3NTDA

Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c531s mutant
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
565
structure length
565
Chain Sequence
MKKILIIGGVAGGASAAARARRLSETAEIIMFERGEYVSFANCGLPYHISGEIAQRSALVLQTPESFKARFNVEVRVKHEVVAIDRAAKLVTVRRLLDGSEYQESYDTLLLSPGAAPIVPPIPGVDNPLTHSLRNIPDMDRILQTIQMNNVEHATVVGGGFIGLEMMESLHHLGIKTTLLELADQVMTPVDREMAGFAHQAIRDQGVDLRLGTALSEVSYQVQTHVASDAAGEDTAHQHIKGHLSLTLSNGELLETDLLIMAIGVRPETQLARDAGLAIGELGGIKVNAMMQTSDPAIYAVGDAVEEQDFVTGQACLVPLAGPANRQGRMAADNMFGREERYQGTQGTAICKVFDLAVGATGKNEKQLKQAGIAFEKVYVHTASHASYYPGAEVVSFKLLFDPVKGTIFGAQAVGKDGIDKRIDVMAVAQRAGMTVEQLQHLELSYAPPYGSAKDVINQAAFVASNIIKGDATPIHFDQIDNLSEDQLLLDVRNPGELQNGGLEGAVNIPVDELRDRMHELPKDKEIIIFSQVGLRGNVAYRQLVNNGYRARNLIGGYRTYKFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization of an NADH-Dependent Persulfide Reductase from Shewanella loihica PV-4: Implications for the Mechanism of Sulfur Respiration via FAD-Dependent Enzymes .
pubmed doi rcsb
source organism Shewanella loihica
molecule tags Oxidoreductase
molecule keywords FAD-dependent pyridine nucleotide-disulphide oxidoreductase
total genus 184
structure length 565
sequence length 565
chains with identical sequence B
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2010-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3ntdA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ntdA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ntdA01
3HZLA 1GOSA 1E1MA 4WH9A 5JCIA 2B7SA 1LVLA 3CTYA 3AD8B 4Y4LA 3UKFA 3ILMA 2GQFA 1JNZA 3IHGA 4Z25A 1MXTA 1H84A 1RP0A 2XVHA 2QCUA 4H4WA 1GRAA 2YVJA 4M52A 3CGBA 1URHA 3DJGX 3FIMB 1W4XA 3GRSA 1M6IA 1ZOYA 3QVPA 5BULA 1GV4A 4BJZA 2YLTA 4H4RA 4TM4A 3UKLA 3II4A 3MZZA 4A6NA 1QB0A 3DGHA 2ZBWA 4REKA 1RHDA 3QSSA 5DBJA 2R0GA 4N9XA 5BUKA 5JCNA 4YT0A 1E0CA 2R46A 3LZWA 3SGLA 1B5QA 3AB1A 5J7XA 3VR9A 4YSZA 4H4SA 4ZN0A 1NEKA 1ONFA 4A9WA 1D7LA 1NHRA 3H8IA 4Z24A 2JB2A 2WPFA 1S2QA 1YQ4A 2CDUA 1BZLA 4CCRA 3AE7A 5LV9A 5JCKA 3ABVA 3NLCA 2VRMA 2K0ZA 2JBVA 3ALMA 4EM4A 4K22A 4B65A 3TP9A 4GDPA 3G5RA 4U8PA 4IVOB 3EPTA 3HZUA 2DCQA 3GSIA 1H81A 2BACA 2BS4A 1ZOVA 3R2UA 2YAUA 1LQUA 4TLXA 3FNJA 2IVEA 2WBAA 3F8PA 1M64A 3LOVA 4MJWA 4EMIA 2W0HA 4H4PA 4YKGA 3CNPA 5LAMA 3S61A 5U1OA 2V6OA 1EL9A 2GR3A 2A89A 5J60A 4I58A 4JQ9A 4DSHA 3QFAA 5TR3A 1GRHA 3DK8A 4B66A 1PBEA 1OJCA 3QFBA 2BS2A 1GPEA 2WOWA 3B3RA 2Z5YA 1H4KX 2B76A 1D4CA 4A99A 2H89A 2XDOA 2JK6A 1ZP0A 1P2HA 2BK5A 4U2TA 4WX1A 3SM8A 1F8SA 4D04A 2YVGA 3LADA 1CJCA 1VDCA 2GRTA 2X50A 2GMHA 2GR0A 3D8XA 3AD7B 5L46A 2O9ZA 3K7MX 4K5SA 4YSXA 2HQMA 2OLOA 3CNDA 3TG1B 3NK0X 5GSNA 4H4TA 3B6DA 4D03A 2XFNA 4USQA 4A6NB 4H7UA 3C96A 4EQWA 4JY2A 3FPZA 1OJ9A 3P4PA 4O5UA 4GR1A 4AT2A 2A87A 1CBOA 1VG9A 3NK2X 1GXFA 1P2EA 1YKJA 2YLSA 4CCQA 4IA6A 4K5RA 3NHVA 1REOA 2X3NA 1JNRA 1GTEA 5U63A 3GYJA 3V3OA 2X8GA 1IUWA 3DJDA 2BXRA 2WS3A 3DMEA 4FK1C 4DGKA 3DK4A 4LU6A 3S5WA 3ZDNA 1DODA 4X9MA 1E1LA 1XANA 3UOZA 2C3DA 3UOXA 4HB9A 3NKSA 4JNAA 2DKHA 3CGEA 5GRTA 2FJEA 4EIQA 3NHOX 4H2NA 1D4EA 2YG7A 1F6MA 2BC1A 2BCGG 2WLRA 3KD9A 3OZ2A 4OPGA 1AOGA 4F67A 2QAEA 1EL7A 2GEWA 1F8RA 4PABA 2YLZA 4RG3A 2ZZCA 2QA1A 3ALJA 4NZHA 3ICSA 1F3PA 2YG3A 3V3NA 2CULA 3JSKA 4A7AA 4Z2TA 4OPUA 4AP3A 1TDEA 1CWSA 1DP2A 3UOYA 2EQ7A 3P3AA 2BS3A 4EMWA 2JTQA 1N1PA 1PDHA 4B69A 5C2TA 1PBBA 2GAHB 1ZMDA 2PYXA 1ZX9A 3Q6JA 1IUXA 4IV9A 2B7RA 2GQWA 1LQTA 2UZZA 4K7ZA 4CY8A 2XLPA 3PS9A 5HPAA 1PXCA 1VRQB 3IF9A 3CN8A 3HIXA 1O94A 1TDOA 1DOEA 1YT8A 1H7WA 1X31B 2YWLA 1TDKA 1VG0A 2BYBA 3BI2A 3H4KA 4H50A 2GV8A 3QVRA 2GH5A 1Y0PA 1GNDA 3KKJA 4U8MA 5CKUA 5IPYA 2XFPA 4OPTA 4RG4A 1NHQA 1S2YA 2R0CA 3SQPA 1OJTA 1CJ4A 3FBSA 4CNJA 2YLWA 2BK3A 4Z43A 3EAOA 3AEAA 2YQUA 1TYTA 3NH3X 3AYJA 2H88A 2ZZBA 5IQ4A 4YWOA 3UTGA 1CHUA 5FS6A 4U8JA 3BI5A 4BK3A 4H2RA 1EBDA 1LV0A 3P9UA 4FDCB 3WE0A 3F8RA 3I3LA 3UKKA 1D7YA 3AYIA 1GERA 1L9CA 1TQ1A 1LJ1A 2XFQA 4H2PA 4KPRA 3RP7A 4AOXA 4YTPA 1H4MX 2C3CA 1GEUA 3AE6A 3I6DA 1LTXR 3LB8A 4NTEA 4XWZA 1GMXA 1NG3A 2R45A 2Q0KA 1GRGA 2XLUA 2WPEA 4P9SA 1FECA 3LJPA 1JU2A 3RP8A 3NTAA 2OLNA 3IPOA 3ISHA 4U8NA 1H86A 2JB1A 1CJ2A 1H6VA 1C25A 2GF3A 2ORAA 3GD4A 4ZCDA 3AE8A 5KWFA 2B9YA 2HHGA 2EQ8A 4AP1A 3GDPA 4YKFA 3UTFA 4E0VA 3NIXA 1DNCA 1GRTA 1GREA 3NYFA 1DJQA 4OPCA 1L9DA 3IC9A 1CWTA 3L1RA 2KL3A 3GYIA 2WU5A 2A8XA 2Q7VA 1FEBA 2YVFA 4H4ZA 4U8KA 4Z44A 3KLJA 2E4GA 3P1WA 4Y4NA 1UKVG 2YR6A 3DH9A 3KU9A 2BXSA 3AE3A 1DOBA 1BKWA 2R4EA 1Y56B 3QJ4A 3DA1A 1JOAA 1VQWA 3COXA 4OPIA 4A79A 3OP3A 3H8LA 4HA6A 2V60A 4J34A 2AAQA 2R0PA 3K9RA 2C67A 2WLXA 2VVLG 3C4NA 3GDNA 5EB4A 3VR8A 1SEZA 1KSUA 4ADWA 3RHAA 3PO7A 2FJDA 4H2QA 4NTDA 3ICTA 5KVIA 3K7TA 5KXJA 1B37A 1QXNA 3IPPA 2EQ9A 5FS7A 2XFOA 4LA1A 5U25A 4CBQA 1NHPA 3NYCA 1CC4A 1GRFA 1E1KA 1L9EA 2C7GA 3GK5A 2GVCA 1E1NA 1Q1WA 2XFUA 2E1MA 1GETA 2VZ2A 2YLRA 3ITJA 4XWRA 2IIDA 1QLBA 2QA2A 4UP3A 3AEFA 2XVJA 3CNSA 4IA5A 4DNAA 2GWFA 3URHA 2JTSA 2Q0LA 3AE5A 4YSHA 3O3WA 1ZDLA 3I2VA 2V3AA 2IFDA 1S3BA 3NG7X 1IUSA 1CC2A 1FL2A 1JEHA 1K0LA 2J3NA 4UDQA 3CPJG 3BNMA 4KX6A 1ELIA 1DXLA 3G5JA 3CNTA 2WP6A 2VRLA 2CFYA 2WDQA 4H4UA 4OVIA 4Y4MA 1ZKQA 2YG6A 3AAXA 1DJNA 1JRZA 1KNPA 3NNEA 2Q6UA 2YM2A 3AEGA 2JB3A 3F8DA 5HBOA 3RNMA 2APGA 1Z6LA 2C75A 1YMDA 4BV6A 4OCGA 2C66A 2TMDA 4J56A 1WV9A 2CVJA 2GMJA 3REDA 5EBKA 4USRA 5M10A 4PAAA 2WDVA 2XVEA 3PVCA 1IJHA 2JKCA 2XVIA 2EG3A 3FG2P 1BOHA 2FBWA 1BGNA 3UCLA 1BGJA 3CIRA 1COYA 4TM0A 1YMKA 2FJAA 4UDRA 1FEAA 1YQ3A 2RGOA 2C64A 5EB5A 1VEEA 2JTRA 1TYPA 3AEBA 3T37A 3FMWA 1YQZA 4YXDA 3LZXA 2VVLA 1BF3A 1Q9IA 3DGZA 1O5WA 1NDAA 3L8KA 2PHHA 3BI4A 3P4SA 5HXIA 3GWDA 3D1PA 1CJ3A 1H7XA 1K4QA 2NPXA 4A5LA 1MOKA 3AE4A 1PN0A 1E39A 4B64A 3AECA 1BOIA 1H83A 1N4UA 5EOWA 4EQSA 4APNA 1FCDA 2MOIA 2AR8A 3D1CA 1D4DA 1T3KA 1PBDA 1Y56A 2YM1A 3GWFA 4YTNA 3UTNX 2UZQA 1E7PA 1K0JA 1XDIA 4JN9A 1ZMCA 2C70A 1RYIA 4NEWA 4YTMA 2YLXA 2X99A 1IUTA 1HZMA 1CF3A 2WPCA 2YR5A 4GCMA 4GRTA 4BJYA 1YM9A 3ATRA 3HWIA 1TRBA 3VQRA 4B68A 2GR2A 4J33A 2B9WA 3QSMA 4J31A 3FLHA 2R4JA 4CRTA 1EL8A 1KSSA 2XYOA 5BVAA 1RHSA 3AEEA 2YG5A 1EL5A 4BURA 3KVEA 3GD3A 1NENA 1JRXA 2AQJA 1YY5A 2DKIA 2YR4A 1QJDA 3CNJA 5HBLA 3AEDA 4J57A 4ZCCA 3UOVA 4BK2A 2I0ZA 2WU2A 1PBCA 3SFEA 1ZY8A 3UTHA 3NT6A 2F5ZA 2VSWA 3P4QA 4JGTA 4I59A 1PJ7A 4AOSA 4BK1A 1KNRA 2WP9A 2ZZ0A 3AE9A 4FX9A 4U2SA 4UDPA 5HY5A 4C3YA 2BCPA 2IFVA 2VQBA 1CC6A 3UKAA 1PJ6A 2Z5XA 2ACZA 5KOWA 4JY3A 4CY6A 2A2KA 2RGHA 4U8OA 1NHSA 2WOIA 1YMLA 1HYUA 3DK9A 4TLZA 4C74A 1ZK7A 5HBQA 1RSGA 2OALA 2BABA 1TDNA 4GUVA 5LAOA 4C77A 2GR1A 2C73A 2EG4A 3EF6A 3FOJA 4JDRA 4J2WA 4J36A 