3NTDA

Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c531s mutant
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
565
structure length
565
Chain Sequence
MKKILIIGGVAGGASAAARARRLSETAEIIMFERGEYVSFANCGLPYHISGEIAQRSALVLQTPESFKARFNVEVRVKHEVVAIDRAAKLVTVRRLLDGSEYQESYDTLLLSPGAAPIVPPIPGVDNPLTHSLRNIPDMDRILQTIQMNNVEHATVVGGGFIGLEMMESLHHLGIKTTLLELADQVMTPVDREMAGFAHQAIRDQGVDLRLGTALSEVSYQVQTHVASDAAGEDTAHQHIKGHLSLTLSNGELLETDLLIMAIGVRPETQLARDAGLAIGELGGIKVNAMMQTSDPAIYAVGDAVEEQDFVTGQACLVPLAGPANRQGRMAADNMFGREERYQGTQGTAICKVFDLAVGATGKNEKQLKQAGIAFEKVYVHTASHASYYPGAEVVSFKLLFDPVKGTIFGAQAVGKDGIDKRIDVMAVAQRAGMTVEQLQHLELSYAPPYGSAKDVINQAAFVASNIIKGDATPIHFDQIDNLSEDQLLLDVRNPGELQNGGLEGAVNIPVDELRDRMHELPKDKEIIIFSQVGLRGNVAYRQLVNNGYRARNLIGGYRTYKFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords FAD-dependent pyridine nucleotide-disulphide oxidoreductase
publication title Characterization of an NADH-Dependent Persulfide Reductase from Shewanella loihica PV-4: Implications for the Mechanism of Sulfur Respiration via FAD-Dependent Enzymes .
pubmed doi rcsb
source organism Shewanella loihica
total genus 184
structure length 565
sequence length 565
chains with identical sequence B
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2010-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3ntdA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ntdA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ntdA01
1H82A 3AEGA 2OUCA 2B9YA 1HYUA 2NPXA 1B37A 3ZYXA 1E7PA 4A79A 1JNZA 5L46A 1F3PA 3HZUA 2R4EA 2VOUA 1BF3A 4J56A 3K7MX 5FS6A 4EMWA 1NDAA 3QVRA 4OPIA 4REKA 2K0ZA 3UTNX 1UKVG 1P2EA 3REDA 1K0IA 1EL5A 3AE8A 3Q9TA 3BI5A 2YAUA 2B9WA 3CPJG 1VG9A 2OALA 2UZZA 2XVHA 3ALMA 4CRTA 3GWDA 4DSGA 1ONFA 1P2HA 2C73A 2BC0A 3LZXA 4J31A 1MOKA 4C3YA 2GB0A 2X50A 1D4DA 1D7LA 3UKKA 3QFBA 4IVOB 1JRYA 1YMKA 4ICYA 3GWFA 3VR9A 4C74A 1B8SA 1L9DA 3Q6JA 2BS2A 5GRTA 4EIQA 3HZLA 5IQ4A 1LTXR 4XWRA 2JB2A 1YMDA 1FCDA 4JNAA 2AQJA 4WH7A 2V60A 2YM1A 5HY5A 3IWAA 2JTQA 1EBDA 2VSWA 2Q0KA 3NYEA 3VQRA 3D1PA 1ELIA 3K30A 5HBLA 2RGOA 1PS9A 4LIIA 4TM0A 3RP8A 2IVDA 5EB5A 3COXA 4IA6A 2Q6UA 1GTHA 3O3WA 2V6OA 5JCIA 2C75A 3AYJA 3NNEA 2ORAA 4M52A 3FOJA 4O5QA 3UOVA 4YSHA 4YTPA 4Z2TA 1DNCA 3H8IA 4ECHA 3ATRA 3AD7B 1RYIA 1LPFA 4USQA 3ISHA 4I59A 5CKUA 4U8JA 3S61A 3H8LA 1TDEA 3VRBA 4U2TA 1TQ1A 2FSXA 1QLBA 2YVFA 1DOCA 2WDQA 2V61A 1CJ4A 2PHHA 3OC4A 4OPUA 1E1NA 2HHGA 3PO7A 1B5QA 2YLRA 3DGHA 3VRDB 5DBJA 4A99A 4OPDA 4FDCB 4UDQA 2W0HA 3GDNA 2YVJA 5KOXA 5IQ1A 2AR8A 2CFYA 2X8CA 3C4AA 2GV8A 3OP3A 3GYIA 2GAGB 5BUKA 5J7XA 3CGDA 1GPEA 2ZBWA 3E1TA 2HQMA 3NG7X 4EQWA 2YG5A 1YQ4A 1DJQA 1K0JA 1MO9A 2Y6QA 1IUVA 2GMJA 3HIXA 2ZZ0A 3AE9A 1TRBA 2EQ9A 3HWIA 2RGHA 4O5UA 3VRAA 4JQ9A 3EANA 3F4AA 1BWCA 4YSYA 2E4GA 2C64A 1GRGA 2PYXA 2YR6A 4E0VA 2E5VA 3I3UA 3CPIG 1GESA 1S2YA 3GMBA 3NRNA 5KVIA 3FBSA 4YSXA 1NHSA 2YG7A 4I58A 2XVIA 3O0HA 3DA1A 1YY5A 3SFEA 4CY8A 3JSKA 1RSGA 4H4TA 3UP5A 2O9ZA 2Y6RA 2V3BA 2ZZCA 1DXLA 1TYTA 3NKSA 4CNJA 1D7YA 2AAQA 3NGCX 1H4KX 1XDIA 4OVIA 3NIXA 3PS9A 2XLRA 1L9CA 1NEKA 2XLPA 4U8KA 2WPFA 2YR4A 4YTNA 5HBQA 2R0GA 5M10A 2C76A 1QXNA 2GQFA 1IJHA 1IUWA 1XANA 4JY3A 2MOIA 2FJBA 2EQ6A 4H2PA 1E1LA 1PXCA 2GR1A 1DP2A 4D03A 2VRLA 3RNMA 1KDGA 3CN8A 2E1MA 1MXTA 1IUXA 2WP5A 1DJNA 3P1WA 1PXAA 2J3NA 5J60A 3CGCA 3KA7A 2IVEA 4AP3A 1OJDA 4Y4LA 5HYMA 3OLHA 3GSIA 4IVMB 1S2QA 2XLUA 1NENA 4WH9A 2GMHA 3SM8A 4U8OA 5JCLA 3BI4A 3SGLA 4EIPA 2UZQA 1CJCA 2WOWA 2WPEA 3AD9B 4HB9A 2A87A 4NTEA 2JTSA 1Q1RA 3ALLA 4A65A 5EBKA 4B69A 3DJGX 1N4UA 2QA2A 3AECA 1ZKQA 4P9SA 2OAMA 4HA6A 1KSUA 4K2XA 2WS3A 2YG3A 3CGEA 4H4VA 5BRTA 3FLHA 1OJ9A 3L1RA 3NN6X 3UTHA 4K5RA 1C25A 2NVKX 3QSEA 3URHA 4DSHA 1QB0A 3QSMA 3AEEA 4AT0A 2XVFA 3M13A 3UTGA 3UCLA 3BI2A 2R46A 1TDKA 2WDRA 3I2VA 3UKAA 2IFDA 1F6MA 1GNDA 1TYPA 4MJWA 4YWOA 1KF6A 2XLSA 1QO8A 1H7WA 2CDUA 3ALJA 1IUSA 1SEZA 4Z44A 3DK4A 1GERA 2RGJA 4H4ZA 3AE1A 1CWRA 2BCGG 3ICSA 2WDVA 4A9WA 3IPPA 1GETA 3K7QX 4CCQA 4RG4A 1F8RA 3BNUA 1REOA 2H88A 3DGZA 2XFQA 2XVEA 2XYOA 4RSLA 4XWZA 1XHCA 2WU2A 1E6EA 1KFYA 3KU9A 3G5QA 4JGTA 1AOGA 5FS8A 1FEBA 4B67A 4UDPA 4C5OA 1LV0A 2BC1A 1YKJA 2DKHA 5LAOA 4Y4MA 2GEWA 3DMEA 1UARA 3UTFA 3GK5A 1GRFA 3DJJA 3K7TA 1LJ1A 2C66A 3AE5A 4OPTA 1NHPA 2V3AA 1N4VA 1PBBA 3CGBA 