRM A;  2WOV A;  1E1L A;  1N4V A;  4G9K A;  3NIX A;  2WPC A;  5J60 A;  3GD4 A;  4D04 A;  3V3N A;  2MOI A;  1ZY8 A;  4BK1 A;  1REO A;  1UKV G;  2C73 A;  1D5T A;  1ZMD A;  4A99 A;  4EQR A;  2ARD A;  4GAV A;  1BOI A;  2JKC A;  5BVA A;  1CHU A;  4OPU A;  3FNJ A;  2IFD A;  1B37 A;  3QJ4 A;  4A79 A;  3CNS A;  4WH9 A;  2XVF A;  4C3X A;  4J56 A;  2UZQ A;  1PXA A;  5JCM A;  1LQU A;  2V6O A;  2C64 A;  3SFD A;  1BF3 A;  1JU2 A;  2B9W A;  2AAQ A;  3NHO X;  3K30 A;  4MJW A;  1GRB A;  1PBE A;  1OJT A;  4U8L A;  3NLC A;  3GRS A;  2Y6Q A;  3QFB A;  4NEW A;  4NEV A;  2FJB A;  2ZZ0 A;  2YM2 A;  3B3R A;  5U25 A;  2E5V A;  1MOK A;  4Z26 A;  3IPO A;  2OAL A;  1NHP A;  2IVD A;  4WX1 A;  1D4D A;  3NK2 X;  4YTP A;  2TPR A;  2XDO A;  3FIM B;  4I58 A;  1XAN A;  4H2Q A;  4AT2 A;  4DSH A;  2YG4 A;  2IFV A;  3UCL A;  4M52 A;  2JTS A;  2AQJ A;  3HYX A;  2B76 A;  3D8X A;  2GR3 A;  5KMP A;  3IC9 A;  2XVH A;  3Q9T A;  4H4Z A;  5EB4 A;  3HIX A;  5KVH A;  2GAG B;  2JTQ A;  1KF6 A;  4N9X A;  4U8N A;  1WV9 A;  2B7S A;  1M6I A;  2BCG G;  2C7G A;  1QO8 A;  4H4R A;  1VG9 A;  1TYP A;  3P1W A;  2JB3 A;  4YKG A;  3K9R A;  2WDR A;  2R9Z A;  4J57 A;  3ISH A;  4RG3 A;  3RP8 A;  3M13 A;  3SZC A;  3AYJ A;  3CNP A;  1GRG A;  2BK5 A;  4NTD A;  1DOD A;  3CGD A;  2NPX A;  2J3N A;  2WET A;  3QFA A;  3SZW A;  5EB5 A;  1EL9 A;  1F3P A;  2XLS A;  3CN8 A;  4J2W A;  1XDI A;  3T2K A;  3ZYX A;  1LTX R;  3RED A;  1CC6 A;  3P4S A;  1KNR A;  3SFE A;  3QVP A;  4YSH A;  3DJD A;  2R45 A;  2R0C A;  3DJE A;  1F8R A;  1XPQ A;  2FJA A;  2C72 A;  4O5U A;  1ZDL A;  1YQ3 A;  2C75 A;  2C76 A;  1D4E A;  1GRT A;  1GND A;  2BAB A;  1JOA A;  1UAR A;  2WOW A;  4AP1 A;  2VRL A;  3NN0 X;  2RGO A;  3GSI A;  3AAY A;  3LXD A; 
#chains in the Genus database with same CATH homology