3VRBA 4TM3A 2WQYA 3TG3A 2EG4B 3AD9B 1B4VA 3RP6A 3ICRA 3DJEA 4EQXA 3GMCA 1TDFA 4B67A 1DOCA 3IWHA 1LPFA 1PHHA 2R9ZA 4NEVA 2B9XA 4NTCA 3NK1X 2Y6RA 4Z26A 3UP4A 5IQ1A 1GALA 3KA7A 4GDEA 3AXBA 3NRNA 3QSEA 2JAEA 2IVDA 5KRQA 3VRAA 2VVMA 4ECHA 2OUCA 2XVFA 3I3UA 1YS0A 3FS5A 1CL0A 2C72A 3NGCX 3R9UA 3VRDB 4IVMB 4EIPA 4XXGA 3P4RA 2C76A 4DSGA 1IUVA 3IWAA 4EMJA 3LXDA 1MO9A 4U8LA 5M0ZA 2WESA 5HHFA 5BRTA 3M13A 5FS8A 1GRBA 1N4VA 1B8SA 3AE1A 4OPDA 1XPQA 3GMBA 2WOVA 4B63A 2VQ7A 5KOXA 1KDGA 4C3XA 2XLRA 2XLTA 4A65A 3EANA 3M0OA 2J6PA 1PXBA 4RSLA 2MRMA 2Y6QA 4WCTA 3E1TA 3GRTA 3NN6X 3M12A 2E5VA 3CPHG 4H4VA 3OLHA 3V76A 5HBPA 1FOHA 3CGDA 4EM3A 3O0HA 4O5QA 1E6EA 5HYMA 5KVHA 1H82A 2EQ6A 4H4QA 5FS9A 1GTHA 2RGJA 4OPLA 2VOUA 4JNQA 3AYLA 4U2LA 4X4JA 3ATQA 4X9NA 4FK1A 1UARA 5ER0A 1N4WA 4C5OA 1JRYA 4Z2UA 4AT0A 3K30A 2BK4A 4ICYA 3AE2A 1GESA 4U8IA 3UP5A 1OJAA 2WEUA 4GF7A 5JCLA 1K0IA 2WHDA 4CNKA 2YG4A 2ARDA 3C4AA 2V5ZA 1D5TA 1OJDA 1PXAA 3G5QA 2FJBA 3CGCA 4YSYA 3SFDA 3DJJA 1IUUA 1GN0A 2WETA 2BA9A 4H4YA 2X8CA 3ADAB 3K7QX 1BWCA 3NYEA 3KPFA 1XHCA 3NTDA 1ORBA 1NAAA 3Q9TA 3OC4A 2BC0A 2XLSA 1F8WA 3ALLA 5JCMA 3UKPA 2MOLA 1KF6A 2RABA 5CQFA 1NPXA 2GAGB 2WP5A 1CWRA 1GT8A 4EQRA 3AWIA 2TPRA 3NN0X 1S3EA 4LIIA 3UTEA 3UKQA 1NG4A 2OA1A 2V61A 1V59A 2X8HA 3CPIG 1OKGA 2OAMA 2FSXA 3IHMA 4K2XA 4K8DA 2XCGA 4TM1A 3BHKA 5FMHA 4WH7A 1WHBA 2GB0A 1L0VA 2WDRA 5C3JA 1PBFA 1PS9A 1GSNA 2V3BA 2C65A 1QO8A 3ZYXA 2NVKX 1KFYA 4B1BA 4Z2RA 4H4XA 1PJ5A 1Q1RA 3BNUA 3G5SA 3UKHA 3F4AA 3AAYA 3BHFA 1O95A
chains in the Genus database with same CATH superfamily
3HZLA 2BRAA 1GOSA 1E1MA 4WH9A 5JCIA 2B7SA 1LVLA 3CTYA 3AD8B 4Y4LA 3UKFA 3ILMA 2GQFA 1JNZA 3IHGA 4Z25A 1MXTA 1H84A 1RP0A 2XVHA 2QCUA 4H4WA 1GRAA 2YVJA 4M52A 3CGBA 4II3A 1URHA 3DJGX 3FIMB 1W4XA 3GRSA 1M6IA 1ZOYA 3QVPA 5BULA 1GV4A 4BJZA 2YLTA 4YTNA 4H4RA 4TM4A 3UKLA 3II4A 3MZZA 4A6NA 1QB0A 3DGHA 2ZBWA 4REKA 1RHDA 3QSSA 5DBJA 2R0GA 4N9XA 5BUKA 5JCNA 4YT0A 1E0CA 2R46A 3LZWA 3SGLA 1B5QA 3AB1A 3T2ZA 5J7XA 3VR9A 4YSZA 4H4SA 4ZN0A 1NEKA 1ONFA 4A9WA 1D7LA 1NHRA 3H8IA 4Z24A 2JB2A 2WPFA 1S2QA 1YQ4A 2CDUA 1BZLA 4CCRA 3AE7A 5LV9A 5JCKA 3ABVA 3NLCA 2VRMA 2K0ZA 2JBVA 4G9KA 3ALMA 4EM4A 4K22A 4B65A 3TP9A 4GDPA 3G5RA 4U8PA 4IVOB 3EPTA 3HZUA 2DCQA 3GSIA 1H81A 2BACA 2BS4A 1ZOVA 3R2UA 2YAUA 1LQUA 4TLXA 3FNJA 2IVEA 2WBAA 3F8PA 1M64A 3LOVA 4MJWA 4EMIA 2W0HA 4H4PA 4YKGA 3CNPA 5LAMA 3S61A 5U1OA 2V6OA 1EL9A 2GR3A 2A89A 5J60A 4I58A 4JQ9A 4DSHA 3QFAA 5TR3A 1GRHA 3DK8A 3CMMA 1PBEA 4B66A 1OJCA 3QFBA 2BS2A 1GPEA 2WOWA 3B3RA 2Z5YA 1H4KX 2B76A 1D4CA 4A99A 2H89A 2XDOA 2JK6A 1ZP0A 1P2HA 2BK5A 4U2TA 4WX1A 3SM8A 1F8SA 4D04A 2YVGA 3LADA 1CJCA 1VDCA 2GRTA 2X50A 2GMHA 2GR0A 3D8XA 3AD7B 5L46A 2O9ZA 3K7MX 4K5SA 4YSXA 2HQMA 2OLOA 3CNDA 3TG1B 3NK0X 5GSNA 4H4TA 3B6DA 4D03A 2XFNA 4USQA 4A6NB 4H7UA 3C96A 4EQWA 4JY2A 3FPZA 1OJ9A 3P4PA 4O5UA 4GR1A 4AT2A 2A87A 1CBOA 1VG9A 3NK2X 1GXFA 1P2EA 1YKJA 2YLSA 4CCQA 4IA6A 4K5RA 3NHVA 1REOA 2X3NA 1JNRA 1GTEA 5U63A 3GYJA 3V3OA 3T2KA 2X8GA 1IUWA 3DJDA 2BXRA 2WS3A 3DMEA 4FK1C 4DGKA 3DK4A 4LU6A 3S5WA 3ZDNA 1DODA 4X9MA 1E1LA 1XANA 3UOZA 2C3DA 3UOXA 4HB9A 3NKSA 4JNAA 2DKHA 3CGEA 5GRTA 2FJEA 3SZCA 4EIQA 3NHOX 4H2NA 1D4EA 2YG7A 1F6MA 2BC1A 2BCGG 2WLRA 3KD9A 3OZ2A 4OPGA 1AOGA 4F67A 3SYIA 2QAEA 1EL7A 2GEWA 1F8RA 4PABA 2YLZA 4RG3A 2ZZCA 2QA1A 3ALJA 4NZHA 3ICSA 1F3PA 2YG3A 3V3NA 2CULA 3JSKA 4A7AA 4Z2TA 4OPUA 4AP3A 1TDEA 1CWSA 1DP2A 3SZFA 2EQ7A 3UOYA 3P3AA 2BS3A 4EMWA 2JTQA 1N1PA 1PDHA 4B69A 5C2TA 1PBBA 2GAHB 1ZMDA 2PYXA 1ZX9A 3Q6JA 3KPKA 1IUXA 4IV9A 2B7RA 2GQWA 1LQTA 2UZZA 4K7ZA 4CY8A 2XLPA 3PS9A 5HPAA 1PXCA 1VRQB 3IF9A 3CN8A 3HIXA 1O94A 1TDOA 1DOEA 1YT8A 1H7WA 1X31B 2YWLA 1TDKA 1VG0A 2BYBA 3BI2A 3H4KA 4H50A 2GV8A 3QVRA 2GH5A 1Y0PA 1GNDA 3KKJA 4U8MA 5CKUA 5IPYA 2XFPA 4OPTA 4RG4A 1NHQA 1S2YA 2R0CA 3SQPA 1OJTA 1CJ4A 3FBSA 4CNJA 2YLWA 3T31A 2BK3A 4Z43A 3EAOA 3AEAA 2YQUA 1TYTA 3NH3X 3AYJA 2H88A 2ZZBA 5IQ4A 5KMSA 4YWOA 3UTGA 1CHUA 5FS6A 4U8JA 3BI5A 4BK3A 4H2RA 1EBDA 1LV0A 3P9UA 4FDCB 3WE0A 3F8RA 3I3LA 3UKKA 1D7YA 3AYIA 1GERA 1L9CA 1TQ1A 1LJ1A 2XFQA 4G73A 4H2PA 4KPRA 3RP7A 4AOXA 1H4MX 2C3CA 1GEUA 3AE6A 3I6DA 1LTXR 3LB8A 4NTEA 4XWZA 1GMXA 1NG3A 2R45A 2Q0KA 1GRGA 2XLUA 2WPEA 4P9SA 1FECA 3LJPA 1JU2A 3RP8A 3NTAA 2OLNA 3IPOA 3ISHA 4U8NA 1H86A 2JB1A 1CJ2A 1H6VA 1C25A 2GF3A 2ORAA 3GD4A 4ZCDA 3AE8A 5KWFA 2B9YA 2HHGA 2EQ8A 4AP1A 3GDPA 4YKFA 3UTFA 4E0VA 3NIXA 1DNCA 1GRTA 1GREA 3NYFA 1DJQA 4OPCA 1L9DA 3IC9A 1CWTA 3L1RA 2KL3A 3GYIA 2WU5A 2A8XA 2Q7VA 1FEBA 2YVFA 4H4ZA 4U8KA 4Z44A 3KLJA 2E4GA 3P1WA 4Y4NA 1UKVG 2YR6A 3DH9A 3KU9A 2BXSA 3AE3A 1DOBA 1BKWA 3T2YA 2R4EA 1Y56B 3QJ4A 3DA1A 1JOAA 1VQWA 3COXA 4OPIA 4A79A 3OP3A 3H8LA 4HA6A 2V60A 4J34A 2AAQA 2R0PA 3K9RA 2C67A 2WLXA 2VVLG 3C4NA 3GDNA 5EB4A 3VR8A 1SEZA 1KSUA 4ADWA 3RHAA 3PO7A 2FJDA 4H2QA 4NTDA 3ICTA 5KVIA 3K7TA 5KXJA 1B37A 1QXNA 3IPPA 2EQ9A 5FS7A 2XFOA 4LA1A 5U25A 2BRYA 4CBQA 1NHPA 3NYCA 1CC4A 1GRFA 1E1KA 3HYWA 1L9EA 2C7GA 5KMRA 3GK5A 2GVCA 1E1NA 1Q1WA 2XFUA 2E1MA 1GETA 2VZ2A 2YLRA 3ITJA 4XWRA 2IIDA 1QLBA 2QA2A 4UP3A 3AEFA 2XVJA 3CNSA 4IA5A 4DNAA 2GWFA 3URHA 2JTSA 2Q0LA 3AE5A 4YSHA 3O3WA 1ZDLA 3I2VA 2V3AA 2IFDA 1S3BA 3NG7X 1IUSA 1CC2A 1FL2A 1JEHA 1K0LA 2J3NA 4UDQA 3CPJG 3BNMA 4KX6A 1ELIA 1DXLA 3G5JA 3CNTA 2WP6A 2VRLA 2CFYA 2WDQA 4H4UA 4OVIA 4Y4MA 1ZKQA 2YG6A 3AAXA 1DJNA 1JRZA 1KNPA 3NNEA 2Q6UA 2YM2A 3AEGA 2JB3A 3F8DA 5HBOA 4GAPA 2APGA 1Z6LA 2C75A 1YMDA 3RNMA 4OCGA 2C66A 2TMDA 4BV6A 4J56A 1WV9A 2CVJA 2GMJA 3REDA 5EBKA 4USRA 5M10A 4PAAA 2WDVA 2XVEA 3PVCA 1IJHA 2JKCA 2XVIA 2EG3A 3FG2P 1BOHA 2FBWA 1BGNA 3UCLA 1BGJA 3CIRA 1COYA 4II2A 4TM0A 1YMKA 2FJAA 4UDRA 1FEAA 1YQ3A 2RGOA 2C64A 5EB5A 1VEEA 2JTRA 1TYPA 3AEBA 3T37A 3FMWA 1YQZA 4YXDA 3LZXA 2VVLA 1BF3A 1Q9IA 3DGZA 1O5WA 1NDAA 3L8KA 2PHHA 3SZ0A 3BI4A 3P4SA 5HXIA 3GWDA 3D1PA 3SX6A 5KMPA 1CJ3A 1H7XA 1K4QA 5KMQA 2NPXA 3SY4A 1MOKA 3AE4A 4A5LA 5KNLA 1PN0A 1E39A 4B64A 3AECA 1BOIA 1H83A 1N4UA 5EOWA 4EQSA 4APNA 1FCDA 2MOIA 2AR8A 3D1CA 1D4DA 1T3KA 1PBDA 1Y56A 2YM1A 3GWFA 4NWZA 3UTNX 2UZQA 1E7PA 1K0JA 1XDIA 4JN9A 1ZMCA 2C70A 1RYIA 4NEWA 4YTMA 3T0KA 2YLXA 2X99A 4GAVA 1IUTA 1HZMA 1CF3A 2WPCA 2YR5A 4GCMA 4GRTA 4BJYA 1YM9A 3ATRA 3HWIA 1TRBA 3VQRA 4B68A 2GR2A 4J33A 2B9WA 3QSMA 4J31A 3FLHA 2R4JA 4CRTA 1EL8A 1KSSA 2XYOA 5BVAA 1RHSA 3AEEA 2YG5A 1EL5A 4BURA 3KVEA 3GD3A 1NENA 1JRXA 2AQJA 1YY5A 2DKIA 2YR4A 1QJDA 3CNJA 5HBLA 3AEDA 4J57A 4ZCCA 3UOVA 4BK2A 2I0ZA 2WU2A 1PBCA 3SFEA 1ZY8A 3UTHA 3NT6A 2F5ZA 2VSWA 3P4QA 4JGTA 4I59A 1PJ7A 4AOSA 4BK1A 1KNRA 2WP9A 2ZZ0A 3AE9A 4FX9A 4U2SA 