4JDRA 1YQ3A 4FX9A 2C70A 4Z24A 2FBWA 4Z43A 2WU5A 3QSSA 2EQ8A 1NAAA 1ZMCA 2VQBA 1TDFA 2JBVA 4FK1C 1YMLA 1DOBA 4RG3A 2YM2A 3IWHA 2GR3A 3CPHG 5LV9A 4U8NA 2B7SA 4B66A 1H81A 4NTCA 4J33A 3LADA 1X31B 1NHRA 2FJAA 1GN0A 3QVPA 1PJ6A 1KNPA 3NH3X 3FIMB 3BHKA 1EL8A 1BOHA 2ARDA 2I0ZA 1Z6LA 1WHBA 4DNAA 4H4YA 1EL7A 3RHAA 4OCGA 3ABVA 1ZK7A 1ZOVA 3GD3A 3UP4A 4BK3A 3M0OA 2WP6A 2WHDA 2B76A 3ATQA 1M6IA 4Z2RA 5JCNA 2C3DA 2H89A 3AE4A 2WEUA 1QJDA 3GYJA 1FEAA 1YS0A 3UKFA 3AAXA 4IA5A 5KXJA 4TLZA 4Z26A 3UOXA 2ACZA 5U1OA 5KVHA 1OJAA 2CULA 2MRMA 1Q1WA 1NPXA 4CBQA 1FL2A 2Q0LA 1CL0A 3NK0X 2BK5A 4K7ZA 4OPGA 4ZN0A 2TMDA 3KVEA 2MOLA 5HBOA 1H84A 4B63A 4CY6A 4LU6A 3IF9A 4LA1A 1ZP0A 1LQTA 5LAMA 2J6PA 2RABA 5FS9A 1S3EA 2BYBA 1PBCA 2CVJA 2GF3A 3B3RA 2R4JA 3FS5A 4N9XA 2TPRA 1Q9IA 2B9XA 1K0LA 3AEBA 3C4NA 1OKGA 1ZX9A 3NYFA 1GALA 1NG3A 4XXGA 4BURA 4EQXA 4H50A 4EQRA 3NK2X 2IIDA 4TM1A 1N4WA 2JKCA 4A6NB 2VZ2A 1KSSA 3NN0X 1CF3A 2GRTA 3AE2A 2YQUA 2X8HA 1NHQA 4YT0A 2XCGA 2EG4B 3EF6A 3LOVA 4F67A 1H83A 1VG0A 1EL9A 1ZDLA 1ZMDA 2QAEA 3CIRA 4TLXA 5HPAA 3AE6A 1ZOYA 4J2WA 3P9UA 1BGJA 1PJ5A 5BULA 1GOSA 1F8WA 1IUTA 3ADAB 1JOAA 3NYCA 2WBAA 2V5ZA 5HBPA 2Q7VA 1D4CA 1FOHA 1NG4A 1PJ7A 2BXSA 3UKQA 2C72A 2DCQA 4X9MA 1L0VA 3G5RA 3IHGA 3C96A 2YG4A 4JY2A 3P4RA 1E0CA 5HXIA 2GR2A 2X3NA 3ZDNA 2OA1A 1V59A 1H7XA 3AE7A 3NK1X 4NEWA 3LB8A 2JAEA 3GRSA 1DODA 3G5JA 2C3CA 4H2RA 2GWFA 4X4JA 1YT8A 1COYA 4GRTA 4AOXA 3D1CA 2IFVA 3ITJA 2BK4A 1N1PA 2A8XA 4ZCCA 3F8PA 3MZZA 1O95A 3EAOA 4YTMA 4A7AA 3LZWA 4GDPA 3KD9A 5BVAA 3QJ4A 2EQ7A 1JRXA 1JU2A 1OJTA 3I3LA 3UKPA 1VQWA 4H2QA 1RP0A 3UTEA 4H4UA 1URHA 1LQUA 3ICTA 1XPQA 3AB1A 2XVJA 4APNA 4GUVA 1H4MX 1H86A 4JN9A 2BCPA 2WPCA 4FK1A 2XLTA 4D04A 3M12A 1BKWA 3P4SA 1W4XA 3FPZA 2VVLA 4AT2A 1E1KA 3DH9A 4YKFA 2ZZBA 2R9ZA 2R0PA 3F8RA 2DKIA 3NLCA 4EQSA 3RP7A 5FS7A 2WLXA 4YKGA 2APGA 2WLRA 2XDOA 4B68A 3F8DA 1CWSA 1O5WA 3LJPA 2GAHB 4EM4A 3P4PA 5C3JA 4B1BA 1E39A 3EPTA 4H4QA 4U8MA 1BGNA 1FECA 2VVLG 2XFNA 1VEEA 3P3AA 4JNQA 3WE0A 2GR0A 3S5WA 1GRAA 4A6NA 2BS4A 3NT6A 3NTAA 1ZY8A 2X99A 4NEVA 3AYLA 1CC4A 3KKJA 3L8KA 4Y4NA 2EG4A 3AD8B 4NTDA 4U8IA 4C3XA 3FG2P 3II4A 2KL3A 1K4QA 1PBEA 1PHHA 2YWLA 2BK3A 3CNSA 3G5SA 3CNTA 2JB1A 3OZ2A 4H7UA 3AWIA 5FMHA 3IPOA 2FJEA 4H4PA 3V3NA 3AEAA 2BA9A 5C2TA 1CBOA 2XFUA 1TDOA 1BOIA 3RP6A 4EM3A 4PABA 1CWTA 3UOYA 1E1MA 4U2LA 3I6DA 1IUUA 2WQYA 1D5TA 3ICRA 2A89A 4CCRA 2C67A 1YM9A 1Y56B 5U63A 4J36A 2WOIA 1CHUA 1PDHA 1PXBA 2YR5A 1GRTA 4BJZA 1F8SA 4BK2A 1L9EA 2BABA 4EMIA 5GSNA 4B64A 3AYIA 2EG3A 3DJDA 3UKHA 2YLWA 3BNMA 4YSZA 4KPRA 3R2UA 1CJ2A 1T3KA 4GDEA 4A5LA 2WOVA 2GQWA 4J34A 1GXFA 2BXRA 4J57A 3BHFA 4ZCDA 3TG3A 4H4RA 4ADWA 2Z5XA 4USRA 1DOEA 2WESA 5IPYA 1JNRA 2YLTA 4DGKA 2GVCA 2YG6A 3AEFA 4BJYA 2JK6A 4OPCA 2VVMA 5KRQA 3R9UA 1JRZA 3IC9A 4U8PA 4H4SA 5TR3A 2JB3A 1PBFA 4GR1A 4K8DA 1VDCA 4WCTA 1M64A 4WX1A 4UP3A 1B4VA 1VRQB 1GV4A 3B6DA 4AP1A 2GH5A 1OJCA 5KOWA 1GMXA 3GDPA 2VRMA 3DK8A 4GCMA 4PAAA 4U8LA 2QA1A 1HZMA 1D4EA 5JCKA 3V3OA 3TG1B 2F5ZA 4K5SA 4YXDA 2BS3A 3SFDA 3ILMA 2FJDA 3NTDA 2YLSA 1GTEA 2VQ7A 1ORBA 4UDRA 2BACA 4C77A 4EMJA 1CC2A 2OLNA 3PVCA 4AOSA 3AAYA 3CNJA 1CJ3A 3SQPA 4X9NA 3NHOX 3GRTA 2YVGA 4BV6A 3CTYA 4TM3A 1WV9A 1PN0A 1RHDA 1YQZA 3AEDA 4H2NA 1LVLA 3CNDA 1Y0PA 2OLOA 1GREA 5ER0A 3UOZA 3KLJA 2R45A 4Z2UA 3FNJA 3DK9A 1PBDA 5U25A 3T37A 1TDNA 3DJEA 3GD4A 2YLZA 3CNPA 3FMWA 1GRHA 5JCMA 3H4KA 2Z5YA 1GT8A 2WETA 3VR8A 2R0CA 3IHMA 5CQFA 4BK1A 4U2SA 1BZLA 2B7RA 4K22A 5KWFA 2QCUA 3TP9A 3QFAA 1GSNA 3LXDA 2XFOA 1RHSA 1Y56A 3GMCA 1S3BA 3P4QA 1O94A 1JEHA 4TM4A 1GEUA 2JTRA 5EB4A 4CNKA 1KNRA 2C65A 2XFPA 3V76A 4KX6A 2A2KA 3K9RA 2X8GA 2C7GA 3AXBA 4NZHA 1GRBA 3AE3A 5EOWA 3D8XA 5HHFA 4OPLA 4IV9A 4H4WA 3NHVA 2WP9A 5M0ZA 4Z25A 2YLXA 3KPFA 3UKLA 4H4XA 1H6VA 4GF7A 1CC6A 4B65A
chains in the Genus database with same CATH superfamily