 1GRF A;  1RP0 A;  2XVJ A;  3AWI A;  4H4S A;  2Q0L A;  2GR0 A;  2GRT A;  1D4C A;  1GRE A;  3BI5 A;  1CWT A;  1E7P A;  1GOS A;  4XXG A;  2FSX A;  2ZBW A;  3PS9 A;  2R0G A;  4A9W A;  1K0L A;  2WOI A;  3R2U A;  3UTG A;  3CNT A;  2WDQ A;  1S2Q A;  3AE8 A;  3BI2 A;  2WP5 A;  4OPD A;  3UOX A;  4Z2T A;  4JY3 A;  2Z5X A;  1ELI A;  2VZ2 A;  1IUS A;  3NYC A;  5CKU A;  3UKP A;  3UTH A;  1VG0 A;  1YML A;  4ICY A;  2GV8 A;  4RSL A;  4EMW A;  2QA2 A;  4U2S A;  1D7L A;  3VRB A;  2C3C A;  3I3L A;  3GMB A;  3K7T A;  5KVI A;  4ADW A;  3SQP A;  3DJG X;  5KMR A;  1O95 A;  1E0C A;  4YWO A;  4A7A A;  3HZL A;  4IA5 A;  3OLH A;  3FS5 A;  3UOV A;  2C3D A;  3D1C A;  4UDP A;  1NHQ A;  1IUX A;  3AD7 B;  1PJ5 A;  5JCN A;  3DH9 A;  1IUW A;  2Z5Y A;  4K7Z A;  1P2H A;  5C2T A;  5IPY A;  1FCD A;  1DJQ A;  3LJP A;  5LAM A;  4ZCD A;  4BV6 A;  4YSZ A;  4FK1 C;  2XLU A;  1ZOY A;  3SX6 A;  3VQR A;  1CC2 A;  4EM3 A;  2CFY A;  2GQW A;  4B1B A;  4A5L A;  4EIQ A;  1CC4 A;  1OJ9 A;  2CDU A;  1H7W A;  2EQ7 A;  4B68 A;  4BK3 A;  2YLX A;  1FEC A;  1JNZ A;  2C4C A;  4X9N A;  4OPI A;  3UKH A;  2HQM A;  3LZX A;  3ICR A;  1GMX A;  1H84 A;  2ZZB A;  2YG6 A;  3EF6 A;  1BGN A;  2OAM A;  4C74 A;  2Q7V A;  4A6N B;  1N1P A;  3BNU A;  4G6H A;  4DSG A;  1YY5 A;  1FOH A;  2X8C A;  3GRT A;  1IUV A;  2C65 A;  5HHF A;  2AR8 A;  4YSX A;  4UDQ A;  2C67 A;  3F4A A;  4RG4 A;  1IJH A;  2E1M A;  1PXB A;  3DJJ A;  4FX9 A;  1GTH A;  1PBB A;  3FBS A;  3GDP A;  4GDP A;  4BJZ A;  1BGJ A;  3CGC A;  3AXB A;  3ILM A;  3ITJ A;  4Y4M A;  1CJC A;  1JRY A;  2XYO A;  3IPP A;  2XLP A;  3MZZ A;  4K22 A;  4GF7 A;  1FEA A;  1PBC A;  4TLX A;  2WP6 A;  3ATR A;  1XHC A;  5LAO A;  3UKK A;  3LAD A;  2WLR A;  4YT0 A;  2YLW A;  2YQU A;  5HXI A;  1BWC A;  2W0H A;  3T37 A;  1B5Q A;  2WHD A;  5DBJ A;  4GRT A;  4Z2R A;  5IQ4 A;  3T2Z A;  2CVJ A;  1EBD A;  4TM1 A;  3FG2 P;  3DME A;  1DXL A;  1LQT A;  3CMM A;  4C3Y A;  5L46 A;  4EIP A;  4U8P A;  3UP4 A;  1E1N A;  2Q6U A;  1H4K X;  4YTN A;  2BC1 A;  1ZOV A;  1BKW A;  3UKQ A;  3UOY A;  3M0O A;  2DCQ A;  4EQW A;  3FOJ A;  1NAA A;  1FEB A;  2R4E A;  3H4K A;  1YT8 A;  2YWL A;  3NN6 X;  3G5S A;  2WP9 A;  3P4P A;  