4UDPA 5HY5A 4C3YA 2BCPA 2IFVA 2VQBA 3SZWA 1CC6A 3UKAA 1PJ6A 2Z5XA 2ACZA 5KOWA 4JY3A 4CY6A 2A2KA 2RGHA 4U8OA 1NHSA 2WOIA 1YMLA 1HYUA 3DK9A 4TLZA 4C74A 1ZK7A 4G6GA 5HBQA 1RSGA 2OALA 2BABA 1TDNA 4GUVA 5LAOA 4NNJA 4C77A 2GR1A 2C73A 2EG4A 3EF6A 3FOJA 4JDRA 4J2WA 4J36A 3VRBA 4G74A 4TM3A 2WQYA 3TG3A 2EG4B 3AD9B 1B4VA 3RP6A 3ICRA 3DJEA 4EQXA 3GMCA 1TDFA 4B67A 1DOCA 3IWHA 1LPFA 1PHHA 2R9ZA 4NEVA 2B9XA 4NTCA 3NK1X 2Y6RA 4Z26A 3UP4A 5IQ1A 1GALA 3KA7A 4GDEA 3AXBA 3NRNA 3QSEA 2JAEA 2IVDA 5KRQA 3VRAA 2VVMA 4ECHA 2OUCA 2XVFA 3I3UA 1YS0A 3FS5A 1CL0A 2C72A 3NGCX 3R9UA 3VRDB 4IVMB 4EIPA 4XXGA 4G6HA 3P4RA 2C76A 4DSGA 1IUVA 3IWAA 4EMJA 3LXDA 1MO9A 4U8LA 5M0ZA 2WESA 5HHFA 5BRTA 3M13A 5FS8A 1GRBA 1N4VA 1B8SA 3AE1A 4OPDA 1XPQA 3GMBA 2WOVA 4B63A 2VQ7A 5KOXA 1KDGA 4C3XA 2XLRA 2XLTA 4A65A 3EANA 3M0OA 2J6PA 1PXBA 4RSLA 2MRMA 2Y6QA 4WCTA 3E1TA 3GRTA 3NN6X 3M12A 2E5VA 3CPHG 4H4VA 3OLHA 3V76A 5HBPA 1FOHA 3CGDA 4EM3A 3O0HA 4O5QA 1E6EA 5HYMA 5KVHA 1H82A 2EQ6A 4H4QA 5FS9A 1GTHA 2RGJA 4OPLA 2VOUA 4JNQA 3AYLA 4U2LA 4X4JA 3ATQA 4X9NA 4FK1A 1UARA 5ER0A 1N4WA 4C5OA 1JRYA 4Z2UA 4AT0A 3K30A 2BK4A 4ICYA 3AE2A 1GESA 4U8IA 3UP5A 1OJAA 2WEUA 4GF7A 5JCLA 1K0IA 3T14A 2WHDA 4CNKA 2YG4A 2ARDA 3C4AA 2V5ZA 1D5TA 1OJDA 1PXAA 3G5QA 2FJBA 3CGCA 4YSYA 3SFDA 3DJJA 1IUUA 1GN0A 2WETA 2BA9A 4H4YA 3HYXA 4YTPA 2X8CA 3ADAB 3K7QX 1BWCA 3HYVA 3NYEA 3KPFA 1XHCA 3NTDA 1ORBA 1NAAA 3Q9TA 3OC4A 2BC0A 2XLSA 3SXIA 1F8WA 3ALLA 5JCMA 3UKPA 2MOLA 1KF6A 2RABA 5CQFA 1NPXA 2GAGB 2WP5A 1CWRA 1GT8A 4EQRA 2Q82A 2TPRA 3AWIA 3NN0X 1S3EA 4LIIA 3UTEA 3GYXA 3UKQA 1NG4A 2OA1A 2V61A 1V59A 2X8HA 3CPIG 1OKGA 2OAMA 2FSXA 3IHMA 4K2XA 4K8DA 2XCGA 4TM1A 3BHKA 5FMHA 4WH7A 1WHBA 2GB0A 1L0VA 2WDRA 5C3JA 1PBFA 1PS9A 1GSNA 2V3BA 2C65A 1QO8A 3ZYXA 2NVKX 1KFYA 4B1BA 4Z2RA 4H4XA 1PJ5A 1Q1RA 3BNUA 3G5SA 2C4CA 3UKHA 3F4AA 3AAYA 3BHFA 1O95A
chains in the Genus database with same CATH topology
3HZLA 2BRAA 1GOSA 1E1MA 4WH9A 5JCIA 2B7SA 1LVLA 3CTYA 3AD8B 4Y4LA 3UKFA 3ILMA 2GQFA 1JNZA 3IHGA 4Z25A 1MXTA 1H84A 1RP0A 2XVHA 2QCUA 4H4WA 1GRAA 2YVJA 4M52A 3CGBA 4II3A 1URHA 3DJGX 3FIMB 1W4XA 3GRSA 1M6IA 1ZOYA 3QVPA 5BULA 1GV4A 4BJZA 2YLTA 4YTNA 4H4RA 4TM4A 3UKLA 3II4A 3MZZA 4A6NA 1QB0A 3DGHA 2ZBWA 4REKA 1RHDA 3QSSA 5DBJA 2R0GA 4N9XA 5BUKA 5JCNA 4YT0A 1E0CA 2R46A 3LZWA 3SGLA 1B5QA 3AB1A 3T2ZA 5J7XA 3VR9A 4YSZA 4H4SA 4ZN0A 1NEKA 1ONFA 4A9WA 1D7LA 1NHRA 3H8IA 4Z24A 2JB2A 2WPFA 1S2QA 1YQ4A 2CDUA 1BZLA 4CCRA 3AE7A 5LV9A 5JCKA 3ABVA 3NLCA 2VRMA 2K0ZA 2JBVA 4G9KA 3ALMA 4EM4A 4K22A 4B65A 3TP9A 4GDPA 3G5RA 4U8PA 4IVOB 3EPTA 3HZUA 2DCQA 3GSIA 1H81A 2BACA 2BS4A 1ZOVA 3R2UA 2YAUA 1LQUA 4TLXA 3FNJA 2IVEA 2WBAA 3F8PA 1M64A 3LOVA 4MJWA 4EMIA 2W0HA 4H4PA 4YKGA 3CNPA 5LAMA 3S61A 5U1OA 2V6OA 1EL9A 2GR3A 2A89A 5J60A 4I58A 4JQ9A 4DSHA 3QFAA 5TR3A 1GRHA 3DK8A 3CMMA 1PBEA 4B66A 1OJCA 3QFBA 2BS2A 1GPEA 2WOWA 3B3RA 2Z5YA 1H4KX 2B76A 1D4CA 4A99A 2H89A 2XDOA 2JK6A 1ZP0A 1P2HA 2BK5A 4U2TA 4WX1A 3SM8A 1F8SA 4D04A 2YVGA 3LADA 1CJCA 1VDCA 2GRTA 2X50A 2GMHA 2GR0A 3D8XA 3AD7B 5L46A 2O9ZA 3K7MX 4K5SA 4YSXA 2HQMA 2OLOA 3CNDA 3TG1B 3NK0X 5GSNA 4H4TA 3B6DA 4D03A 2XFNA 4USQA 4A6NB 4H7UA 3C96A 4EQWA 4JY2A 3FPZA 1OJ9A 3P4PA 4O5UA 4GR1A 4AT2A 2A87A 1CBOA 1VG9A 3NK2X 1GXFA 1P2EA 1YKJA 2YLSA 4CCQA 4IA6A 4K5RA 3NHVA 1REOA 2X3NA 1JNRA 1GTEA 5U63A 3GYJA 3V3OA 3T2KA 2X8GA 1IUWA 3DJDA 2BXRA 2WS3A 3DMEA 4FK1C 4DGKA 3DK4A 4LU6A 3S5WA 3ZDNA 1DODA 4X9MA 1E1LA 1XANA 3UOZA 2C3DA 3UOXA 4HB9A 3NKSA 4JNAA 2DKHA 3CGEA 5GRTA 2FJEA 3SZCA 4EIQA 3NHOX 4H2NA 1D4EA 2YG7A 1F6MA 2BC1A 2BCGG 2WLRA 3KD9A 3OZ2A 4OPGA 1AOGA 4F67A 3SYIA 2QAEA 1EL7A 2GEWA 1F8RA 4PABA 2YLZA 4RG3A 2ZZCA 2QA1A 3ALJA 4NZHA 3ICSA 1F3PA 2YG3A 3V3NA 2CULA 3JSKA 4A7AA 4Z2TA 4OPUA 4AP3A 1TDEA 1CWSA 1DP2A 3SZFA 2EQ7A 3UOYA 3P3AA 2BS3A 4EMWA 2JTQA 1N1PA 1PDHA 4B69A 5C2TA 1PBBA 2GAHB 1ZMDA 2PYXA 1ZX9A 3Q6JA 3KPKA 1IUXA 4IV9A 2B7RA 2GQWA 1LQTA 2UZZA 4K7ZA 4CY8A 2XLPA 3PS9A 5HPAA 1PXCA 1VRQB 3IF9A 3CN8A 3HIXA 1O94A 1TDOA 1DOEA 1YT8A 1H7WA 1X31B 2YWLA 1TDKA 1VG0A 2BYBA 3BI2A 3H4KA 4H50A 2GV8A 3QVRA 2GH5A 1Y0PA 1GNDA 3KKJA 4U8MA 5CKUA 5IPYA 2XFPA 4OPTA 4RG4A 1NHQA 1S2YA 2R0CA 3SQPA 1OJTA 1CJ4A 3FBSA 4CNJA 2YLWA 3T31A 2BK3A 4Z43A 3EAOA 3AEAA 2YQUA 1TYTA 3NH3X 3AYJA 2H88A 2ZZBA 5IQ4A 5KMSA 4YWOA 3UTGA 1CHUA 5FS6A 4U8JA 3BI5A 4BK3A 4H2RA 1EBDA 1LV0A 3P9UA 4FDCB 3WE0A 3F8RA 3I3LA 3UKKA 1D7YA 3AYIA 1GERA 1L9CA 1TQ1A 1LJ1A 2XFQA 4G73A 4H2PA 4KPRA 3RP7A 4AOXA 1H4MX 2C3CA 1GEUA 3AE6A 3I6DA 1LTXR 3LB8A 4NTEA 4XWZA 1GMXA 1NG3A 2R45A 2Q0KA 1GRGA 2XLUA 2WPEA 4P9SA 1FECA 3LJPA 1JU2A 3RP8A 3NTAA 2OLNA 3IPOA 3ISHA 4U8NA 1H86A 2JB1A 1CJ2A 1H6VA 1C25A 2GF3A 2ORAA 3GD4A 4ZCDA 3AE8A 5KWFA 2B9YA 2HHGA 2EQ8A 4AP1A 3GDPA 4YKFA 3UTFA 4E0VA 3NIXA 1DNCA 1GRTA 1GREA 3NYFA 1DJQA 4OPCA 1L9DA 3IC9A 1CWTA 3L1RA 2KL3A 3GYIA 2WU5A 2A8XA 2Q7VA 1FEBA 2YVFA 4H4ZA 4U8KA 4Z44A 3KLJA 2E4GA 3P1WA 4Y4NA 1UKVG 2YR6A 3DH9A 3KU9A 2BXSA 3AE3A 1DOBA 1BKWA 3T2YA 2R4EA 1Y56B 3QJ4A 3DA1A 1JOAA 1VQWA 3COXA 4OPIA 4A79A 3OP3A 3H8LA 4HA6A 2V60A 4J34A 2AAQA 2R0PA 3K9RA 2C67A 2WLXA 2VVLG 3C4NA 3GDNA 5EB4A 3VR8A 1SEZA 1KSUA 4ADWA 3RHAA 3PO7A 2FJDA 4H2QA 4NTDA 3ICTA 5KVIA 3K7TA 5KXJA 1B37A 1QXNA 3IPPA 2EQ9A 5FS7A 2XFOA 4LA1A 5U25A 2BRYA 4CBQA 1NHPA 3NYCA 1CC4A 1GRFA 1E1KA 3HYWA 1L9EA 2C7GA 5KMRA 3GK5A 2GVCA 1E1NA 1Q1WA 2XFUA 2E1MA 1GETA 2VZ2A 2YLRA 3ITJA 4XWRA 2IIDA 1QLBA 2QA2A 4UP3A 3AEFA 2XVJA 3CNSA 4IA5A 4DNAA 2GWFA 3URHA 2JTSA 2Q0LA 3AE5A 4YSHA 3O3WA 1ZDLA 3I2VA 2V3AA 2IFDA 1S3BA 3NG7X 1IUSA 1CC2A 1FL2A 1JEHA 1K0LA 2J3NA 4UDQA 3CPJG 3BNMA 4KX6A 1ELIA 1DXLA 3G5JA 3CNTA 2WP6A 2VRLA 2CFYA 2WDQA 4H4UA 4OVIA 4Y4MA 1ZKQA 2YG6A 3AAXA 1DJNA 1JRZA 1KNPA 3NNEA 2Q6UA 2YM2A 3AEGA 2JB3A 3F8DA 5HBOA 4GAPA 2APGA 1Z6LA 2C75A 1YMDA 3RNMA 4OCGA 2C66A 2TMDA 4BV6A 4J56A 1WV9A 2CVJA 2GMJA 3REDA 5EBKA 4USRA 5M10A 4PAAA 2WDVA 2XVEA 3PVCA 1IJHA 2JKCA 2XVIA 2EG3A 3FG2P 1BOHA 2FBWA 1BGNA 3UCLA 1BGJA 3CIRA 1COYA 4II2A 4TM0A 1YMKA 2FJAA 4UDRA 1FEAA 1YQ3A 2RGOA 2C64A 5EB5A 1VEEA 2JTRA 1TYPA 3AEBA 3T37A 3FMWA 1YQZA 4YXDA 3LZXA 2VVLA 1BF3A 1Q9IA 3DGZA 1O5WA 1NDAA 3L8KA 2PHHA 3SZ0A 3BI4A 3P4SA 5HXIA 3GWDA 3D1PA 3SX6A 5KMPA 1CJ3A 1H7XA 1K4QA 5KMQA 2NPXA 3SY4A 1MOKA 3AE4A 4A5LA 5KNLA 1PN0A 1E39A 4B64A 3AECA 1BOIA 1H83A 1N4UA 5EOWA 4EQSA 4APNA 1FCDA 2MOIA 2AR8A 3D1CA 1D4DA 1T3KA 1PBDA 1Y56A 2YM1A 3GWFA 4NWZA 3UTNX 2UZQA 1E7PA 1K0JA 1XDIA 4JN9A 1ZMCA 2C70A 1RYIA 4NEWA 4YTMA 3T0KA 2YLXA 2X99A 4GAVA 1IUTA 1HZMA 1CF3A 2WPCA 2YR5A 4GCMA 4GRTA 4BJYA 1YM9A 3ATRA 3HWIA 1TRBA 3VQRA 4B68A 2GR2A 4J33A 