1H82A 3AEGA 2OUCA 2B9YA 1HYUA 2NPXA 1B37A 3ZYXA 1E7PA 4A79A 1JNZA 5L46A 1F3PA 3HZUA 2R4EA 2VOUA 1BF3A 4J56A 3K7MX 4G6GA 5FS6A 4EMWA 1NDAA 3QVRA 4OPIA 4REKA 2K0ZA 3UTNX 1UKVG 1P2EA 3REDA 1K0IA 1EL5A 3AE8A 3Q9TA 3BI5A 2YAUA 2B9WA 3CPJG 1VG9A 2OALA 2UZZA 2XVHA 3ALMA 4CRTA 4G6HA 3GWDA 4DSGA 1ONFA 1P2HA 2C73A 2BC0A 3LZXA 4J31A 1MOKA 4C3YA 2GB0A 2X50A 1D4DA 1D7LA 3UKKA 3QFBA 4IVOB 1JRYA 1YMKA 4ICYA 3GWFA 5KMQA 3VR9A 1B8SA 1L9DA 3Q6JA 2BS2A 5GRTA 4C74A 3HZLA 4EIQA 1LTXR 4XWRA 2JB2A 5IQ4A 1YMDA 1FCDA 4JNAA 5KMRA 2AQJA 4WH7A 2V60A 2YM1A 5HY5A 3IWAA 2JTQA 1EBDA 2VSWA 2Q0KA 3NYEA 3VQRA 3D1PA 1ELIA 3K30A 5HBLA 2RGOA 1PS9A 4LIIA 4TM0A 3RP8A 2IVDA 5EB5A 3COXA 4IA6A 2Q6UA 1GTHA 3O3WA 2V6OA 5JCIA 2C75A 3AYJA 3NNEA 2ORAA 4M52A 3FOJA 4O5QA 3UOVA 4YSHA 4YTPA 4Z2TA 1DNCA 3H8IA 4ECHA 3ATRA 3SZCA 3AD7B 1RYIA 1LPFA 4USQA 3ISHA 4I59A 5CKUA 4U8JA 3S61A 3H8LA 1TDEA 3VRBA 4U2TA 1TQ1A 2FSXA 1QLBA 2YVFA 1DOCA 2WDQA 2V61A 1CJ4A 2PHHA 3OC4A 4OPUA 1E1NA 2HHGA 3PO7A 1B5QA 2YLRA 3DGHA 3VRDB 5DBJA 4A99A 4OPDA 4FDCB 4UDQA 2W0HA 2BRYA 3GDNA 2YVJA 5KOXA 5IQ1A 2AR8A 2BRAA 2CFYA 2X8CA 3C4AA 2GV8A 3OP3A 3GYIA 2GAGB 5BUKA 5J7XA 3CGDA 1GPEA 2ZBWA 3E1TA 2HQMA 3NG7X 3T0KA 4EQWA 2YG5A 1YQ4A 1DJQA 1K0JA 1MO9A 2Y6QA 1IUVA 2GMJA 3HIXA 2ZZ0A 3AE9A 1TRBA 2EQ9A 3HWIA 2RGHA 4O5UA 3VRAA 4JQ9A 3EANA 3F4AA 1BWCA 4YSYA 2E4GA 2C64A 1GRGA 2PYXA 2YR6A 4E0VA 2E5VA 3I3UA 3CPIG 1GESA 1S2YA 3GMBA 3NRNA 5KVIA 3FBSA 4YSXA 1NHSA 2YG7A 3GYXA 4I58A 2XVIA 3O0HA 3DA1A 1YY5A 3SFEA 4CY8A 3JSKA 1RSGA 4H4TA 3UP5A 4NWZA 2O9ZA 2Y6RA 2V3BA 2ZZCA 1DXLA 1TYTA 3NKSA 4CNJA 1D7YA 2AAQA 3NGCX 1H4KX 2C4CA 1XDIA 4OVIA 3NIXA 3PS9A 2XLRA 1L9CA 1NEKA 2XLPA 4U8KA 2WPFA 2YR4A 4YTNA 5HBQA 2R0GA 5M10A 2C76A 3SXIA 1QXNA 2GQFA 1IJHA 1IUWA 1XANA 4JY3A 2MOIA 2FJBA 2EQ6A 4H2PA 1E1LA 1PXCA 2GR1A 1DP2A 4D03A 2VRLA 3RNMA 1KDGA 3CN8A 2E1MA 1MXTA 1IUXA 2WP5A 1DJNA 3P1WA 1PXAA 2J3NA 5J60A 3CGCA 3KA7A 2IVEA 4AP3A 1OJDA 4Y4LA 5HYMA 3OLHA 3GSIA 4IVMB 1S2QA 2XLUA 1NENA 5KMPA 4WH9A 2GMHA 3SM8A 4U8OA 5JCLA 3BI4A 3SGLA 4EIPA 2UZQA 1CJCA 2WOWA 2WPEA 3AD9B 4HB9A 2A87A 4NTEA 3HYWA 2JTSA 1Q1RA 3ALLA 4II3A 5EBKA 4A65A 4B69A 3DJGX 1N4UA 2QA2A 3AECA 1ZKQA 4P9SA 2OAMA 4HA6A 1KSUA 4K2XA 2WS3A 2YG3A 3CGEA 4H4VA 5BRTA 3FLHA 1OJ9A 3L1RA 3NN6X 3UTHA 4K5RA 1C25A 2NVKX 3QSEA 3URHA 4DSHA 1QB0A 3QSMA 3AEEA 4AT0A 2XVFA 3M13A 3UTGA 3UCLA 3BI2A 2R46A 1TDKA 2WDRA 3I2VA 3UKAA 2IFDA 1F6MA 1GNDA 1TYPA 4MJWA 4YWOA 1KF6A 2XLSA 1QO8A 1H7WA 2CDUA 3ALJA 1IUSA 1SEZA 4Z44A 3DK4A 1GERA 2RGJA 4H4ZA 3AE1A 1CWRA 2BCGG 3ICSA 2WDVA 4A9WA 3IPPA 1GETA 3K7QX 3T14A 4CCQA 4RG4A 1F8RA 3BNUA 1REOA 2H88A 3DGZA 2XFQA 2XVEA 2XYOA 4RSLA 4XWZA 1XHCA 2WU2A 1E6EA 1KFYA 3KU9A 3G5QA 4JGTA 1AOGA 5FS8A 1FEBA 4B67A 4UDPA 4C5OA 1LV0A 2BC1A 1YKJA 2DKHA 5LAOA 4Y4MA 2GEWA 3DMEA 1UARA 3UTFA 3GK5A 1GRFA 3DJJA 3K7TA 1LJ1A 2C66A 3AE5A 4OPTA 1NHPA 2V3AA 1N4VA 1PBBA 3CGBA 4JDRA 1YQ3A 4FX9A 2C70A 4Z24A 2FBWA 4Z43A 2WU5A 3QSSA 2EQ8A 1NAAA 1ZMCA 2VQBA 1TDFA 2JBVA 4FK1C 1YMLA 1DOBA 4RG3A 2YM2A 3IWHA 2GR3A 3CPHG 5LV9A 4U8NA 2B7SA 4B66A 1H81A 4NTCA 4J33A 3LADA 1X31B 1NHRA 2FJAA 5KMSA 1GN0A 3QVPA 1PJ6A 1KNPA 3NH3X 3FIMB 3BHKA 1EL8A 1BOHA 2ARDA 2I0ZA 1Z6LA 1WHBA 4DNAA 4H4YA 1EL7A 3RHAA 4OCGA 3ABVA 1ZK7A 1ZOVA 3GD3A 3UP4A 4BK3A 3M0OA 2WP6A 2WHDA 2B76A 3ATQA 1M6IA 3KPKA 4Z2RA 2C3DA 5JCNA 2H89A 3AE4A 2WEUA 1QJDA 3HYVA 3GYJA 1FEAA 1YS0A 3UKFA 3AAXA 4IA5A 3HYXA 5KXJA 4TLZA 4Z26A 3UOXA 2ACZA 5U1OA 5KVHA 1OJAA 2CULA 2MRMA 1Q1WA 1NPXA 4CBQA 1FL2A 2Q0LA 1CL0A 3NK0X 2BK5A 4K7ZA 4OPGA 4ZN0A 2TMDA 3KVEA 2MOLA 5HBOA 1H84A 4B63A 4CY6A 4LU6A 3IF9A 4LA1A 1ZP0A 1LQTA 5LAMA 2J6PA 2RABA 5FS9A 1S3EA 2BYBA 1PBCA 2CVJA 2GF3A 3B3RA 2R4JA 3FS5A 4N9XA 2TPRA 1Q9IA 2B9XA 1K0LA 3AEBA 3C4NA 1OKGA 1ZX9A 3NYFA 1GALA 1NG3A 4XXGA 4BURA 4EQXA 4H50A 4EQRA 3NK2X 2IIDA 4TM1A 1N4WA 2JKCA 4A6NB 2VZ2A 1KSSA 3NN0X 1CF3A 2GRTA 3AE2A 2YQUA 2X8HA 1NHQA 4YT0A 2XCGA 2EG4B 3EF6A 3LOVA 4F67A 1H83A 3T2YA 1VG0A 1EL9A 1ZDLA 1ZMDA 2QAEA 3CIRA 4TLXA 4II2A 5HPAA 3AE6A 1ZOYA 4J2WA 3P9UA 1BGJA 1PJ5A 5BULA 1GOSA 2Q82A 1F8WA 1IUTA 3ADAB 1JOAA 3NYCA 2WBAA 2V5ZA 5HBPA 2Q7VA 5KNLA 1D4CA 1FOHA 1NG4A 1PJ7A 2BXSA 3UKQA 2C72A 2DCQA 4X9MA 1L0VA 3G5RA 3IHGA 3C96A 2YG4A 4JY2A 3P4RA 1E0CA 5HXIA 2GR2A 2X3NA 3ZDNA 2OA1A 1V59A 1H7XA 3AE7A 3NK1X 4NEWA 3LB8A 2JAEA 3GRSA 1DODA 3G5JA 2C3CA 4H2RA 2GWFA 4X4JA 1YT8A 1COYA 4GRTA 4AOXA 3D1CA 2IFVA 3ITJA 2BK4A 1N1PA 2A8XA 4ZCCA 3F8PA 3MZZA 1O95A 3EAOA 4YTMA 4A7AA 3LZWA 4GDPA 3KD9A 5BVAA 3QJ4A 2EQ7A 1JRXA 1JU2A 1OJTA 3I3LA 3UKPA 1VQWA 3CMMA 4H2QA 1RP0A 3UTEA 4H4UA 1URHA 1LQUA 3ICTA 1XPQA 3AB1A 2XVJA 4APNA 4GUVA 1H4MX 1H86A 4JN9A 2BCPA 2WPCA 4FK1A 2XLTA 4D04A 3M12A 1BKWA 3P4SA 1W4XA 3FPZA 2VVLA 4AT2A 1E1KA 3DH9A 4YKFA 2ZZBA 