1HZM A;  2X3N A;  2BCP A;  2YG5 A;  4GCM A;  1CWR A;  2GMH A;  4USQ A;  5FS8 A;  3VRD B;  1YMK A;  3HYV A;  5M10 A;  1PBF A;  3HYW A;  1H7X A;  2WS3 A;  1L9C A;  1PJ6 A;  3DGZ A;  2BXS A;  3NYF A;  3AE1 A;  4X4J A;  5EBK A;  1VEE A;  2YG3 A;  3DK8 A;  4HB9 A;  5KOW A;  1AOG A;  4NWZ A;  1SEZ A;  3UOZ A;  4YTM A;  1RHS A;  1S2Y A;  5GSN A;  3GDN A;  4K5R A;  1B4V A;  1NHS A;  1LJ1 A;  1GRA A;  1S3E A;  2R46 A;  3AEE A;  3VR8 A;  4OPG A;  3QSM A;  1TDK A;  2HHG A;  3IHG A;  1MO9 A;  2WDV A;  2WU5 A;  3UTN X;  1E1K A;  2GMJ A;  1TDF A;  5FMH A;  4U8M A;  2VOU A;  3K7M X;  1TDN A;  4EMJ A;  1V59 A;  4TM3 A;  1GEU A;  1H83 A;  4Z43 A;  2DKI A;  2VVL G;  3AEG A;  3P3A A;  4NZH A;  2YVG A;  1URH A;  3EAO A;  5KNL A;  1E39 A;  3DK9 A;  3NH3 X;  3BHF A;  3S61 A;  1ZP0 A;  1VRQ B;  3E1T A;  3JSK A;  3VRA A;  1NHR A;  3II4 A;  2I0Z A;  2EG3 A;  3R9U A;  1OJC A;  3CTY A;  2YLT A;  1EL8 A;  2BA9 A;  3OZ2 A;  4B69 A;  3CGE A;  2YLS A;  4J33 A;  2EG4 A;  2PYX A;  4G6G A;  4CCR A;  5HY5 A;  2EQ8 A;  4Z25 A;  4C5O A;  2CUL A;  2XLT A;  3VR9 A;  2WPE A;  2WPF A;  3BNM A;  4LU6 A;  3PO7 A;  3SGL A;  3AE3 A;  2QCU A;  2YLZ A;  1Q9I A;  1MXT A;  2XFO A;  4AT0 A;  1JEH A;  3F8P A;  2BRY A;  2C70 A;  2YLR A;  1NEK A;  1Y0P A;  3AE7 A;  3UTE A;  4AOX A;  3NHV A;  3K7Q X;  3NTA A;  3AE4 A;  1TDE A;  3T0K A;  2GH5 A;  2IID A;  2BS2 A;  3GD3 A;  3GWD A;  3H8I A;  4OCG A;  1Q1R A;  1H82 A;  1P2E A;  2YVJ A;  5U63 A;  1DNC A;  4EQS A;  3AEB A;  1Z6L A;  4IVO B;  1GTE A;  2O9Z A;  3ALJ A;  1PS9 A;  2XFU A;  4K5S A;  2TMD A;  2V5Z A;  1YS0 A;  1YQZ A;  3AEA A;  5KMQ A;  2X99 A;  3ADA B;  1JRX A;  2X50 A;  3TG1 B;  3KPF A;  4XWZ A;  1QJD A;  2XVI A;  5HBL A;  3CGB A;  4YXD A;  4JN9 A;  1QXN A;  1W4X A;  3CND A;  2JBV A;  4H50 A;  1VQW A;  3S5W A;  3UKF A;  2MRM A;  4WH7 A;  2APG A;  4DGK A;  3FPZ A;  1F8W A;  1L9E A;  3G5Q A;  3PVC A;  3NT6 A;  3DGH A;  4WCT A;  1Y56 A;  2V3A A;  2F5Z A;  2VQB A;  5JCI A;  3NNE