2B9WA 3QSMA 4J31A 3FLHA 2R4JA 4CRTA 1EL8A 1KSSA 2XYOA 5BVAA 1RHSA 3AEEA 2YG5A 1EL5A 4BURA 3KVEA 3GD3A 1NENA 1JRXA 2AQJA 1YY5A 2DKIA 2YR4A 1QJDA 3CNJA 5HBLA 3AEDA 4J57A 4ZCCA 3UOVA 4BK2A 2I0ZA 2WU2A 1PBCA 3SFEA 1ZY8A 3UTHA 3NT6A 2F5ZA 2VSWA 3P4QA 4JGTA 4I59A 1PJ7A 4AOSA 4BK1A 1KNRA 2WP9A 2ZZ0A 3AE9A 4FX9A 4U2SA 4UDPA 5HY5A 4C3YA 2BCPA 2IFVA 2VQBA 3SZWA 1CC6A 3UKAA 1PJ6A 2Z5XA 2ACZA 5KOWA 4JY3A 4CY6A 2A2KA 2RGHA 4U8OA 1NHSA 2WOIA 1YMLA 1HYUA 3DK9A 4TLZA 4C74A 1ZK7A 4G6GA 5HBQA 1RSGA 2OALA 2BABA 1TDNA 4GUVA 5LAOA 4NNJA 4C77A 2GR1A 2C73A 2EG4A 3EF6A 3FOJA 4JDRA 4J2WA 4J36A 3VRBA 4G74A 4TM3A 2WQYA 3TG3A 2EG4B 3AD9B 1B4VA 3RP6A 3ICRA 3DJEA 4EQXA 3GMCA 1TDFA 4B67A 1DOCA 3IWHA 1LPFA 1PHHA 2R9ZA 4NEVA 2B9XA 4NTCA 3NK1X 2Y6RA 4Z26A 3UP4A 5IQ1A 1GALA 3KA7A 4GDEA 3AXBA 3NRNA 3QSEA 2JAEA 2IVDA 5KRQA 3VRAA 2VVMA 4ECHA 2OUCA 2XVFA 3I3UA 1YS0A 3FS5A 1CL0A 2C72A 3NGCX 3R9UA 3VRDB 4IVMB 4EIPA 4XXGA 4G6HA 3P4RA 2C76A 4DSGA 1IUVA 3IWAA 4EMJA 3LXDA 1MO9A 4U8LA 5M0ZA 2WESA 5HHFA 5BRTA 3M13A 5FS8A 1GRBA 1N4VA 1B8SA 3AE1A 4OPDA 1XPQA 3GMBA 2WOVA 4B63A 2VQ7A 5KOXA 1KDGA 4C3XA 2XLRA 2XLTA 4A65A 3EANA 3M0OA 2J6PA 1PXBA 4RSLA 2MRMA 2Y6QA 4WCTA 3E1TA 3GRTA 3NN6X 3M12A 2E5VA 3CPHG 4H4VA 3OLHA 3V76A 5HBPA 1FOHA 3CGDA 4EM3A 3O0HA 4O5QA 1E6EA 5HYMA 5KVHA 1H82A 2EQ6A 4H4QA 5FS9A 1GTHA 2RGJA 4OPLA 2VOUA 4JNQA 3AYLA 4U2LA 4X4JA 3ATQA 4X9NA 4FK1A 1UARA 5ER0A 1N4WA 4C5OA 1JRYA 4Z2UA 4AT0A 3K30A 2BK4A 4ICYA 3AE2A 1GESA 4U8IA 3UP5A 1OJAA 2WEUA 4GF7A 5JCLA 1K0IA 3T14A 2WHDA 4CNKA 2YG4A 2ARDA 3C4AA 2V5ZA 1D5TA 1OJDA 1PXAA 3G5QA 2FJBA 3CGCA 4YSYA 3SFDA 3DJJA 1IUUA 1GN0A 2WETA 2BA9A 4H4YA 3HYXA 4YTPA 2X8CA 3ADAB 3K7QX 1BWCA 3HYVA 3NYEA 3KPFA 1XHCA 3NTDA 1ORBA 1NAAA 3Q9TA 3OC4A 2BC0A 2XLSA 3SXIA 1F8WA 3ALLA 5JCMA 3UKPA 2MOLA 1KF6A 2RABA 5CQFA 1NPXA 2GAGB 2WP5A 1CWRA 1GT8A 4EQRA 3AWIA 2TPRA 3NN0X 1S3EA 4LIIA 3UTEA 3GYXA 3UKQA 1NG4A 2OA1A 2V61A 1V59A 2X8HA 3CPIG 1OKGA 2OAMA 2FSXA 3IHMA 4K2XA 4K8DA 2XCGA 4TM1A 3BHKA 5FMHA 4WH7A 1WHBA 2GB0A 1L0VA 2WDRA 5C3JA 1PBFA 1PS9A 1GSNA 2V3BA 2C65A 1QO8A 3ZYXA 2NVKX 1KFYA 4B1BA 4Z2RA 4H4XA 1PJ5A 1Q1RA 3BNUA 3G5SA 2C4CA 3UKHA 3F4AA 3AAYA 3BHFA 1O95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HZL A;  1GOS A;  1E1M A;  4WH9 A;  5JCI A;  2B7S A;  1LVL A;  3CTY A;  3AD8 B;  4Y4L A;  3UKF A;  3ILM A;  2GQF A;  1JNZ A;  3IHG A;  4Z25 A;  1MXT A;  1H84 A;  1RP0 A;  2XVH A;  2QCU A;  4H4W A;  1GRA A;  2YVJ A;  4M52 A;  3CGB A;  1URH A;  3DJG X;  3FIM B;  1W4X A;  3GRS A;  1M6I A;  1ZOY A;  3QVP A;  5BUL A;  1GV4 A;  4BJZ A;  2YLT A;  4H4R A;  4TM4 A;  3UKL A;  3II4 A;  3MZZ A;  4A6N A;  1QB0 A;  3DGH A;  2ZBW A;  4REK A;  1RHD A;  3QSS A;  5DBJ A;  2R0G A;  4N9X A;  5BUK A;  5JCN A;  4YT0 A;  1E0C A;  2R46 A;  3LZW A;  3SGL A;  1B5Q A;  3AB1 A;  5J7X A;  3VR9 A;  4YSZ A;  4H4S A;  4ZN0 A;  1NEK A;  1ONF A;  4A9W A;  1D7L A;  1NHR A;  3H8I A;  4Z24 A;  2JB2 A;  2WPF A;  1S2Q A;  1YQ4 A;  2CDU A;  1BZL A;  4CCR A;  3AE7 A;  5LV9 A;  5JCK A;  3ABV A;  3NLC A;  2VRM A;  2K0Z A;  2JBV A;  3ALM A;  4EM4 A;  4K22 A;  4B65 A;  3TP9 A;  4GDP A;  3G5R A;  4U8P A;  4IVO B;  3EPT A;  3HZU A;  2DCQ A;  3GSI A;  1H81 A;  2BAC A;  2BS4 A;  1ZOV A;  3R2U A;  2YAU A;  1LQU A;  4TLX A;  3FNJ A;  2IVE A;  2WBA A;  3F8P A;  1M64 A;  3LOV A;  4MJW A;  4EMI A;  2W0H A;  4H4P A;  4YKG A;  3CNP A;  5LAM A;  3S61 A;  5U1O A;  2V6O A;  1EL9 A;  2GR3 A;  2A89 A;  5J60 A;  4I58 A;  4JQ9 A;  4DSH A;  3QFA A;  5TR3 A;  1GRH A;  3DK8 A;  4B66 A;  1PBE A;  1OJC A;  3QFB A;  2BS2 A;  1GPE A;  2WOW A;  3B3R A;  2Z5Y A;  1H4K X;  2B76 A;  1D4C A;  4A99 A;  2H89 A;  2XDO A;  2JK6 A;  1ZP0 A;  1P2H A;  2BK5 A;  4U2T A;  4WX1 A;  3SM8 A;  1F8S A;  4D04 A;  2YVG A;  3LAD A;  1CJC A;  1VDC A;  2GRT A;  2X50 A;  2GMH A;  2GR0 A;  3D8X A;  3AD7 B;  5L46 A;  2O9Z A;  3K7M X;  4K5S A;  4YSX A;  2HQM A;  2OLO A;  3CND A;  3TG1 B;  3NK0 X;  5GSN A;  4H4T A;  3B6D A;  4D03 A;  2XFN A;  4USQ A;  4A6N B;  4H7U A;  3C96 A;  4EQW A;  4JY2 A;  3FPZ A;  1OJ9 A;  3P4P A;  4O5U A;  4GR1 A;  4AT2 A;  2A87 A;  1CBO A;  1VG9 A;  3NK2 X;  1GXF A;  1P2E A;  1YKJ A;  2YLS A;  4CCQ A;  4IA6 A;  4K5R A;  3NHV A;  1REO A;  2X3N A;  1JNR A;  1GTE A;  5U63 A;  3GYJ A;  3V3O A;  2X8G A;  1IUW A;  3DJD A;  2BXR A;  2WS3 A;  3DME A;  4FK1 C;  4DGK A;  3DK4 A;  4LU6 A;  3S5W A;  3ZDN A;  1DOD A;  4X9M A;  1E1L A;  1XAN A;  3UOZ A;  2C3D A;  3UOX A;  4HB9 A;  3NKS A;  4JNA A;  2DKH A;  3CGE A;  5GRT A;  2FJE A;  4EIQ A;  3NHO X;  4H2N A;  1D4E A;  2YG7 A;  1F6M A;  2BC1 A;  2BCG G;  2WLR A;  3KD9 A;  3OZ2 A;  4OPG A;  1AOG A;  4F67 A;  2QAE A;  1EL7 A;  2GEW A;  1F8R A;  4PAB A;  2YLZ A;  4RG3 A;  2ZZC A;  2QA1 A;  3ALJ A;  4NZH A;  3ICS A;  1F3P A;  2YG3 A;  3V3N A;  2CUL A;  3JSK A;  4A7A A;  4Z2T A;  4OPU A;  4AP3 A;  1TDE A;  1CWS A;  1DP2 A;  3UOY A;  2EQ7 A;  3P3A A;  2BS3 A;  4EMW A;  2JTQ A;  1N1P A;  1PDH A;  4B69 A;  5C2T A;  1PBB A;  2GAH B;  1ZMD A;  2PYX A;  1ZX9 A;  3Q6J A;  1IUX A;  4IV9 A;  2B7R A;  2GQW A;  1LQT A;  2UZZ A;  4K7Z A;  4CY8 A;  2XLP A;  3PS9 A;  5HPA A;  1PXC A;  1VRQ B;  3IF9 A;  3CN8 A;  3HIX A;  1O94 A;  1TDO A;  1DOE A;  1YT8 A;  1H7W A;  1X31 B;  2YWL A;  1TDK A;  1VG0 A;  2BYB A;  3BI2 A;  3H4K A;  4H50 A;  2GV8 A;  3QVR A;  2GH5 A;  1Y0P A;  1GND A;  3KKJ A;  4U8M A;  5CKU A;  5IPY A;  2XFP A;  4OPT A;  4RG4 A;  1NHQ A;  1S2Y A;  2R0C A;  3SQP A;  1OJT A;  1CJ4 A;  3FBS A;  4CNJ A;  2YLW A;  2BK3 A;  4Z43 A;  3EAO A;  3AEA A;  2YQU A;  1TYT A;  3NH3 X;  3AYJ A;  2H88 A;  2ZZB A;  5IQ4 A;  4YWO A;  3UTG A;  1CHU A;  5FS6 A;  4U8J A;  3BI5 A;  4BK3 A;  4H2R A;  1EBD A;  1LV0 A;  3P9U A;  4FDC B;  3WE0 A;  3F8R A;  3I3L A;  3UKK A;  1D7Y A;  3AYI A;  1GER A;  1L9C A;  1TQ1 A;  1LJ1 A;  2XFQ A;  4H2P A;  4KPR A;  3RP7 A;  4AOX A;  4YTP A;  1H4M X;  2C3C A;  1GEU A;  3AE6 A;  3I6D A;  1LTX R;  3LB8 A;  4NTE A;  4XWZ A;  1GMX A;  1NG3 A;  2R45 A;  2Q0K A;  1GRG A;  2XLU A;  2WPE A;  4P9S A;  1FEC A;  3LJP A;  1JU2 A;  3RP8 A;  3NTA A;  2OLN A;  3IPO A;  3ISH A;  4U8N A;  1H86 A;  2JB1 A;  1CJ2 A;  1H6V A;  1C25 A;  2GF3 A;  2ORA A;  3GD4 A;  4ZCD A;  3AE8 A;  5KWF A;  2B9Y A;  2HHG A;  2EQ8 A;  4AP1 A;  3GDP A;  4YKF A;  3UTF A;  4E0V A;  3NIX A;  1DNC A;  1GRT A;  1GRE A;  3NYF A;  1DJQ A;  4OPC A;  1L9D A;  3IC9 A;  1CWT A;  3L1R A;  2KL3 A;  3GYI A;  2WU5 A;  2A8X A;  2Q7V A;  1FEB A;  2YVF A;  4H4Z A;  4U8K A;  4Z44 A;  3KLJ A;  