2R9ZA 2R0PA 3F8RA 4G74A 2DKIA 3NLCA 4EQSA 3RP7A 5FS7A 3T2KA 2WLXA 4YKGA 2APGA 2WLRA 3SZFA 2XDOA 4B68A 3F8DA 1CWSA 1O5WA 3LJPA 2GAHB 4EM4A 3P4PA 5C3JA 4B1BA 1E39A 3EPTA 4H4QA 4U8MA 1BGNA 1FECA 2VVLG 2XFNA 1VEEA 3P3AA 4JNQA 3WE0A 3T2ZA 2GR0A 3S5WA 1GRAA 4A6NA 2BS4A 3NT6A 3NTAA 1ZY8A 2X99A 4NEVA 3AYLA 1CC4A 3KKJA 3L8KA 4Y4NA 2EG4A 3AD8B 4NTDA 4U8IA 4C3XA 3FG2P 3SX6A 3II4A 2KL3A 1K4QA 1PBEA 1PHHA 2YWLA 2BK3A 3CNSA 3G5SA 3CNTA 2JB1A 3OZ2A 4H7UA 3AWIA 5FMHA 3IPOA 2FJEA 4H4PA 3V3NA 3AEAA 2BA9A 5C2TA 1CBOA 2XFUA 1TDOA 1BOIA 3RP6A 4EM3A 4PABA 1CWTA 4GAPA 1E1MA 4U2LA 3UOYA 3I6DA 1IUUA 2WQYA 1D5TA 3ICRA 2A89A 4CCRA 2C67A 1YM9A 1Y56B 5U63A 4J36A 2WOIA 1CHUA 1PDHA 1PXBA 3SZWA 2YR5A 1GRTA 4BJZA 1F8SA 4BK2A 1L9EA 2BABA 4EMIA 5GSNA 4B64A 3AYIA 2EG3A 3DJDA 3UKHA 2YLWA 3BNMA 4YSZA 4KPRA 3R2UA 1CJ2A 1T3KA 4GDEA 4A5LA 2WOVA 2GQWA 4J34A 1GXFA 2BXRA 3SZ0A 4J57A 3BHFA 4ZCDA 3TG3A 4H4RA 4ADWA 2Z5XA 4USRA 1DOEA 2WESA 5IPYA 1JNRA 2YLTA 4DGKA 2GVCA 3SYIA 2YG6A 3AEFA 4BJYA 2JK6A 4OPCA 2VVMA 5KRQA 3R9UA 1JRZA 3IC9A 4U8PA 4H4SA 5TR3A 2JB3A 1PBFA 4GR1A 4K8DA 1VDCA 4WCTA 1M64A 4WX1A 4UP3A 1B4VA 1VRQB 1GV4A 3B6DA 4AP1A 2GH5A 1OJCA 5KOWA 1GMXA 3GDPA 2VRMA 3DK8A 4GCMA 4PAAA 4G9KA 4U8LA 2QA1A 1HZMA 1D4EA 5JCKA 3V3OA 3TG1B 2F5ZA 4K5SA 4YXDA 2BS3A 3SFDA 3ILMA 2FJDA 3NTDA 2YLSA 1GTEA 2VQ7A 1ORBA 4UDRA 2BACA 3T31A 4NNJA 4C77A 1CC2A 2OLNA 3PVCA 4EMJA 4AOSA 3AAYA 3CNJA 1CJ3A 3SQPA 4X9NA 3NHOX 3GRTA 2YVGA 4BV6A 3CTYA 4TM3A 1WV9A 1PN0A 1RHDA 1YQZA 4G73A 3AEDA 4H2NA 1LVLA 3CNDA 1Y0PA 2OLOA 1GREA 5ER0A 3UOZA 3KLJA 2R45A 4Z2UA 3FNJA 3DK9A 1PBDA 5U25A 3T37A 1TDNA 3DJEA 3GD4A 2YLZA 3CNPA 3FMWA 1GRHA 5JCMA 3H4KA 2Z5YA 1GT8A 2WETA 3VR8A 2R0CA 3IHMA 5CQFA 4BK1A 4U2SA 3SY4A 1BZLA 2B7RA 4K22A 5KWFA 2QCUA 3TP9A 3QFAA 1GSNA 3LXDA 2XFOA 1RHSA 1Y56A 3GMCA 1S3BA 3P4QA 1O94A 1JEHA 4TM4A 1GEUA 2JTRA 5EB4A 4CNKA 1KNRA 2C65A 2XFPA 3V76A 4KX6A 2A2KA 3K9RA 2X8GA 2C7GA 3AXBA 4NZHA 1GRBA 3AE3A 5EOWA 3D8XA 5HHFA 4OPLA 4IV9A 4H4WA 3NHVA 2WP9A 5M0ZA 4Z25A 2YLXA 3KPFA 4GAVA 3UKLA 4H4XA 1H6VA 4GF7A 1CC6A 4B65A
chains in the Genus database with same CATH topology
1H82A 3AEGA 2OUCA 2B9YA 1HYUA 2NPXA 1B37A 3ZYXA 1E7PA 4A79A 1JNZA 5L46A 1F3PA 3HZUA 2R4EA 2VOUA 1BF3A 4J56A 3K7MX 4G6GA 5FS6A 4EMWA 1NDAA 3QVRA 4OPIA 4REKA 2K0ZA 3UTNX 1UKVG 1P2EA 3REDA 1K0IA 1EL5A 3AE8A 3Q9TA 3BI5A 2YAUA 2B9WA 3CPJG 1VG9A 2OALA 2UZZA 2XVHA 3ALMA 4CRTA 4G6HA 3GWDA 4DSGA 1ONFA 1P2HA 2C73A 2BC0A 3LZXA 4J31A 1MOKA 4C3YA 2GB0A 2X50A 1D4DA 1D7LA 3UKKA 3QFBA 4IVOB 1JRYA 1YMKA 4ICYA 3GWFA 5KMQA 3VR9A 1B8SA 1L9DA 3Q6JA 2BS2A 5GRTA 4C74A 3HZLA 4EIQA 1LTXR 4XWRA 2JB2A 5IQ4A 1YMDA 1FCDA 4JNAA 5KMRA 2AQJA 4WH7A 2V60A 2YM1A 5HY5A 3IWAA 2JTQA 1EBDA 2VSWA 2Q0KA 3NYEA 3VQRA 3D1PA 1ELIA 3K30A 5HBLA 2RGOA 1PS9A 4LIIA 4TM0A 3RP8A 2IVDA 5EB5A 3COXA 4IA6A 2Q6UA 1GTHA 3O3WA 2V6OA 5JCIA 2C75A 3AYJA 3NNEA 2ORAA 4M52A 3FOJA 4O5QA 3UOVA 4YSHA 4YTPA 4Z2TA 1DNCA 3H8IA 4ECHA 3ATRA 3SZCA 3AD7B 1RYIA 1LPFA 4USQA 3ISHA 4I59A 5CKUA 4U8JA 3S61A 3H8LA 1TDEA 3VRBA 4U2TA 1TQ1A 2FSXA 1QLBA 2YVFA 1DOCA 2WDQA 2V61A 1CJ4A 2PHHA 3OC4A 4OPUA 1E1NA 2HHGA 3PO7A 1B5QA 2YLRA 3DGHA 3VRDB 5DBJA 4A99A 4OPDA 4FDCB 4UDQA 2W0HA 2BRYA 3GDNA 2YVJA 5KOXA 5IQ1A 2AR8A 2BRAA 2CFYA 2X8CA 3C4AA 2GV8A 3OP3A 3GYIA 2GAGB 5BUKA 5J7XA 3CGDA 1GPEA 2ZBWA 3E1TA 2HQMA 3NG7X 3T0KA 4EQWA 2YG5A 1YQ4A 1DJQA 1K0JA 1MO9A 2Y6QA 1IUVA 2GMJA 3HIXA 2ZZ0A 3AE9A 1TRBA 2EQ9A 3HWIA 2RGHA 4O5UA 3VRAA 4JQ9A 3EANA 3F4AA 1BWCA 4YSYA 2E4GA 2C64A 1GRGA 2PYXA 2YR6A 4E0VA 2E5VA 3I3UA 3CPIG 1GESA 1S2YA 3GMBA 3NRNA 5KVIA 3FBSA 4YSXA 1NHSA 2YG7A 3GYXA 4I58A 2XVIA 3O0HA 3DA1A 1YY5A 3SFEA 4CY8A 3JSKA 1RSGA 4H4TA 3UP5A 4NWZA 2O9ZA 2Y6RA 2V3BA 2ZZCA 1DXLA 1TYTA 3NKSA 4CNJA 1D7YA 2AAQA 3NGCX 1H4KX 2C4CA 1XDIA 4OVIA 3NIXA 3PS9A 2XLRA 1L9CA 1NEKA 2XLPA 4U8KA 2WPFA 2YR4A 4YTNA 5HBQA 2R0GA 5M10A 2C76A 3SXIA 1QXNA 2GQFA 1IJHA 1IUWA 1XANA 4JY3A 2MOIA 2FJBA 2EQ6A 4H2PA 1E1LA 1PXCA 2GR1A 1DP2A 4D03A 2VRLA 3RNMA 1KDGA 3CN8A 2E1MA 1MXTA 1IUXA 2WP5A 1DJNA 3P1WA 1PXAA 2J3NA 5J60A 3CGCA 3KA7A 2IVEA 4AP3A 1OJDA 4Y4LA 5HYMA 3OLHA 3GSIA 4IVMB 1S2QA 2XLUA 1NENA 5KMPA 4WH9A 2GMHA 3SM8A 4U8OA 5JCLA 3BI4A 3SGLA 4EIPA 2UZQA 1CJCA 2WOWA 2WPEA 3AD9B 4HB9A 2A87A 4NTEA 3HYWA 2JTSA 1Q1RA 3ALLA 4II3A 5EBKA 