A;  4K8D A;  3D1P A;  3SM8 A;  3GMC A;  3LZW A;  3F8R A;  3NG7 X;  3IWA A;  5LV9 A;  4G74 A;  5M0Z A;  2GWF A;  3T2Y A;  5HPA A;  4AP3 A;  3T31 A;  1F6M A;  3AE9 A;  3KA7 A;  1KNP A;  3UTF A;  1GSN A;  1QLB A;  1PN0 A;  5ER0 A;  5BRT A;  2V61 A;  3LOV A;  4O5Q A;  3C96 A;  1T3K A;  3HWI A;  3Q6J A;  5JCK A;  2V3B A;  1NPX A;  1OJD A;  2YR4 A;  3EAN A;  1BZL A;  3CIR A;  1L9D A;  3RP7 A;  1ZK7 A;  3RHA A;  4ZN0 A;  1H4M X;  1S3B A;  2OLO A;  3QSE A;  1M64 A;  1ZX9 A;  3NRN A;  4B67 A;  4CRT A;  5U1O A;  2QAE A;  3AE2 A;  4IV9 A;  2GR1 A;  2BK4 A;  3EPT A;  1JNR A;  3ALM A;  1BOH A;  3L1R A;  1Y56 B;  2Q0K A;  2A89 A;  1TQ1 A;  1YKJ A;  1C25 A;  4NTC A;  4D03 A;  2R4J A;  4BK2 A;  1PJ7 A;  4CNK A;  1E6E A;  3G5J A;  3HZU A;  4J31 A;  4FDC B;  1LVL A;  3KVE A;  3AD9 B;  2WLX A;  1YQ4 A;  4IA6 A;  3ZDN A;  4H4V A;  2BXR A;  4TM4 A;  1PXC A;  4XWR A;  2YG7 A;  1N4W A;  2VVM A;  2XCG A;  3UKL A;  1DOE A;  4PAA A;  3NYE A;  4BJY A;  1CL0 A;  2GF3 A;  4LA1 A;  3KKJ A;  3AYI A;  4FK1 A;  1IUU A;  1GAL A;  2YR5 A;  4H2N A;  4JQ9 A;  5HBP A;  4K2X A;  3P4Q A;  5HBQ A;  3SZF A;  4UDR A;  1GV4 A;  5GRT A;  2BAC A;  3P4R A;  4HA6 A;  4U8O A;  4A65 A;  4EM4 A;  5KMS A;  1D7Y A;  1GPE A;  1ONF A;  4Z24 A;  2BC0 A;  1CJ2 A;  3WE0 A;  3LB8 A;  2GVC A;  3M12 A;  2ZZC A;  4CCQ A;  1ORB A;  2JB1 A;  2R0P A;  3KPK A;  4H4W A;  1OKG A;  1CJ3 A;  2OUC A;  4Y4N A;  3UP5 A;  3GWF A;  5BUL A;  3NTD A;  5HBO A;  4JNQ A;  4U8I A;  3V76 A;  3NK0 X;  2IVE A;  2WU2 A;  3TG3 A;  5C3J A;  4GR1 A;  5HYM A;  3I3U A;  5BUK A;  5FS6 A;  1NG3 A;  2A2K A;  2X8G A;  4F67 A;  2XFQ A;  3GYI A;  4EQX A;  3OP3 A;  3SY4 A;  1WHB A;  1COY A;  2RGJ A;  3CPJ G;  1CJ4 A;  5KRQ A;  1H86 A;  3O0H A;  1DP2 A;  3AEF A;  1K0J A;  3ICT A;  4PAB A;  4BUR A;  2VSW A;  2VQ7 A;  2JAE A;  1VDC A;  4EMI A;  3AD8 B;  3H8L A;  3CPI G;  3F8D A;  4APN A;  2H89 A;  4A6N A;  3I2V A;  2B7R A;  4LII A;  3O3W A;  4UP3 A;  2EG4 B;  2KL3 A;  1H81 