2E4G A;  3P1W A;  4Y4N A;  1UKV G;  2YR6 A;  3DH9 A;  3KU9 A;  2BXS A;  3AE3 A;  1DOB A;  1BKW A;  2R4E A;  1Y56 B;  3QJ4 A;  3DA1 A;  1JOA A;  1VQW A;  3COX A;  4OPI A;  4A79 A;  3OP3 A;  3H8L A;  4HA6 A;  2V60 A;  4J34 A;  2AAQ A;  2R0P A;  3K9R A;  2C67 A;  2WLX A;  2VVL G;  3C4N A;  3GDN A;  5EB4 A;  3VR8 A;  1SEZ A;  1KSU A;  4ADW A;  3RHA A;  3PO7 A;  2FJD A;  4H2Q A;  4NTD A;  3ICT A;  5KVI A;  3K7T A;  5KXJ A;  1B37 A;  1QXN A;  3IPP A;  2EQ9 A;  5FS7 A;  2XFO A;  4LA1 A;  5U25 A;  4CBQ A;  1NHP A;  3NYC A;  1CC4 A;  1GRF A;  1E1K A;  1L9E A;  2C7G A;  3GK5 A;  2GVC A;  1E1N A;  1Q1W A;  2XFU A;  2E1M A;  1GET A;  2VZ2 A;  2YLR A;  3ITJ A;  4XWR A;  2IID A;  1QLB A;  2QA2 A;  4UP3 A;  3AEF A;  2XVJ A;  3CNS A;  4IA5 A;  4DNA A;  2GWF A;  3URH A;  2JTS A;  2Q0L A;  3AE5 A;  4YSH A;  3O3W A;  1ZDL A;  3I2V A;  2V3A A;  2IFD A;  1S3B A;  3NG7 X;  1IUS A;  1CC2 A;  1FL2 A;  1JEH A;  1K0L A;  2J3N A;  4UDQ A;  3CPJ G;  3BNM A;  4KX6 A;  1ELI A;  1DXL A;  3G5J A;  3CNT A;  2WP6 A;  2VRL A;  2CFY A;  2WDQ A;  4H4U A;  4OVI A;  4Y4M A;  1ZKQ A;  2YG6 A;  3AAX A;  1DJN A;  1JRZ A;  1KNP A;  3NNE A;  2Q6U A;  2YM2 A;  3AEG A;  2JB3 A;  3F8D A;  5HBO A;  3RNM A;  2APG A;  1Z6L A;  2C75 A;  1YMD A;  4BV6 A;  4OCG A;  2C66 A;  2TMD A;  4J56 A;  1WV9 A;  2CVJ A;  2GMJ A;  3RED A;  5EBK A;  4USR A;  5M10 A;  4PAA A;  2WDV A;  2XVE A;  3PVC A;  1IJH A;  2JKC A;  2XVI A;  2EG3 A;  3FG2 P;  1BOH A;  2FBW A;  1BGN A;  3UCL A;  1BGJ A;  3CIR A;  1COY A;  4TM0 A;  1YMK A;  2FJA A;  4UDR A;  1FEA A;  1YQ3 A;  2RGO A;  2C64 A;  5EB5 A;  1VEE A;  2JTR A;  1TYP A;  3AEB A;  3T37 A;  3FMW A;  1YQZ A;  4YXD A;  3LZX A;  2VVL A;  1BF3 A;  1Q9I A;  3DGZ A;  1O5W A;  1NDA A;  3L8K A;  2PHH A;  3BI4 A;  3P4S A;  5HXI A;  3GWD A;  3D1P A;  1CJ3 A;  1H7X A;  1K4Q A;  2NPX A;  4A5L A;  1MOK A;  3AE4 A;  1PN0 A;  1E39 A;  4B64 A;  3AEC A;  1BOI A;  1H83 A;  1N4U A;  5EOW A;  4EQS A;  4APN A;  1FCD A;  2MOI A;  2AR8 A;  3D1C A;  1D4D A;  1T3K A;  1PBD A;  1Y56 A;  2YM1 A;  3GWF A;  4YTN A;  3UTN X;  2UZQ A;  1E7P A;  1K0J A;  1XDI A;  4JN9 A;  1ZMC A;  2C70 A;  1RYI A;  4NEW A;  4YTM A;  2YLX A;  2X99 A;  1IUT A;  1HZM A;  1CF3 A;  2WPC A;  2YR5 A;  4GCM A;  4GRT A;  4BJY A;  1YM9 A;  3ATR A;  3HWI A;  1TRB A;  3VQR A;  4B68 A;  2GR2 A;  4J33 A;  2B9W A;  3QSM A;  4J31 A;  3FLH A;  2R4J A;  4CRT A;  1EL8 A;  1KSS A;  2XYO A;  5BVA A;  1RHS A;  3AEE A;  2YG5 A;  1EL5 A;  4BUR A;  3KVE A;  3GD3 A;  1NEN A;  1JRX A;  2AQJ A;  1YY5 A;  2DKI A;  2YR4 A;  1QJD A;  3CNJ A;  5HBL A;  3AED A;  4J57 A;  4ZCC A;  3UOV A;  4BK2 A;  2I0Z A;  2WU2 A;  1PBC A;  3SFE A;  1ZY8 A;  3UTH A;  3NT6 A;  2F5Z A;  2VSW A;  3P4Q A;  4JGT A;  4I59 A;  1PJ7 A;  4AOS A;  4BK1 A;  1KNR A;  2WP9 A;  2ZZ0 A;  3AE9 A;  4FX9 A;  4U2S A;  4UDP A;  5HY5 A;  4C3Y A;  2BCP A;  2IFV A;  2VQB A;  1CC6 A;  3UKA A;  1PJ6 A;  2Z5X A;  2ACZ A;  5KOW A;  4JY3 A;  4CY6 A;  2A2K A;  2RGH A;  4U8O A;  1NHS A;  2WOI A;  1YML A;  1HYU A;  3DK9 A;  4TLZ A;  4C74 A;  1ZK7 A;  5HBQ A;  1RSG A;  2OAL A;  2BAB A;  1TDN A;  4GUV A;  5LAO A;  4C77 A;  2GR1 A;  2C73 A;  2EG4 A;  3EF6 A;  3FOJ A;  4JDR A;  4J2W A;  4J36 A;  3VRB A;  4TM3 A;  2WQY A;  3TG3 A;  2EG4 B;  3AD9 B;  1B4V A;  3RP6 A;  3ICR A;  3DJE A;  4EQX A;  3GMC A;  1TDF A;  4B67 A;  1DOC A;  3IWH A;  1LPF A;  1PHH A;  2R9Z A;  4NEV A;  2B9X A;  4NTC A;  3NK1 X;  2Y6R A;  4Z26 A;  3UP4 A;  5IQ1 A;  1GAL A;  3KA7 A;  4GDE A;  3AXB A;  3NRN A;  3QSE A;  2JAE A;  2IVD A;  5KRQ A;  3VRA A;  2VVM A;  4ECH A;  2OUC A;  2XVF A;  3I3U A;  1YS0 A;  3FS5 A;  1CL0 A;  2C72 A;  3NGC X;  3R9U A;  3VRD B;  4IVM B;  4EIP A;  4XXG A;  3P4R A;  2C76 A;  4DSG A;  1IUV A;  3IWA A;  4EMJ A;  3LXD A;  1MO9 A;  4U8L A;  5M0Z A;  2WES A;  5HHF A;  5BRT A;  3M13 A;  5FS8 A;  1GRB A;  1N4V A;  1B8S A;  3AE1 A;  4OPD A;  1XPQ A;  3GMB A;  2WOV A;  4B63 A;  2VQ7 A;  5KOX A;  1KDG A;  4C3X A;  2XLR A;  2XLT A;  4A65 A;  3EAN A;  3M0O A;  2J6P A;  1PXB A;  4RSL A;  2MRM A;  2Y6Q A;  4WCT A;  3E1T A;  3GRT A;  3NN6 X;  3M12 A;  2E5V A;  3CPH G;  4H4V A;  3OLH A;  3V76 A;  5HBP A;  1FOH A;  3CGD A;  4EM3 A;  3O0H A;  4O5Q A;  1E6E A;  5HYM A;  5KVH A;  1H82 A;  2EQ6 A;  4H4Q A;  5FS9 A;  1GTH A;  2RGJ A;  4OPL A;  2VOU A;  4JNQ A;  3AYL A;  4U2L A;  4X4J A;  3ATQ A;  4X9N A;  4FK1 A;  1UAR A;  5ER0 A;  1N4W A;  4C5O A;  1JRY A;  4Z2U A;  4AT0 A;  3K30 A;  2BK4 A;  4ICY A;  3AE2 A;  1GES A;  4U8I A;  3UP5 A;  1OJA A;  2WEU A;  4GF7 A;  5JCL A;  1K0I A;  2WHD A;  4CNK A;  2YG4 A;  2ARD A;  3C4A A;  2V5Z A;  1D5T A;  1OJD A;  1PXA A;  3G5Q A;  2FJB A;  3CGC A;  4YSY A;  3SFD A;  3DJJ A;  1IUU A;  1GN0 A;  2WET A;  2BA9 A;  4H4Y A;  2X8C A;  3ADA B;  3K7Q X;  1BWC A;  3NYE A;  3KPF A;  1XHC A;  3NTD A;  1ORB A;  1NAA A;  3Q9T A;  3OC4 A;  2BC0 A;  2XLS A;  1F8W A;  3ALL A;  5JCM A;  3UKP A;  2MOL A;  1KF6 A;  2RAB A;  5CQF A;  1NPX A;  2GAG B;  2WP5 A;  1CWR A;  1GT8 A;  4EQR A;  3AWI A;  2TPR A;  3NN0 X;  1S3E A;  4LII A;  3UTE A;  3UKQ A;  1NG4 A;  2OA1 A;  2V61 A;  1V59 A;  2X8H A;  3CPI G;  1OKG A;  2OAM A;  2FSX A;  3IHM A;  4K2X A;  4K8D A;  2XCG A;  4TM1 A;  3BHK A;  5FMH A;  4WH7 A;  1WHB A;  2GB0 A;  1L0V A;  2WDR A;  5C3J A;  1PBF A;  1PS9 A;  1GSN A;  2V3B A;  2C65 A;  1QO8 A;  3ZYX A;  2NVK X;  1KFY A;  4B1B A;  4Z2R A;  4H4X A;  1PJ5 A;  1Q1R A;  3BNU A;  3G5S A;  3UKH A;  3F4A A;  3AAY A;  3BHF A;  1O95 A; 
#chains in the Genus database with same CATH topology