4A65A 4B69A 3DJGX 1N4UA 2QA2A 3AECA 1ZKQA 4P9SA 2OAMA 4HA6A 1KSUA 4K2XA 2WS3A 2YG3A 3CGEA 4H4VA 5BRTA 3FLHA 1OJ9A 3L1RA 3NN6X 3UTHA 4K5RA 1C25A 2NVKX 3QSEA 3URHA 4DSHA 1QB0A 3QSMA 3AEEA 4AT0A 2XVFA 3M13A 3UTGA 3UCLA 3BI2A 2R46A 1TDKA 2WDRA 3I2VA 3UKAA 2IFDA 1F6MA 1GNDA 1TYPA 4MJWA 4YWOA 1KF6A 2XLSA 1QO8A 1H7WA 2CDUA 3ALJA 1IUSA 1SEZA 4Z44A 3DK4A 1GERA 2RGJA 4H4ZA 3AE1A 1CWRA 2BCGG 3ICSA 2WDVA 4A9WA 3IPPA 1GETA 3K7QX 3T14A 4CCQA 4RG4A 1F8RA 3BNUA 1REOA 2H88A 3DGZA 2XFQA 2XVEA 2XYOA 4RSLA 4XWZA 1XHCA 2WU2A 1E6EA 1KFYA 3KU9A 3G5QA 4JGTA 1AOGA 5FS8A 1FEBA 4B67A 4UDPA 4C5OA 1LV0A 2BC1A 1YKJA 2DKHA 5LAOA 4Y4MA 2GEWA 3DMEA 1UARA 3UTFA 3GK5A 1GRFA 3DJJA 3K7TA 1LJ1A 2C66A 3AE5A 4OPTA 1NHPA 2V3AA 1N4VA 1PBBA 3CGBA 4JDRA 1YQ3A 4FX9A 2C70A 4Z24A 2FBWA 4Z43A 2WU5A 3QSSA 2EQ8A 1NAAA 1ZMCA 2VQBA 1TDFA 2JBVA 4FK1C 1YMLA 1DOBA 4RG3A 2YM2A 3IWHA 2GR3A 3CPHG 5LV9A 4U8NA 2B7SA 4B66A 1H81A 4NTCA 4J33A 3LADA 1X31B 1NHRA 2FJAA 5KMSA 1GN0A 3QVPA 1PJ6A 1KNPA 3NH3X 3FIMB 3BHKA 1EL8A 1BOHA 2ARDA 2I0ZA 1Z6LA 1WHBA 4DNAA 4H4YA 1EL7A 3RHAA 4OCGA 3ABVA 1ZK7A 1ZOVA 3GD3A 3UP4A 4BK3A 3M0OA 2WP6A 2WHDA 2B76A 3ATQA 1M6IA 3KPKA 4Z2RA 2C3DA 5JCNA 2H89A 3AE4A 2WEUA 1QJDA 3HYVA 3GYJA 1FEAA 1YS0A 3UKFA 3AAXA 4IA5A 3HYXA 5KXJA 4TLZA 4Z26A 3UOXA 2ACZA 5U1OA 5KVHA 1OJAA 2CULA 2MRMA 1Q1WA 1NPXA 4CBQA 1FL2A 2Q0LA 1CL0A 3NK0X 2BK5A 4K7ZA 4OPGA 4ZN0A 2TMDA 3KVEA 2MOLA 5HBOA 1H84A 4B63A 4CY6A 4LU6A 3IF9A 4LA1A 1ZP0A 1LQTA 5LAMA 2J6PA 2RABA 5FS9A 1S3EA 2BYBA 1PBCA 2CVJA 2GF3A 3B3RA 2R4JA 3FS5A 4N9XA 2TPRA 1Q9IA 2B9XA 1K0LA 3AEBA 3C4NA 1OKGA 1ZX9A 3NYFA 1GALA 1NG3A 4XXGA 4BURA 4EQXA 4H50A 4EQRA 3NK2X 2IIDA 4TM1A 1N4WA 2JKCA 4A6NB 2VZ2A 1KSSA 3NN0X 1CF3A 2GRTA 3AE2A 2YQUA 2X8HA 1NHQA 4YT0A 2XCGA 2EG4B 3EF6A 3LOVA 4F67A 1H83A 3T2YA 1VG0A 1EL9A 1ZDLA 1ZMDA 2QAEA 3CIRA 4TLXA 4II2A 5HPAA 3AE6A 1ZOYA 4J2WA 3P9UA 1BGJA 1PJ5A 5BULA 1GOSA 1F8WA 1IUTA 3ADAB 1JOAA 3NYCA 2WBAA 2V5ZA 5HBPA 2Q7VA 5KNLA 1D4CA 1FOHA 1NG4A 1PJ7A 2BXSA 3UKQA 2C72A 2DCQA 4X9MA 1L0VA 3G5RA 3IHGA 3C96A 2YG4A 4JY2A 3P4RA 1E0CA 5HXIA 2GR2A 2X3NA 3ZDNA 2OA1A 1V59A 1H7XA 3AE7A 3NK1X 4NEWA 3LB8A 2JAEA 3GRSA 1DODA 3G5JA 2C3CA 4H2RA 2GWFA 4X4JA 1YT8A 1COYA 4GRTA 4AOXA 3D1CA 2IFVA 3ITJA 2BK4A 1N1PA 2A8XA 4ZCCA 3F8PA 3MZZA 1O95A 3EAOA 4YTMA 4A7AA 3LZWA 4GDPA 3KD9A 5BVAA 3QJ4A 2EQ7A 1JRXA 1JU2A 1OJTA 3I3LA 3UKPA 1VQWA 3CMMA 4H2QA 1RP0A 3UTEA 4H4UA 1URHA 1LQUA 3ICTA 1XPQA 3AB1A 2XVJA 4APNA 4GUVA 1H4MX 1H86A 4JN9A 2BCPA 2WPCA 4FK1A 2XLTA 4D04A 3M12A 1BKWA 3P4SA 1W4XA 3FPZA 2VVLA 4AT2A 1E1KA 3DH9A 4YKFA 2ZZBA 2R9ZA 2R0PA 3F8RA 4G74A 2DKIA 3NLCA 4EQSA 3RP7A 5FS7A 3T2KA 2WLXA 4YKGA 2APGA 2WLRA 3SZFA 2XDOA 4B68A 3F8DA 1CWSA 1O5WA 3LJPA 2GAHB 4EM4A 3P4PA 5C3JA 4B1BA 1E39A 3EPTA 4H4QA 4U8MA 1BGNA 1FECA 2VVLG 2XFNA 1VEEA 3P3AA 4JNQA 3WE0A 3T2ZA 2GR0A 3S5WA 1GRAA 4A6NA 2BS4A 3NT6A 3NTAA 1ZY8A 2X99A 4NEVA 3AYLA 1CC4A 3KKJA 3L8KA 4Y4NA 2EG4A 3AD8B 4NTDA 4U8IA 4C3XA 3FG2P 3SX6A 3II4A 2KL3A 1K4QA 1PBEA 1PHHA 2YWLA 2BK3A 3CNSA 3G5SA 3CNTA 2JB1A 3OZ2A 4H7UA 3AWIA 5FMHA 3IPOA 2FJEA 4H4PA 3V3NA 3AEAA 2BA9A 5C2TA 1CBOA 2XFUA 1TDOA 1BOIA 3RP6A 4EM3A 4PABA 1CWTA 4GAPA 1E1MA 4U2LA 3UOYA 3I6DA 1IUUA 2WQYA 1D5TA 3ICRA 2A89A 4CCRA 2C67A 1YM9A 1Y56B 5U63A 4J36A 2WOIA 1CHUA 1PDHA 1PXBA 3SZWA 2YR5A 1GRTA 4BJZA 1F8SA 4BK2A 1L9EA 2BABA 4EMIA 5GSNA 4B64A 3AYIA 2EG3A 3DJDA 3UKHA 2YLWA 3BNMA 4YSZA 4KPRA 3R2UA 1CJ2A 1T3KA 4GDEA 4A5LA 2WOVA 2GQWA 4J34A 1GXFA 2BXRA 3SZ0A 4J57A 3BHFA 4ZCDA 3TG3A 4H4RA 4ADWA 2Z5XA 4USRA 1DOEA 2WESA 5IPYA 1JNRA 2YLTA 4DGKA 2GVCA 3SYIA 2YG6A 3AEFA 4BJYA 2JK6A 4OPCA 2VVMA 5KRQA 3R9UA 1JRZA 3IC9A 4U8PA 4H4SA 5TR3A 2JB3A 1PBFA 4GR1A 4K8DA 1VDCA 4WCTA 1M64A 4WX1A 4UP3A 1B4VA 1VRQB 1GV4A 3B6DA 4AP1A 2GH5A 1OJCA 5KOWA 1GMXA 3GDPA 2VRMA 3DK8A 4GCMA 4PAAA 4G9KA 4U8LA 2QA1A 1HZMA 1D4EA 5JCKA 3V3OA 3TG1B 2F5ZA 4K5SA 4YXDA 2BS3A 3SFDA 3ILMA 2FJDA 3NTDA 2YLSA 1GTEA 2VQ7A 1ORBA 4UDRA 2BACA 3T31A 4NNJA 4C77A 1CC2A 2OLNA 3PVCA 4EMJA 4AOSA 3AAYA 3CNJA 1CJ3A 3SQPA 4X9NA 3NHOX 3GRTA 2YVGA 4BV6A 3CTYA 4TM3A 1WV9A 1PN0A 1RHDA 1YQZA 4G73A 3AEDA 4H2NA 1LVLA 3CNDA 1Y0PA 2OLOA 1GREA 5ER0A 3UOZA 3KLJA 2R45A 4Z2UA 3FNJA 3DK9A 1PBDA 5U25A 3T37A 1TDNA 3DJEA 3GD4A 2YLZA 3CNPA 3FMWA 1GRHA 5JCMA 3H4KA 2Z5YA 1GT8A 2WETA 