A;  4U8J A;  5FS7 A;  3BHK A;  2MOL A;  3DA1 A;  4GUV A;  3SXI A;  2H88 A;  2WBA A;  3AED A;  4H4U A;  4H4P A;  4Y4L A;  4JDR A;  4TM0 A;  4E0V A;  3UKA A;  2YM1 A;  3ATQ A;  1NG4 A;  4OPT A;  3AYL A;  1LPF A;  2QA1 A;  3C4N A;  3G5R A;  4P9S A;  1RSG A;  2E4G A;  3COX A;  4REK A;  1KFY A;  2WEU A;  3QVR A;  4B66 A;  4B63 A;  4H4Y A;  4Z2U A;  3TP9 A;  4DNA A;  2EQ9 A;  1B8S A;  1OJA A;  1O94 A;  2YR6 A;  4OVI A;  2B9Y A;  3ALL A;  4C77 A;  2DKH A;  3ABV A;  2JTR A;  2RAB A;  3DK4 A;  1CBO A;  3I6D A;  1ZMC A;  4B65 A;  1O5W A;  2K0Z A;  2FBW A;  3GK5 A;  2BS4 A;  1KSS A;  4GDE A;  3AAX A;  1PHH A;  3SZ0 A;  3KD9 A;  4YKF A;  4CNJ A;  4OPL A;  4IVM B;  2A87 A;  2GQF A;  3KU9 A;  4JY2 A;  1KSU A;  4H7U A;  5TR3 A;  1NEN A;  3IHM A;  2XFN A;  2VVL A;  3GYX A;  1EL7 A;  5IQ1 A;  3IF9 A;  1GET A;  2ACZ A;  1GT8 A;  1X31 B;  1GER A;  4NTE A;  1YM9 A;  2FJE A;  2GB0 A;  3C4A A;  1PBD A;  4GAP A;  2WQY A;  4ZCC A;  5KXJ A;  1YMD A;  4USR A;  2JB2 A;  2BRA A;  3P9U A;  4H2R A;  4H4X A;  3SYI A;  3RNM A;  1CF3 A;  1RYI A;  1LV0 A;  1N4U A;  3CNJ A;  4CBQ A;  3KLJ A;  1GRH A;  3OC4 A;  4H4Q A;  4J34 A;  4I59 A;  2J6P A;  2FJD A;  3CPH G;  3URH A;  4CY6 A;  1GXF A;  3NKS A;  2Y6R A;  1TDO A;  2V60 A;  2OA1 A;  3T14 A;  4YSY A;  1JRZ A;  2GR2 A;  3AE6 A;  4II3 A;  3V3O A;  4NNJ A;  4X9M A;  4Z44 A;  3NGC X;  4U8K A;  3AEC A;  4B64 A;  1CWS A;  1EL5 A;  1K4Q A;  3FMW A;  5EOW A;  2XLR A;  2BK3 A;  2BS3 A;  4H2P A;  2B9X A;  2YVF A;  2NVK X;  3IWH A;  2WES A;  3ICS A;  3AB1 A;  4J36 A;  4CY8 A;  5CQF A;  3RP6 A;  1DJN A;  2BYB A;  2PHH A;  4AOS A;  1IUT A;  2XFP A;  5KWF A;  2XVE A;  4U2T A;  2ORA A;  1GES A;  4G73 A;  1DOC A;  3FLH A;  1PDH A;  1Q1W A;  4H4T A;  5FS9 A;  4TLZ A;  1QB0 A;  1H6V A;  4II2 A;  2RGH A;  3GYJ A;  1TYT A;  2GAH B;  2A8X A;  4KX6 A;  4U2L A;  4ECH A;  2JK6 A;  3AE5 A;  3BI4 A;  3QSS A;  1L0V A;  2GEW A;  2OLN A;  1FL2 A;  1KDG A;  1DOB A;  4OPC A;  1E1M A;  3B6D A;  1HYU A;  3NK1 X;  5JCL A;  1F8S A;  2C66 A;  2EQ6 A;  1K0I A;  1ZKQ A;  5J7X A;  1GN0 A;  1RHD A;  4JNA A;  2YAU A;  5KOX A;  4JGT A;  3L8K A;  1NDA A;  1TRB A;  2X8H A;  4KPR A;  2UZZ A;  2VRM A;  2WOV A;  1E1L A;  1N4V A;  4G9K A;  3NIX A;  2WPC A;  5J60 A;  3GD4 A;  4D04 A;  3V3N A;  2MOI A;  1ZY8 A;  4BK1 A;  1REO A;  1UKV G;  2C73 A;  1D5T A;  1ZMD A;  4A99 A;  4EQR A;  2ARD A;  4GAV A;  1BOI A;  2JKC A;  5BVA A;  1CHU A;  4OPU A;  3FNJ A;  2IFD A;  1B37 A;  3QJ4 A;  4A79 A;  3CNS A;  4WH9 A;  2XVF A;  4C3X A;  4J56 A;  2UZQ A;  1PXA A;  5JCM A;  1LQU A;  2V6O A;  2C64 A;  3SFD A;  1BF3 A;  1JU2 A;  2B9W A;  2AAQ A;  3NHO X;  3K30 A;  4MJW A;  1GRB A;  1PBE A;  1OJT A;  4U8L A;  3NLC A;  3GRS A;  2Y6Q A;  3QFB A;  4NEW A;  4NEV A;  2FJB A;  2ZZ0 A;  2YM2 A;  3B3R A;  5U25 A;  2E5V A;  1MOK A;  4Z26 A;  3IPO A;  2OAL A;  1NHP A;  2IVD A;  4WX1 A;  1D4D A;  3NK2 X;  4YTP A;  2TPR A;  2XDO A;  3FIM B;  4I58 A;  1XAN A;  4H2Q A;  4AT2 A;  4DSH A;  2YG4 A;  2IFV A;  3UCL A;  4M52 A;  2JTS A;  2AQJ A;  3HYX A;  2B76 A;  3D8X A;  2GR3 A;  5KMP A;  3IC9 A;  2XVH A;  3Q9T A;  4H4Z A;  5EB4 A;  3HIX A;  5KVH A;  2GAG B;  2JTQ A;  1KF6 A;  4N9X A;  4U8N A;  1WV9 A;  2B7S A;  1M6I A;  2BCG G;  2C7G A;  1QO8 A;  4H4R A;  1VG9 A;  1TYP A;  3P1W A;  2JB3 A;  4YKG A;  3K9R A;  2WDR A;  2R9Z A;  4J57 A;  3ISH A;  4RG3 A;  3RP8 A;  3M13 A;  3SZC A;  3AYJ A;  3CNP A;  1GRG A;  2BK5 A;  4NTD A;  1DOD A;  3CGD A;  2NPX A;  2J3N A;  2WET A;  3QFA A;  3SZW A;  5EB5 A;  1EL9 A;  1F3P A;  2XLS A;  3CN8 A;  4J2W A;  1XDI A;  3T2K A;  3ZYX A;  1LTX R;  3RED A;  1CC6 A;  3P4S A;  1KNR A;  3SFE A;  3QVP A;  4YSH A;  3DJD A;  2R45 A;  2R0C A;  3DJE A;  1F8R A;  1XPQ A;  2FJA A;  2C72 A;  4O5U A;  1ZDL A;  1YQ3 A;  2C75 A;  2C76 A;  1D4E A;  1GRT A;  1GND A;  2BAB A;  1JOA A;  1UAR A;  2WOW A;  4AP1 A;  2VRL A;  3NN0 X;  2RGO A;  3GSI A;  3AAY A;  3LXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...