 3HZL A;  2BRA A;  1GOS A;  1E1M A;  4WH9 A;  5JCI A;  2B7S A;  1LVL A;  3CTY A;  3AD8 B;  4Y4L A;  3UKF A;  3ILM A;  2GQF A;  1JNZ A;  3IHG A;  4Z25 A;  1MXT A;  1H84 A;  1RP0 A;  2XVH A;  2QCU A;  4H4W A;  1GRA A;  2YVJ A;  4M52 A;  3CGB A;  4II3 A;  1URH A;  3DJG X;  3FIM B;  1W4X A;  3GRS A;  1M6I A;  1ZOY A;  3QVP A;  5BUL A;  1GV4 A;  4BJZ A;  2YLT A;  4YTN A;  4H4R A;  4TM4 A;  3UKL A;  3II4 A;  3MZZ A;  4A6N A;  1QB0 A;  3DGH A;  2ZBW A;  4REK A;  1RHD A;  3QSS A;  5DBJ A;  2R0G A;  4N9X A;  5BUK A;  5JCN A;  4YT0 A;  1E0C A;  2R46 A;  3LZW A;  3SGL A;  1B5Q A;  3AB1 A;  3T2Z A;  5J7X A;  3VR9 A;  4YSZ A;  4H4S A;  4ZN0 A;  1NEK A;  1ONF A;  4A9W A;  1D7L A;  1NHR A;  3H8I A;  4Z24 A;  2JB2 A;  2WPF A;  1S2Q A;  1YQ4 A;  2CDU A;  1BZL A;  4CCR A;  3AE7 A;  5LV9 A;  5JCK A;  3ABV A;  3NLC A;  2VRM A;  2K0Z A;  2JBV A;  4G9K A;  3ALM A;  4EM4 A;  4K22 A;  4B65 A;  3TP9 A;  4GDP A;  3G5R A;  4U8P A;  4IVO B;  3EPT A;  3HZU A;  2DCQ A;  3GSI A;  1H81 A;  2BAC A;  2BS4 A;  1ZOV A;  3R2U A;  2YAU A;  1LQU A;  4TLX A;  3FNJ A;  2IVE A;  2WBA A;  3F8P A;  1M64 A;  3LOV A;  4MJW A;  4EMI A;  2W0H A;  4H4P A;  4YKG A;  3CNP A;  5LAM A;  3S61 A;  5U1O A;  2V6O A;  1EL9 A;  2GR3 A;  2A89 A;  5J60 A;  4I58 A;  4JQ9 A;  4DSH A;  3QFA A;  5TR3 A;  1GRH A;  3DK8 A;  3CMM A;  1PBE A;  4B66 A;  1OJC A;  3QFB A;  2BS2 A;  1GPE A;  2WOW A;  3B3R A;  2Z5Y A;  1H4K X;  2B76 A;  1D4C A;  4A99 A;  2H89 A;  2XDO A;  2JK6 A;  1ZP0 A;  1P2H A;  2BK5 A;  4U2T A;  4WX1 A;  3SM8 A;  1F8S A;  4D04 A;  2YVG A;  3LAD A;  1CJC A;  1VDC A;  2GRT A;  2X50 A;  2GMH A;  2GR0 A;  3D8X A;  3AD7 B;  5L46 A;  2O9Z A;  3K7M X;  4K5S A;  4YSX A;  2HQM A;  2OLO A;  3CND A;  3TG1 B;  3NK0 X;  5GSN A;  4H4T A;  3B6D A;  4D03 A;  2XFN A;  4USQ A;  4A6N B;  4H7U A;  3C96 A;  4EQW A;  4JY2 A;  3FPZ A;  1OJ9 A;  3P4P A;  4O5U A;  4GR1 A;  4AT2 A;  2A87 A;  1CBO A;  1VG9 A;  3NK2 X;  1GXF A;  1P2E A;  1YKJ A;  2YLS A;  4CCQ A;  4IA6 A;  4K5R A;  3NHV A;  1REO A;  2X3N A;  1JNR A;  1GTE A;  5U63 A;  3GYJ A;  3V3O A;  3T2K A;  2X8G A;  1IUW A;  3DJD A;  2BXR A;  2WS3 A;  3DME A;  4FK1 C;  4DGK A;  3DK4 A;  4LU6 A;  3S5W A;  3ZDN A;  1DOD A;  4X9M A;  1E1L A;  1XAN A;  3UOZ A;  2C3D A;  3UOX A;  4HB9 A;  3NKS A;  4JNA A;  2DKH A;  3CGE A;  5GRT A;  2FJE A;  3SZC A;  4EIQ A;  3NHO X;  4H2N A;  1D4E A;  2YG7 A;  1F6M A;  2BC1 A;  2BCG G;  2WLR A;  3KD9 A;  3OZ2 A;  4OPG A;  1AOG A;  4F67 A;  3SYI A;  2QAE A;  1EL7 A;  2GEW A;  1F8R A;  4PAB A;  2YLZ A;  4RG3 A;  2ZZC A;  2QA1 A;  3ALJ A;  4NZH A;  3ICS A;  1F3P A;  2YG3 A;  3V3N A;  2CUL A;  3JSK A;  4A7A A;  4Z2T A;  4OPU A;  4AP3 A;  1TDE A;  1CWS A;  1DP2 A;  3SZF A;  2EQ7 A;  3UOY A;  3P3A A;  2BS3 A;  4EMW A;  2JTQ A;  1N1P A;  1PDH A;  4B69 A;  5C2T A;  1PBB A;  2GAH B;  1ZMD A;  2PYX A;  1ZX9 A;  3Q6J A;  3KPK A;  1IUX A;  4IV9 A;  2B7R A;  2GQW A;  1LQT A;  2UZZ A;  4K7Z A;  4CY8 A;  2XLP A;  3PS9 A;  5HPA A;  1PXC A;  1VRQ B;  3IF9 A;  3CN8 A;  3HIX A;  1O94 A;  1TDO A;  1DOE A;  1YT8 A;  1H7W A;  1X31 B;  2YWL A;  1TDK A;  1VG0 A;  2BYB A;  3BI2 A;  3H4K A;  4H50 A;  2GV8 A;  3QVR A;  2GH5 A;  1Y0P A;  1GND A;  3KKJ A;  4U8M A;  5CKU A;  5IPY A;  2XFP A;  4OPT A;  4RG4 A;  1NHQ A;  1S2Y A;  2R0C A;  3SQP A;  1OJT A;  1CJ4 A;  3FBS A;  4CNJ A;  2YLW A;  3T31 A;  2BK3 A;  4Z43 A;  3EAO A;  3AEA A;  2YQU A;  1TYT A;  3NH3 X;  3AYJ A;  2H88 A;  2ZZB A;  5IQ4 A;  5KMS A;  4YWO A;  3UTG A;  1CHU A;  5FS6 A;  4U8J A;  3BI5 A;  4BK3 A;  4H2R A;  1EBD A;  1LV0 A;  3P9U A;  4FDC B;  3WE0 A;  3F8R A;  3I3L A;  3UKK A;  1D7Y A;  3AYI A;  1GER A;  1L9C A;  1TQ1 A;  1LJ1 A;  2XFQ A;  4G73 A;  4H2P A;  4KPR A;  3RP7 A;  4AOX A;  1H4M X;  2C3C A;  1GEU A;  3AE6 A;  3I6D A;  1LTX R;  3LB8 A;  4NTE A;  4XWZ A;  1GMX A;  1NG3 A;  2R45 A;  2Q0K A;  1GRG A;  2XLU A;  2WPE A;  4P9S A;  1FEC A;  3LJP A;  1JU2 A;  3RP8 A;  3NTA A;  2OLN A;  3IPO A;  3ISH A;  4U8N A;  1H86 A;  2JB1 A;  1CJ2 A;  1H6V A;  1C25 A;  2GF3 A;  2ORA A;  3GD4 A;  4ZCD A;  3AE8 A;  5KWF A;  2B9Y A;  2HHG A;  2EQ8 A;  4AP1 A;  3GDP A;  4YKF A;  3UTF A;  4E0V A;  3NIX A;  1DNC A;  1GRT A;  1GRE A;  3NYF A;  1DJQ A;  4OPC A;  1L9D A;  3IC9 A;  1CWT A;  3L1R A;  2KL3 A;  3GYI A;  2WU5 A;  2A8X A;  2Q7V A;  1FEB A;  2YVF A;  4H4Z A;  4U8K A;  4Z44 A;  3KLJ A;  2E4G A;  3P1W A;  4Y4N A;  1UKV G;  2YR6 A;  3DH9 A;  3KU9 A;  2BXS A;  3AE3 A;  1DOB A;  1BKW A;  3T2Y A;  2R4E A;  1Y56 B;  3QJ4 A;  3DA1 A;  1JOA A;  1VQW A;  3COX A;  4OPI A;  4A79 A;  3OP3 A;  3H8L A;  4HA6 A;  2V60 A;  4J34 A;  2AAQ A;  2R0P A;  3K9R A;  2C67 A;  2WLX A;  2VVL G;  3C4N A;  3GDN A;  5EB4 A;  3VR8 A;  1SEZ A;  1KSU A;  4ADW A;  3RHA A;  3PO7 A;  2FJD A;  4H2Q A;  4NTD A;  3ICT A;  5KVI A;  3K7T A;  5KXJ A;  1B37 A;  1QXN A;  3IPP A;  2EQ9 A;  5FS7 A;  2XFO A;  4LA1 A;  5U25 A;  2BRY A;  4CBQ A;  1NHP A;  3NYC A;  1CC4 A;  1GRF A;  1E1K A;  3HYW A;  1L9E A;  2C7G A;  5KMR A;  3GK5 A;  2GVC A;  1E1N A;  1Q1W A;  2XFU A;  2E1M A;  1GET A;  2VZ2 A;  2YLR A;  3ITJ A;  4XWR A;  2IID A;  1QLB A;  2QA2 A;  4UP3 A;  3AEF A;  2XVJ A;  3CNS A;  4IA5 A;  4DNA A;  2GWF A;  3URH A;  2JTS A;  2Q0L A;  3AE5 A;  4YSH A;  3O3W A;  1ZDL A;  3I2V A;  2V3A A;  2IFD A;  1S3B A;  3NG7 X;  1IUS A;  1CC2 A;  1FL2 A;  1JEH A;  1K0L A;  2J3N A;  4UDQ A;  3CPJ G;  3BNM A;  4KX6 A;  1ELI A;  1DXL A;  3G5J A;  3CNT A;  2WP6 A;  2VRL A;  2CFY A;  2WDQ A;  4H4U A;  4OVI A;  4Y4M A;  1ZKQ A;  2YG6 A;  3AAX A;  1DJN A;  1JRZ A;  1KNP A;  3NNE A;  2Q6U A;  2YM2 A;  3AEG A;  2JB3 A;  3F8D A;  5HBO A;  4GAP A;  2APG A;  1Z6L A;  2C75 A;  1YMD A;  3RNM A;  4OCG A;  2C66 A;  2TMD A;  4BV6 A;  4J56 A;  1WV9 A;  2CVJ A;  2GMJ A;  3RED A;  5EBK A;  4USR A;  5M10 A;  4PAA A;  2WDV A;  2XVE A;  3PVC A;  1IJH A;  2JKC A;  2XVI A;  2EG3 A;  3FG2 P;  1BOH A;  2FBW A;  1BGN A;  3UCL A;  1BGJ A;  3CIR A;  1COY A;  4II2 A;  4TM0 A;  1YMK A;  2FJA A;  4UDR A;  1FEA A;  1YQ3 A;  2RGO A;  2C64 A;  5EB5 A;  1VEE A;  2JTR A;  1TYP A;  3AEB A;  3T37 A;  3FMW A;  1YQZ A;  4YXD A;  3LZX A;  2VVL A;  1BF3 A;  1Q9I A;  3DGZ A;  1O5W A;  1NDA A;  3L8K A;  2PHH A;  3SZ0 A;  3BI4 A;  3P4S A;  5HXI A;  3GWD A;  3D1P A;  3SX6 A;  5KMP A;  1CJ3 A;  1H7X A;  1K4Q A;  5KMQ A;  2NPX A;  3SY4 A;  1MOK A;  3AE4 A;  4A5L A;  5KNL A;  1PN0 A;  1E39 A;  4B64 A;  3AEC A;  1BOI A;  1H83 A;  1N4U A;  5EOW A;  4EQS A;  4APN A;  1FCD A;  2MOI A;  2AR8 A;  3D1C A;  1D4D A;  1T3K A;  1PBD A;  1Y56 A;  2YM1 A;  3GWF A;  4NWZ A;  3UTN X;  2UZQ A;  1E7P A;  1K0J A;  1XDI A;  4JN9 A;  1ZMC A;  2C70 A;  1RYI A;  4NEW A;  4YTM A;  3T0K A;  2YLX A;  2X99 A;  4GAV A;  1IUT A;  1HZM A;  1CF3 A;  2WPC A;  2YR5 A;  4GCM A;  4GRT A;  4BJY A;  1YM9 A;  3ATR A;  3HWI A;  1TRB A;  3VQR A;  4B68 A;  2GR2 A;  4J33 A;  2B9W A;  3QSM A;  4J31 A;  3FLH A;  2R4J A;  4CRT A;  1EL8 A;  1KSS A;  2XYO A;  5BVA A;  1RHS A;  3AEE A;  2YG5 A;  1EL5 A;  4BUR A;  3KVE A;  3GD3 A;  1NEN A;  1JRX A;  2AQJ A;  1YY5 A;  2DKI A;  2YR4 A;  1QJD A;  3CNJ A;  5HBL A;  3AED A;  4J57 A;  4ZCC A;  3UOV A;  4BK2 A;  2I0Z A;  2WU2 A;  1PBC A;  3SFE A;  1ZY8 A;  3UTH A;  3NT6 A;  2F5Z A;  2VSW A;  3P4Q A;  4JGT A;  4I59 A;  1PJ7 A;  4AOS A;  4BK1 A;  1KNR A;  2WP9 A;  2ZZ0 A;  3AE9 A;  4FX9 A;  4U2S A;  4UDP A;  5HY5 A;  4C3Y A;  2BCP A;  2IFV A;  