3VR8A 2R0CA 3IHMA 5CQFA 4BK1A 4U2SA 3SY4A 1BZLA 2B7RA 4K22A 5KWFA 2QCUA 3TP9A 3QFAA 1GSNA 3LXDA 2XFOA 1RHSA 1Y56A 3GMCA 1S3BA 3P4QA 1O94A 1JEHA 4TM4A 1GEUA 2JTRA 5EB4A 4CNKA 1KNRA 2C65A 2XFPA 3V76A 4KX6A 2A2KA 3K9RA 2X8GA 2C7GA 3AXBA 4NZHA 1GRBA 3AE3A 5EOWA 3D8XA 5HHFA 4OPLA 4IV9A 4H4WA 3NHVA 2WP9A 5M0ZA 4Z25A 2YLXA 3KPFA 4GAVA 3UKLA 4H4XA 1H6VA 4GF7A 1CC6A 4B65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H82 A;  3AEG A;  2OUC A;  2B9Y A;  1HYU A;  2NPX A;  1B37 A;  3ZYX A;  1E7P A;  4A79 A;  1JNZ A;  5L46 A;  1F3P A;  3HZU A;  2R4E A;  2VOU A;  1BF3 A;  4J56 A;  3K7M X;  5FS6 A;  4EMW A;  1NDA A;  3QVR A;  4OPI A;  4REK A;  2K0Z A;  3UTN X;  1UKV G;  1P2E A;  3RED A;  1K0I A;  1EL5 A;  3AE8 A;  3Q9T A;  3BI5 A;  2YAU A;  2B9W A;  3CPJ G;  1VG9 A;  2OAL A;  2UZZ A;  2XVH A;  3ALM A;  4CRT A;  3GWD A;  4DSG A;  1ONF A;  1P2H A;  2C73 A;  2BC0 A;  3LZX A;  4J31 A;  1MOK A;  4C3Y A;  2GB0 A;  2X50 A;  1D4D A;  1D7L A;  3UKK A;  3QFB A;  4IVO B;  1JRY A;  1YMK A;  4ICY A;  3GWF A;  3VR9 A;  4C74 A;  1B8S A;  1L9D A;  3Q6J A;  2BS2 A;  5GRT A;  4EIQ A;  3HZL A;  5IQ4 A;  1LTX R;  4XWR A;  2JB2 A;  1YMD A;  1FCD A;  4JNA A;  2AQJ A;  4WH7 A;  2V60 A;  2YM1 A;  5HY5 A;  3IWA A;  2JTQ A;  1EBD A;  2VSW A;  2Q0K A;  3NYE A;  3VQR A;  3D1P A;  1ELI A;  3K30 A;  5HBL A;  2RGO A;  1PS9 A;  4LII A;  4TM0 A;  3RP8 A;  2IVD A;  5EB5 A;  3COX A;  4IA6 A;  2Q6U A;  1GTH A;  3O3W A;  2V6O A;  5JCI A;  2C75 A;  3AYJ A;  3NNE A;  2ORA A;  4M52 A;  3FOJ A;  4O5Q A;  3UOV A;  4YSH A;  4YTP A;  4Z2T A;  1DNC A;  3H8I A;  4ECH A;  3ATR A;  3AD7 B;  1RYI A;  1LPF A;  4USQ A;  3ISH A;  4I59 A;  5CKU A;  4U8J A;  3S61 A;  3H8L A;  1TDE A;  3VRB A;  4U2T A;  1TQ1 A;  2FSX A;  1QLB A;  2YVF A;  1DOC A;  2WDQ A;  2V61 A;  1CJ4 A;  2PHH A;  3OC4 A;  4OPU A;  1E1N A;  2HHG A;  3PO7 A;  1B5Q A;  2YLR A;  3DGH A;  3VRD B;  5DBJ A;  4A99 A;  4OPD A;  4FDC B;  4UDQ A;  2W0H A;  3GDN A;  2YVJ A;  5KOX A;  5IQ1 A;  2AR8 A;  2CFY A;  2X8C A;  3C4A A;  2GV8 A;  3OP3 A;  3GYI A;  2GAG B;  5BUK A;  5J7X A;  3CGD A;  1GPE A;  2ZBW A;  3E1T A;  2HQM A;  3NG7 X;  4EQW A;  2YG5 A;  1YQ4 A;  1DJQ A;  1K0J A;  1MO9 A;  2Y6Q A;  1IUV A;  2GMJ A;  3HIX A;  2ZZ0 A;  3AE9 A;  1TRB A;  2EQ9 A;  3HWI A;  2RGH A;  4O5U A;  3VRA A;  4JQ9 A;  3EAN A;  3F4A A;  1BWC A;  4YSY A;  2E4G A;  2C64 A;  1GRG A;  2PYX A;  2YR6 A;  4E0V A;  2E5V A;  3I3U A;  3CPI G;  1GES A;  1S2Y A;  3GMB A;  3NRN A;  5KVI A;  3FBS A;  4YSX A;  1NHS A;  2YG7 A;  4I58 A;  2XVI A;  3O0H A;  3DA1 A;  1YY5 A;  3SFE A;  4CY8 A;  3JSK A;  1RSG A;  4H4T A;  3UP5 A;  2O9Z A;  2Y6R A;  2V3B A;  2ZZC A;  1DXL A;  1TYT A;  3NKS A;  4CNJ A;  1D7Y A;  2AAQ A;  3NGC X;  1H4K X;  1XDI A;  4OVI A;  3NIX A;  3PS9 A;  2XLR A;  1L9C A;  1NEK A;  2XLP A;  4U8K A;  2WPF A;  2YR4 A;  4YTN A;  5HBQ A;  2R0G A;  5M10 A;  2C76 A;  1QXN A;  2GQF A;  1IJH A;  1IUW A;  1XAN A;  4JY3 A;  2MOI A;  2FJB A;  2EQ6 A;  4H2P A;  1E1L A;  1PXC A;  2GR1 A;  1DP2 A;  4D03 A;  2VRL A;  3RNM A;  1KDG A;  3CN8 A;  2E1M A;  1MXT A;  1IUX A;  2WP5 A;  1DJN A;  3P1W A;  1PXA A;  2J3N A;  5J60 A;  3CGC A;  3KA7 A;  2IVE A;  4AP3 A;  1OJD A;  4Y4L A;  5HYM A;  3OLH A;  3GSI A;  4IVM B;  1S2Q A;  2XLU A;  1NEN A;  4WH9 A;  2GMH A;  3SM8 A;  4U8O A;  5JCL A;  3BI4 A;  3SGL A;  4EIP A;  2UZQ A;  1CJC A;  2WOW A;  2WPE A;  3AD9 B;  4HB9 A;  2A87 A;  4NTE A;  2JTS A;  1Q1R A;  3ALL A;  4A65 A;  5EBK A;  4B69 A;  3DJG X;  1N4U A;  2QA2 A;  3AEC A;  1ZKQ A;  4P9S A;  2OAM A;  4HA6 A;  1KSU A;  4K2X A;  2WS3 A;  2YG3 A;  3CGE A;  4H4V A;  5BRT A;  3FLH A;  1OJ9 A;  3L1R A;  3NN6 X;  3UTH A;  4K5R A;  1C25 A;  2NVK X;  3QSE A;  3URH A;  4DSH A;  1QB0 A;  3QSM A;  3AEE A;  4AT0 A;  2XVF A;  3M13 A;  3UTG A;  3UCL A;  3BI2 A;  2R46 A;  1TDK A;  2WDR A;  3I2V A;  3UKA A;  2IFD A;  1F6M A;  1GND A;  1TYP A;  4MJW A;  4YWO A;  1KF6 A;  2XLS A;  1QO8 A;  1H7W A;  2CDU A;  3ALJ A;  1IUS A;  1SEZ A;  4Z44 A;  3DK4 A;  1GER A;  2RGJ A;  4H4Z A;  3AE1 A;  1CWR A;  2BCG G;  3ICS A;  2WDV A;  4A9W A;  3IPP A;  1GET A;  3K7Q X;  4CCQ A;  4RG4 A;  1F8R A;  3BNU A;  1REO A;  2H88 A;  3DGZ A;  2XFQ A;  2XVE A;  2XYO A;  4RSL A;  4XWZ A;  1XHC A;  2WU2 A;  1E6E A;  1KFY A;  3KU9 A;  3G5Q A;  4JGT A;  1AOG A;  5FS8 A;  1FEB A;  4B67 A;  4UDP A;  4C5O A;  1LV0 A;  2BC1 A;  1YKJ A;  2DKH A;  5LAO A;  4Y4M A;  2GEW A;  3DME A;  1UAR A;  3UTF A;  3GK5 A;  1GRF A;  3DJJ A;  3K7T A;  1LJ1 A;  2C66 A;  3AE5 A;  4OPT A;  1NHP A;  2V3A A;  1N4V A;  1PBB A;  3CGB A;  4JDR A;  1YQ3 A;  4FX9 A;  2C70 A;  4Z24 A;  2FBW A;  4Z43 A;  2WU5 A;  3QSS A;  2EQ8 A;  1NAA A;  1ZMC A;  2VQB A;  1TDF A;  2JBV A;  4FK1 C;  1YML A;  1DOB A;  4RG3 A;  2YM2 A;  3IWH A;  2GR3 A;  3CPH G;  5LV9 A;  4U8N A;  2B7S A;  4B66 A;  1H81 A;  4NTC A;  4J33 A;  3LAD A;  1X31 B;  1NHR A;  2FJA A;  1GN0 A;  3QVP A;  1PJ6 A;  1KNP A;  3NH3 X;  3FIM B;  3BHK A;  1EL8 A;  1BOH A;  2ARD A;  2I0Z A;  1Z6L A;  1WHB A;  4DNA A;  4H4Y A;  1EL7 A;  3RHA A;  4OCG A;  3ABV A;  1ZK7 A;  1ZOV A;  3GD3 A;  3UP4 A;  4BK3 A;  3M0O A;  2WP6 A;  2WHD A;  2B76 A;  3ATQ A;  1M6I A;  4Z2R A;  5JCN A;  2C3D A;  2H89 A;  3AE4 A;  2WEU A;  1QJD A;  3GYJ A;  1FEA A;  1YS0 A;  3UKF A;  3AAX A;  4IA5 A;  5KXJ A;  4TLZ A;  4Z26 A;  3UOX A;  2ACZ A;  5U1O A;  5KVH A;  1OJA A;  2CUL A;  2MRM A;  1Q1W A;  1NPX A;  4CBQ A;  1FL2 A;  2Q0L A;  1CL0 A;  3NK0 X;  2BK5 A;  4K7Z A;  4OPG A;  4ZN0 A;  2TMD A;  3KVE A;  2MOL A;  5HBO A;  1H84 A;  4B63 A;  4CY6 A;  4LU6 A;  3IF9 A;  4LA1 A;  1ZP0 A;  1LQT A;  5LAM A;  2J6P A;  2RAB A;  5FS9 A;  1S3E A;  2BYB A;  1PBC A;  2CVJ A;  2GF3 A;  3B3R A;  2R4J A;  3FS5 A;  4N9X A;  2TPR A;  1Q9I A;  2B9X A;  1K0L A;  3AEB A;  3C4N A;  1OKG A;  1ZX9 A;  3NYF A;  1GAL A;  1NG3 A;  4XXG A;  4BUR A;  4EQX A;  4H50 A;  4EQR A;  3NK2 X;  2IID A;  4TM1 A;  1N4W A;  2JKC A;  4A6N B;  2VZ2 A;  1KSS A;  3NN0 X;  1CF3 A;  2GRT A;  3AE2 A;  2YQU A;  2X8H A;  1NHQ A;  4YT0 A;  2XCG A;  2EG4 B;  3EF6 A;  3LOV A;  4F67 A;  1H83 A;  1VG0 A;  1EL9 A;  1ZDL A;  1ZMD A;  2QAE A;  3CIR A;  4TLX A;  5HPA A;  3AE6 A;  1ZOY A;  4J2W A;  3P9U A;  1BGJ A;  1PJ5 A;  5BUL A;  1GOS A;  1F8W A;  1IUT A;  3ADA B;  1JOA A;  3NYC A;  2WBA A;  2V5Z A;  5HBP A;  2Q7V A;  1D4C A;  1FOH A;  1NG4 A;  1PJ7 A;  2BXS A;  3UKQ A;  2C72 A;  2DCQ A;  4X9M A;  1L0V A;  3G5R A;  3IHG A;  3C96 A;  2YG4 A;  4JY2 A;  3P4R A;  1E0C A;  5HXI A;  2GR2 A;  2X3N A;  3ZDN A;  2OA1 A;  1V59 A;  1H7X A;  3AE7 A;  3NK1 X;  4NEW A;  3LB8 A;  2JAE A;  3GRS A;  1DOD A;  3G5J A;  2C3C A;  4H2R A;  2GWF A;  4X4J A;  1YT8 A;  1COY A;  4GRT A;  4AOX A;  3D1C A;  2IFV A;  3ITJ A;  2BK4 A;  1N1P A;  2A8X A;  4ZCC A;  3F8P A;  3MZZ A;  1O95 A;  3EAO A;  4YTM A;  4A7A A;  3LZW A;  4GDP A;  3KD9 A;  5BVA A;  3QJ4 A;  2EQ7 A;  1JRX A;  1JU2 A;  1OJT A;  3I3L A;  3UKP A;  1VQW A;  4H2Q A;  1RP0 A;  3UTE A;  4H4U A;  1URH A;  1LQU A;  3ICT A;  1XPQ A;  3AB1 A;  2XVJ A;  4APN A;  4GUV A;  1H4M X;  1H86 A;  4JN9 A;  2BCP A;  2WPC A;  4FK1 A;  2XLT A;  4D04 A;  3M12 A;  1BKW A;  3P4S A;  1W4X A;  3FPZ A;  2VVL A;  4AT2 A;  1E1K A;  3DH9 A;  4YKF A;  2ZZB A;  2R9Z A;  2R0P A;  3F8R A;  2DKI A;  3NLC A;  4EQS A;  3RP7 A;  5FS7 A;  2WLX A;  4YKG A;  2APG A;  2WLR A;  2XDO A;  4B68 A;  3F8D A;  1CWS A;  1O5W A;  3LJP A;  2GAH B;  4EM4 A;  3P4P A;  5C3J A;  4B1B A;  1E39 A;  3EPT A;  4H4Q A;  4U8M A;  1BGN A;  1FEC A;  2VVL G;  2XFN A;  1VEE A;  3P3A A;  4JNQ A;  3WE0 A;  2GR0 A;  3S5W A;  1GRA A;  4A6N A;  2BS4 A;  3NT6 A;  3NTA A;  1ZY8 A;  2X99 A;  4NEV A;  3AYL A;  1CC4 A;  3KKJ A;  3L8K A;  4Y4N A;  2EG4 A;  3AD8 B;  4NTD A;  4U8I A;  4C3X A;  3FG2 P;  3II4 A;  2KL3 A;  1K4Q A;  1PBE A;  1PHH A;  2YWL A;  2BK3 A;  3CNS A;  3G5S A;  3CNT A;  2JB1 A;  3OZ2 A;  4H7U A;  3AWI A;  5FMH A;  3IPO A;  2FJE A;  4H4P A;  3V3N A;  3AEA A;  2BA9 A;  5C2T A;  1CBO A;  2XFU A;  1TDO A;  1BOI A;  3RP6 A;  4EM3 A;  4PAB A;  1CWT A;  3UOY A;  1E1M A;  4U2L A;  3I6D A;  1IUU A;  2WQY A;  1D5T A;  3ICR A;  2A89 A;  4CCR A;  2C67 A;  1YM9 A;  1Y56 B;  5U63 A;  4J36 A;  2WOI A;  1CHU A;  1PDH A;  1PXB A;  2YR5 A;  1GRT A;  4BJZ A;  1F8S A;  4BK2 A;  1L9E A;  2BAB A;  4EMI A;  5GSN A;  4B64 A;  3AYI A;  2EG3 A;  3DJD A;  3UKH A;  2YLW A;  3BNM A;  4YSZ A;  4KPR A;  3R2U A;  1CJ2 A;  1T3K A;  4GDE A;  4A5L A;  2WOV A;  2GQW A;  4J34 A;  1GXF A;  2BXR