2VQB A;  3SZW A;  1CC6 A;  3UKA A;  1PJ6 A;  2Z5X A;  2ACZ A;  5KOW A;  4JY3 A;  4CY6 A;  2A2K A;  2RGH A;  4U8O A;  1NHS A;  2WOI A;  1YML A;  1HYU A;  3DK9 A;  4TLZ A;  4C74 A;  1ZK7 A;  4G6G A;  5HBQ A;  1RSG A;  2OAL A;  2BAB A;  1TDN A;  4GUV A;  5LAO A;  4NNJ A;  4C77 A;  2GR1 A;  2C73 A;  2EG4 A;  3EF6 A;  3FOJ A;  4JDR A;  4J2W A;  4J36 A;  3VRB A;  4G74 A;  4TM3 A;  2WQY A;  3TG3 A;  2EG4 B;  3AD9 B;  1B4V A;  3RP6 A;  3ICR A;  3DJE A;  4EQX A;  3GMC A;  1TDF A;  4B67 A;  1DOC A;  3IWH A;  1LPF A;  1PHH A;  2R9Z A;  4NEV A;  2B9X A;  4NTC A;  3NK1 X;  2Y6R A;  4Z26 A;  3UP4 A;  5IQ1 A;  1GAL A;  3KA7 A;  4GDE A;  3AXB A;  3NRN A;  3QSE A;  2JAE A;  2IVD A;  5KRQ A;  3VRA A;  2VVM A;  4ECH A;  2OUC A;  2XVF A;  3I3U A;  1YS0 A;  3FS5 A;  1CL0 A;  2C72 A;  3NGC X;  3R9U A;  3VRD B;  4IVM B;  4EIP A;  4XXG A;  4G6H A;  3P4R A;  2C76 A;  4DSG A;  1IUV A;  3IWA A;  4EMJ A;  3LXD A;  1MO9 A;  4U8L A;  5M0Z A;  2WES A;  5HHF A;  5BRT A;  3M13 A;  5FS8 A;  1GRB A;  1N4V A;  1B8S A;  3AE1 A;  4OPD A;  1XPQ A;  3GMB A;  2WOV A;  4B63 A;  2VQ7 A;  5KOX A;  1KDG A;  4C3X A;  2XLR A;  2XLT A;  4A65 A;  3EAN A;  3M0O A;  2J6P A;  1PXB A;  4RSL A;  2MRM A;  2Y6Q A;  4WCT A;  3E1T A;  3GRT A;  3NN6 X;  3M12 A;  2E5V A;  3CPH G;  4H4V A;  3OLH A;  3V76 A;  5HBP A;  1FOH A;  3CGD A;  4EM3 A;  3O0H A;  4O5Q A;  1E6E A;  5HYM A;  5KVH A;  1H82 A;  2EQ6 A;  4H4Q A;  5FS9 A;  1GTH A;  2RGJ A;  4OPL A;  2VOU A;  4JNQ A;  3AYL A;  4U2L A;  4X4J A;  3ATQ A;  4X9N A;  4FK1 A;  1UAR A;  5ER0 A;  1N4W A;  4C5O A;  1JRY A;  4Z2U A;  4AT0 A;  3K30 A;  2BK4 A;  4ICY A;  3AE2 A;  1GES A;  4U8I A;  3UP5 A;  1OJA A;  2WEU A;  4GF7 A;  5JCL A;  1K0I A;  3T14 A;  2WHD A;  4CNK A;  2YG4 A;  2ARD A;  3C4A A;  2V5Z A;  1D5T A;  1OJD A;  1PXA A;  3G5Q A;  2FJB A;  3CGC A;  4YSY A;  3SFD A;  3DJJ A;  1IUU A;  1GN0 A;  2WET A;  2BA9 A;  4H4Y A;  3HYX A;  4YTP A;  2X8C A;  3ADA B;  3K7Q X;  1BWC A;  3HYV A;  3NYE A;  3KPF A;  1XHC A;  3NTD A;  1ORB A;  1NAA A;  3Q9T A;  3OC4 A;  2BC0 A;  2XLS A;  3SXI A;  1F8W A;  3ALL A;  5JCM A;  3UKP A;  2MOL A;  1KF6 A;  2RAB A;  5CQF A;  1NPX A;  2GAG B;  2WP5 A;  1CWR A;  1GT8 A;  4EQR A;  2Q82 A;  2TPR A;  3AWI A;  3NN0 X;  1S3E A;  4LII A;  3UTE A;  3GYX A;  3UKQ A;  1NG4 A;  2OA1 A;  2V61 A;  1V59 A;  2X8H A;  3CPI G;  1OKG A;  2OAM A;  2FSX A;  3IHM A;  4K2X A;  4K8D A;  2XCG A;  4TM1 A;  3BHK A;  5FMH A;  4WH7 A;  1WHB A;  2GB0 A;  1L0V A;  2WDR A;  5C3J A;  1PBF A;  1PS9 A;  1GSN A;  2V3B A;  2C65 A;  1QO8 A;  3ZYX A;  2NVK X;  1KFY A;  4B1B A;  4Z2R A;  4H4X A;  1PJ5 A;  1Q1R A;  3BNU A;  3G5S A;  2C4C A;  3UKH A;  3F4A A;  3AAY A;  3BHF A;  1O95 A; 
#chains in the Genus database with same CATH homology
 3HZL A;  2BRA A;  1GOS A;  1E1M A;  4WH9 A;  5JCI A;  2B7S A;  1LVL A;  3CTY A;  3AD8 B;  4Y4L A;  3UKF A;  3ILM A;  2GQF A;  1JNZ A;  3IHG A;  4Z25 A;  1MXT A;  1H84 A;  1RP0 A;  2XVH A;  2QCU A;  4H4W A;  1GRA A;  2YVJ A;  4M52 A;  3CGB A;  4II3 A;  1URH A;  3DJG X;  3FIM B;  1W4X A;  3GRS A;  1M6I A;  1ZOY A;  3QVP A;  5BUL A;  1GV4 A;  4BJZ A;  2YLT A;  4YTN A;  4H4R A;  4TM4 A;  3UKL A;  3II4 A;  3MZZ A;  4A6N A;  1QB0 A;  3DGH A;  2ZBW A;  4REK A;  1RHD A;  3QSS A;  5DBJ A;  2R0G A;  4N9X A;  5BUK A;  5JCN A;  4YT0 A;  1E0C A;  2R46 A;  3LZW A;  3SGL A;  1B5Q A;  3AB1 A;  3T2Z A;  5J7X A;  3VR9 A;  4YSZ A;  4H4S A;  4ZN0 A;  1NEK A;  1ONF A;  4A9W A;  1D7L A;  1NHR A;  3H8I A;  4Z24 A;  2JB2 A;  2WPF A;  1S2Q A;  1YQ4 A;  2CDU A;  1BZL A;  4CCR A;  3AE7 A;  5LV9 A;  5JCK A;  3ABV A;  3NLC A;  2VRM A;  2K0Z A;  2JBV A;  4G9K A;  3ALM A;  4EM4 A;  4K22 A;  4B65 A;  3TP9 A;  4GDP A;  3G5R A;  4U8P A;  4IVO B;  3EPT A;  3HZU A;  2DCQ A;  3GSI A;  1H81 A;  2BAC A;  2BS4 A;  1ZOV A;  3R2U A;  2YAU A;  1LQU A;  4TLX A;  3FNJ A;  2IVE A;  2WBA A;  3F8P A;  1M64 A;  3LOV A;  4MJW A;  4EMI A;  2W0H A;  4H4P A;  4YKG A;  3CNP A;  5LAM A;  3S61 A;  5U1O A;  2V6O A;  1EL9 A;  2GR3 A;  2A89 A;  5J60 A;  4I58 A;  4JQ9 A;  4DSH A;  3QFA A;  5TR3 A;  1GRH A;  3DK8 A;  3CMM A;  1PBE A;  4B66 A;  1OJC A;  3QFB A;  2BS2 A;  1GPE A;  2WOW A;  3B3R A;  2Z5Y A;  1H4K X;  2B76 A;  1D4C A;  4A99 A;  2H89 A;  2XDO A;  2JK6 A;  1ZP0 A;  1P2H A;  2BK5 A;  4U2T A;  4WX1 A;  3SM8 A;  1F8S A;  4D04 A;  2YVG A;  3LAD A;  1CJC A;  1VDC A;  2GRT A;  2X50 A;  2GMH A;  2GR0 A;  3D8X A;  3AD7 B;  5L46 A;  2O9Z A;  3K7M X;  4K5S A;  4YSX A;  2HQM A;  2OLO A;  3CND A;  3TG1 B;  3NK0 X;  5GSN A;  4H4T A;  3B6D A;  4D03 A;  2XFN A;  4USQ A;  4A6N B;  4H7U A;  3C96 A;  4EQW A;  4JY2 A;  3FPZ A;  1OJ9 A;  3P4P A;  4O5U A;  4GR1 A;  4AT2 A;  2A87 A;  1CBO A;  1VG9 A;  3NK2 X;  1GXF A;  1P2E A;  1YKJ A;  2YLS A;  4CCQ A;  4IA6 A;  4K5R A;  3NHV A;  1REO A;  2X3N A;  1JNR A;  1GTE A;  5U63 A;  3GYJ A;  3V3O A;  3T2K A;  2X8G A;  1IUW A;  3DJD A;  2BXR A;  2WS3 A;  3DME A;  4FK1 C;  4DGK A;  3DK4 A;  4LU6 A;  3S5W A;  3ZDN A;  1DOD A;  4X9M A;  1E1L A;  1XAN A;  3UOZ A;  2C3D A;  3UOX A;  4HB9 A;  3NKS A;  4JNA A;  2DKH A;  3CGE A;  5GRT A;  2FJE A;  3SZC A;  4EIQ A;  3NHO X;  4H2N A;  1D4E A;  2YG7 A;  1F6M A;  2BC1 A;  2BCG G;  2WLR A;  3KD9 A;  3OZ2 A;  4OPG A;  1AOG A;  4F67 A;  3SYI A;  2QAE A;  1EL7 A;  2GEW A;  1F8R A;  4PAB A;  2YLZ A;  4RG3 A;  2ZZC A;  2QA1 A;  3ALJ A;  4NZH A;  3ICS A;  1F3P A;  2YG3 A;  3V3N A;  2CUL A;  3JSK A;  4A7A A;  4Z2T A;  4OPU A;  4AP3 A;  1TDE A;  1CWS A;  1DP2 A;  3SZF A;  2EQ7 A;  3UOY A;  3P3A A;  2BS3 A;  4EMW A;  2JTQ A;  1N1P A;  1PDH A;  4B69 A;  5C2T A;  1PBB A;  2GAH B;  1ZMD A;  2PYX A;  1ZX9 A;  3Q6J A;  3KPK A;  1IUX A;  4IV9 A;  2B7R A;  2GQW A;  1LQT A;  2UZZ A;  4K7Z A;  4CY8 A;  2XLP A;  3PS9 A;  5HPA A;  1PXC A;  1VRQ B;  3IF9 A;  3CN8 A;  3HIX A;  1O94 A;  1TDO A;  1DOE A;  1YT8 A;  1H7W A;  1X31 B;  2YWL A;  1TDK A;  1VG0 A;  2BYB A;  3BI2 A;  3H4K A;  4H50 A;  2GV8 A;  3QVR A;  2GH5 A;  1Y0P A;  1GND A;  3KKJ A;  4U8M A;  5CKU A;  5IPY A;  2XFP A;  4OPT A;  4RG4 A;  1NHQ A;  1S2Y A;  2R0C A;  3SQP A;  1OJT A;  1CJ4 A;  3FBS A;  4CNJ A;  2YLW A;  3T31 A;  2BK3 A;  4Z43 A;  3EAO A;  3AEA A;  2YQU A;  1TYT A;  3NH3 X;  3AYJ A;  2H88 A;  2ZZB A;  5IQ4 A;  5KMS A;  4YWO A;  3UTG A;  1CHU A;  5FS6 A;  4U8J A;  3BI5 A;  4BK3 A;  4H2R A;  1EBD A;  1LV0 A;  3P9U A;  4FDC B;  3WE0 A;  3F8R A;  3I3L A;  3UKK A;  1D7Y A;  3AYI A;  1GER A;  1L9C A;  1TQ1 A;  1LJ1 A;  2XFQ A;  4G73 A;  4H2P A;  4KPR A;  3RP7 A;  4AOX A;  1H4M X;  2C3C A;  1GEU A;  3AE6 A;  3I6D A;  1LTX R;  3LB8 A;  4NTE A;  4XWZ A;  1GMX A;  1NG3 A;  2R45 A;  2Q0K A;  1GRG A;  2XLU A;  2WPE A;  4P9S A;  1FEC A;  3LJP A;  1JU2 A;  3RP8 A;  3NTA A;  2OLN A;  3IPO A;  3ISH A;  4U8N A;  1H86 A;  2JB1 A;  1CJ2 A;  1H6V A;  1C25 A;  2GF3 A;  2ORA A;  3GD4 A;  4ZCD A;  3AE8 A;  5KWF A;  2B9Y A;  2HHG A;  2EQ8 A;  4AP1 A;  3GDP A;  4YKF A;  3UTF A;  4E0V A;  3NIX A;  1DNC A;  1GRT A;  1GRE A;  3NYF A;  1DJQ A;  4OPC A;  1L9D A;  3IC9 A;  1CWT A;  3L1R A;  2KL3 A;  3GYI A;  2WU5 A;  2A8X A;  2Q7V A;  1FEB A;  2YVF A;  4H4Z A;  4U8K A;  4Z44 A;  3KLJ A;  2E4G A;  3P1W A;  4Y4N A;  1UKV G;  2YR6 A;  3DH9 A;  3KU9 A;  2BXS A;  3AE3 A;  1DOB A;  1BKW A;  3T2Y A;  2R4E A;  1Y56 B;  3QJ4 A;  3DA1 A;  1JOA A;  1VQW A;  3COX A;  4OPI A;  4A79 A;  3OP3 A;  3H8L A;  4HA6 A;  2V60 A;  4J34 A;  2AAQ A;  2R0P A;  3K9R A;  2C67 A;  2WLX A;  2VVL G;  3C4N A;  3GDN A;  5EB4 A;  3VR8 A;  1SEZ A;  1KSU A;  4ADW A;  3RHA A;  3PO7 A;  2FJD A;  4H2Q A;  4NTD A;  3ICT A;  5KVI A;  3K7T A;  5KXJ A;  1B37 A;  1QXN A;  3IPP A;  2EQ9 A;  5FS7 A;  2XFO A;  4LA1 A;  5U25 A;  2BRY A;  4CBQ A;  1NHP A;  3NYC A;  1CC4 A;  1GRF A;  1E1K A;  3HYW A;  1L9E A;  2C7G A;  5KMR A;  3GK5 A;  2GVC A;  1E1N A;  1Q1W A;  2XFU A;  2E1M A;  1GET A;  2VZ2 A;  2YLR A;  3ITJ A;  4XWR A;  2IID A;  1QLB A;  2QA2 A;  4UP3 A;  3AEF A;  2XVJ A;  3CNS A;  4IA5 A;  4DNA A;  2GWF A;  3URH A;  2JTS A;  2Q0L A;  3AE5 A;  4YSH A;  3O3W A;  1ZDL A;  3I2V A;  2V3A A;  2IFD A;  1S3B A;  3NG7 X;  1IUS A;  1CC2 A;  1FL2 A;  1JEH A;  1K0L A;  2J3N A;  4UDQ A;  3CPJ G;  3BNM A;  4KX6 A;  1ELI A;  1DXL A;  3G5J A;  3CNT A;  2WP6 A;  2VRL A;  2CFY A;  2WDQ A;  4H4U A;  4OVI A;  4Y4M A;  1ZKQ A;  2YG6 A;  3AAX A;  1DJN A;  1JRZ A;  1KNP A;  3NNE A;  2Q6U A;  2YM2 A;  3AEG A;  2JB3 A;  3F8D A;  5HBO A;  4GAP A;  2APG A;  1Z6L A;  2C75 A;  1YMD A;  3RNM A;  4OCG A;  2C66 A;  2TMD A;  4BV6 A;  4J56 A;  1WV9 A;  2CVJ A;  2GMJ A;  3RED A;  5EBK A;  4USR A;  5M10 A;  4PAA A;  2WDV A;  2XVE A;  3PVC A;  1IJH A;  2JKC A;  2XVI A;  2EG3 A;  3FG2 P;  1BOH A;  2FBW A;  1BGN A;  3UCL A;  1BGJ A;  3CIR A;  1COY A;  4II2 A;  4TM0 A;  1YMK A;  2FJA A;  4UDR A;  1FEA A;  1YQ3 A;  2RGO A;  2C64 A;  5EB5 A;  1VEE A;  2JTR A;  1TYP A;  3AEB A;  3T37 A;  3FMW A;  1YQZ A;  4YXD A;  3LZX A;  2VVL A;  1BF3 A;  1Q9I A;  3DGZ A;  1O5W A;  1NDA A;  3L8K A;  2PHH A;  3SZ0 A;  3BI4 A;  3P4S A;  5HXI A;  3GWD A;  3D1P A;  3SX6 A;  5KMP A;  1CJ3 A;  1H7X A;  1K4Q A;  5KMQ A;  2NPX A;  3SY4 A;  1MOK A;  3AE4 A;  4A5L A;  5KNL A;  1PN0 A;  1E39 A;  4B64 A;  3AEC A;  1BOI A;  1H83 A;  1N4U A;  5EOW A;  4EQS A;  4APN A;  1FCD A;  2MOI A;  2AR8 A;  3D1C A;  1D4D A;  1T3K A;  1PBD A;  1Y56 A;  2YM1 A;  3GWF A;  4NWZ A;  3UTN X;  2UZQ A;  1E7P A;  1K0J A;  1XDI A;  4JN9 A;  1ZMC A;  2C70 A;  1RYI A;  4NEW A;  4YTM A;  3T0K A;  2YLX A;  2X99 A;  4GAV A;  1IUT A;  1HZM A;  1CF3 A;  2WPC A;  2YR5 A;  4GCM A;  4GRT A;  4BJY A;  1YM9 A;  3ATR A;  3HWI A;  1TRB A;  3VQR A;  4B68 A;  2GR2 A;  4J33 A;  2B9W A;  3QSM A;  4J31 A;  3FLH A;  2R4J A;  4CRT A;  1EL8 A;  1KSS A;  2XYO A;  5BVA A;  1RHS A;  3AEE A;  2YG5 A;  1EL5 A;  4BUR A;  3KVE A;  3GD3 A;  1NEN A;  1JRX A;  2AQJ A;  1YY5 A;  2DKI A;  2YR4 A;  1QJD A;  3CNJ A;  5HBL A;  3AED A;  4J57 A;  4ZCC A;  3UOV A;  4BK2 A;  2I0Z A;  2WU2 A;  1PBC A;  3SFE A;  1ZY8 A;  3UTH A;  3NT6 A;  2F5Z A;  2VSW A;  3P4Q A;  4JGT A;  4I59 A;  1PJ7 A;  4AOS A;  4BK1 A;  1KNR A;  2WP9 A;  2ZZ0 A;  3AE9 A;  4FX9 A;  4U2S A;  4UDP A;  5HY5 A;  4C3Y A;  2BCP A;  2IFV A;  2VQB A;  3SZW A;  1CC6 A;  3UKA A;  1PJ6 A;  2Z5X A;  2ACZ A;  5KOW A;  4JY3 A;  4CY6 A;  2A2K A;  2RGH A;  4U8O A;  1NHS A;  2WOI A;  1YML A;  1HYU A;  3DK9 A;  4TLZ A;  4C74 A;  1ZK7 A;  4G6G A;  5HBQ A;  1RSG A;  2OAL A;  2BAB A;  1TDN A;  4GUV A;  5LAO A;  4NNJ A;  4C77 A;  2GR1 A;  2C73 A;  2EG4 A;  3EF6 A;  3FOJ A;  4JDR A;  4J2W A;  4J36 A;  3VRB A;  4G74 A;  4TM3 A;  2WQY A;  3TG3 A;  2EG4 B;  3AD9 B;  1B4V A;  3RP6 A;  3ICR A;  3DJE A;  4EQX A;  3GMC A;  1TDF A;  4B67 A;  1DOC A;  3IWH A;  1LPF A;  1PHH A;  2R9Z A;  4NEV A;  2B9X A;  4NTC A;  3NK1 X;  2Y6R A;  4Z26 A;  3UP4 A;  5IQ1 A;  1GAL A;  3KA7 A;  4GDE A;  3AXB A;  3NRN A;  3QSE A;  2JAE A;  2IVD A;  5KRQ A;  3VRA A;  2VVM A;  4ECH A;  2OUC A;  2XVF A;  3I3U A;  1YS0 A;  3FS5 A;  1CL0 A;  2C72 A;  3NGC X;  3R9U A;  3VRD B;  4IVM B;  4EIP A;  4XXG A;  4G6H A;  3P4R A;  2C76 A;  4DSG A;  1IUV A;  3IWA A;  4EMJ A;  3LXD A;  1MO9 A;  4U8L A;  5M0Z A;  2WES A;  5HHF A;  5BRT A;  3M13 A;  5FS8 A;  1GRB A;  1N4V A;  1B8S A;  3AE1 A;  4OPD A;  1XPQ A;  3GMB A;  2WOV A;  4B63 A;  2VQ7 A;  5KOX A;  1KDG A;  4C3X A;  2XLR A;  2XLT A;  4A65 A;  3EAN A;  3M0O A;  2J6P A;  1PXB A;  4RSL A;  2MRM A;  2Y6Q A;  4WCT A;  3E1T A;  3GRT A;  3NN6 X;  3M12 A;  2E5V A;  3CPH G;  4H4V A;  3OLH A;  3V76 A;  5HBP A;  1FOH A;  3CGD A;  4EM3 A;  3O0H A;  4O5Q A;  1E6E A;  5HYM A;  5KVH A;  1H82 A;  2EQ6 A;  4H4Q A;  5FS9 A;  1GTH A;  2RGJ A;  4OPL A;  2VOU A;  4JNQ A;  3AYL A;  4U2L A;  4X4J A;  3ATQ A;  4X9N A;  4FK1 A;  1UAR A;  5ER0 A;  1N4W A;  4C5O A;  1JRY A;  4Z2U A;  4AT0 A;  3K30 A;  2BK4 A;  4ICY A;  3AE2 A;  1GES A;  4U8I A;  3UP5 A;  1OJA A;  2WEU A;  4GF7 A;  5JCL A;  1K0I A;  3T14 A;  2WHD A;  4CNK A;  2YG4 A;  2ARD A;  3C4A A;  2V5Z A;  1D5T A;  1OJD A;  1PXA A;  3G5Q A;  2FJB A;  3CGC A;  4YSY A;  3SFD A;  3DJJ A;  1IUU A;  1GN0 A;  2WET A;  2BA9 A;  4H4Y A;  3HYX A;  4YTP A;  2X8C A;  3ADA B;  3K7Q X;  1BWC A;  3HYV A;  3NYE A;  3KPF A;  1XHC A;  3NTD A;  1ORB A;  1NAA A;  3Q9T A;  3OC4 A;  2BC0 A;  2XLS A;  3SXI A;  1F8W A;  3ALL A;  5JCM A;  3UKP A;  2MOL A;  1KF6 A;  2RAB A;  5CQF A;  1NPX A;  2GAG B;  2WP5 A;  1CWR A;  1GT8 A;  4EQR A;  3AWI A;  2TPR A;  3NN0 X;  1S3E A;  4LII A;  3UTE A;  3GYX A;  3UKQ A;  1NG4 A;  2OA1 A;  2V61 A;  1V59 A;  2X8H A;  3CPI G;  1OKG A;  2OAM A;  2FSX A;  3IHM A;  4K2X A;  4K8D A;  2XCG A;  4TM1 A;  3BHK A;  5FMH A;  4WH7 A;  1WHB A;  2GB0 A;  1L0V A;  2WDR A;  5C3J A;  1PBF A;  1PS9 A;  1GSN A;  2V3B A;  2C65 A;  1QO8 A;  3ZYX A;  2NVK X;  1KFY A;  4B1B A;  4Z2R A;  4H4X A;  1PJ5 A;  1Q1R A;  3BNU A;  3G5S A;  2C4C A;  3UKH A;  3F4A A;  3AAY A;  3BHF A;  1O95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...