A;  4J57 A;  3BHF A;  4ZCD A;  3TG3 A;  4H4R A;  4ADW A;  2Z5X A;  4USR A;  1DOE A;  2WES A;  5IPY A;  1JNR A;  2YLT A;  4DGK A;  2GVC A;  2YG6 A;  3AEF A;  4BJY A;  2JK6 A;  4OPC A;  2VVM A;  5KRQ A;  3R9U A;  1JRZ A;  3IC9 A;  4U8P A;  4H4S A;  5TR3 A;  2JB3 A;  1PBF A;  4GR1 A;  4K8D A;  1VDC A;  4WCT A;  1M64 A;  4WX1 A;  4UP3 A;  1B4V A;  1VRQ B;  1GV4 A;  3B6D A;  4AP1 A;  2GH5 A;  1OJC A;  5KOW A;  1GMX A;  3GDP A;  2VRM A;  3DK8 A;  4GCM A;  4PAA A;  4U8L A;  2QA1 A;  1HZM A;  1D4E A;  5JCK A;  3V3O A;  3TG1 B;  2F5Z A;  4K5S A;  4YXD A;  2BS3 A;  3SFD A;  3ILM A;  2FJD A;  3NTD A;  2YLS A;  1GTE A;  2VQ7 A;  1ORB A;  4UDR A;  2BAC A;  4C77 A;  4EMJ A;  1CC2 A;  2OLN A;  3PVC A;  4AOS A;  3AAY A;  3CNJ A;  1CJ3 A;  3SQP A;  4X9N A;  3NHO X;  3GRT A;  2YVG A;  4BV6 A;  3CTY A;  4TM3 A;  1WV9 A;  1PN0 A;  1RHD A;  1YQZ A;  3AED A;  4H2N A;  1LVL A;  3CND A;  1Y0P A;  2OLO A;  1GRE A;  5ER0 A;  3UOZ A;  3KLJ A;  2R45 A;  4Z2U A;  3FNJ A;  3DK9 A;  1PBD A;  5U25 A;  3T37 A;  1TDN A;  3DJE A;  3GD4 A;  2YLZ A;  3CNP A;  3FMW A;  1GRH A;  5JCM A;  3H4K A;  2Z5Y A;  1GT8 A;  2WET A;  3VR8 A;  2R0C A;  3IHM A;  5CQF A;  4BK1 A;  4U2S A;  1BZL A;  2B7R A;  4K22 A;  5KWF A;  2QCU A;  3TP9 A;  3QFA A;  1GSN A;  3LXD A;  2XFO A;  1RHS A;  1Y56 A;  3GMC A;  1S3B A;  3P4Q A;  1O94 A;  1JEH A;  4TM4 A;  1GEU A;  2JTR A;  5EB4 A;  4CNK A;  1KNR A;  2C65 A;  2XFP A;  3V76 A;  4KX6 A;  2A2K A;  3K9R A;  2X8G A;  2C7G A;  3AXB A;  4NZH A;  1GRB A;  3AE3 A;  5EOW A;  3D8X A;  5HHF A;  4OPL A;  4IV9 A;  4H4W A;  3NHV A;  2WP9 A;  5M0Z A;  4Z25 A;  2YLX A;  3KPF A;  3UKL A;  4H4X A;  1H6V A;  4GF7 A;  1CC6 A;  4B65 A; 
#chains in the Genus database with same CATH topology
 1H82 A;  3AEG A;  2OUC A;  2B9Y A;  1HYU A;  2NPX A;  1B37 A;  3ZYX A;  1E7P A;  4A79 A;  1JNZ A;  5L46 A;  1F3P A;  3HZU A;  2R4E A;  2VOU A;  1BF3 A;  4J56 A;  3K7M X;  4G6G A;  5FS6 A;  4EMW A;  1NDA A;  3QVR A;  4OPI A;  4REK A;  2K0Z A;  3UTN X;  1UKV G;  1P2E A;  3RED A;  1K0I A;  1EL5 A;  3AE8 A;  3Q9T A;  3BI5 A;  2YAU A;  2B9W A;  3CPJ G;  1VG9 A;  2OAL A;  2UZZ A;  2XVH A;  3ALM A;  4CRT A;  4G6H A;  3GWD A;  4DSG A;  1ONF A;  1P2H A;  2C73 A;  2BC0 A;  3LZX A;  4J31 A;  1MOK A;  4C3Y A;  2GB0 A;  2X50 A;  1D4D A;  1D7L A;  3UKK A;  3QFB A;  4IVO B;  1JRY A;  1YMK A;  4ICY A;  3GWF A;  5KMQ A;  3VR9 A;  1B8S A;  1L9D A;  3Q6J A;  2BS2 A;  5GRT A;  4C74 A;  3HZL A;  4EIQ A;  1LTX R;  4XWR A;  2JB2 A;  5IQ4 A;  1YMD A;  1FCD A;  4JNA A;  5KMR A;  2AQJ A;  4WH7 A;  2V60 A;  2YM1 A;  5HY5 A;  3IWA A;  2JTQ A;  1EBD A;  2VSW A;  2Q0K A;  3NYE A;  3VQR A;  3D1P A;  1ELI A;  3K30 A;  5HBL A;  2RGO A;  1PS9 A;  4LII A;  4TM0 A;  3RP8 A;  2IVD A;  5EB5 A;  3COX A;  4IA6 A;  2Q6U A;  1GTH A;  3O3W A;  2V6O A;  5JCI A;  2C75 A;  3AYJ A;  3NNE A;  2ORA A;  4M52 A;  3FOJ A;  4O5Q A;  3UOV A;  4YSH A;  4YTP A;  4Z2T A;  1DNC A;  3H8I A;  4ECH A;  3ATR A;  3SZC A;  3AD7 B;  1RYI A;  1LPF A;  4USQ A;  3ISH A;  4I59 A;  5CKU A;  4U8J A;  3S61 A;  3H8L A;  1TDE A;  3VRB A;  4U2T A;  1TQ1 A;  2FSX A;  1QLB A;  2YVF A;  1DOC A;  2WDQ A;  2V61 A;  1CJ4 A;  2PHH A;  3OC4 A;  4OPU A;  1E1N A;  2HHG A;  3PO7 A;  1B5Q A;  2YLR A;  3DGH A;  3VRD B;  5DBJ A;  4A99 A;  4OPD A;  4FDC B;  4UDQ A;  2W0H A;  2BRY A;  3GDN A;  2YVJ A;  5KOX A;  5IQ1 A;  2AR8 A;  2BRA A;  2CFY A;  2X8C A;  3C4A A;  2GV8 A;  3OP3 A;  3GYI A;  2GAG B;  5BUK A;  5J7X A;  3CGD A;  1GPE A;  2ZBW A;  3E1T A;  2HQM A;  3NG7 X;  3T0K A;  4EQW A;  2YG5 A;  1YQ4 A;  1DJQ A;  1K0J A;  1MO9 A;  2Y6Q A;  1IUV A;  2GMJ A;  3HIX A;  2ZZ0 A;  3AE9 A;  1TRB A;  2EQ9 A;  3HWI A;  2RGH A;  4O5U A;  3VRA A;  4JQ9 A;  3EAN A;  3F4A A;  1BWC A;  4YSY A;  2E4G A;  2C64 A;  1GRG A;  2PYX A;  2YR6 A;  4E0V A;  2E5V A;  3I3U A;  3CPI G;  1GES A;  1S2Y A;  3GMB A;  3NRN A;  5KVI A;  3FBS A;  4YSX A;  1NHS A;  2YG7 A;  3GYX A;  4I58 A;  2XVI A;  3O0H A;  3DA1 A;  1YY5 A;  3SFE A;  4CY8 A;  3JSK A;  1RSG A;  4H4T A;  3UP5 A;  4NWZ A;  2O9Z A;  2Y6R A;  2V3B A;  2ZZC A;  1DXL A;  1TYT A;  3NKS A;  4CNJ A;  1D7Y A;  2AAQ A;  3NGC X;  1H4K X;  2C4C A;  1XDI A;  4OVI A;  3NIX A;  3PS9 A;  2XLR A;  1L9C A;  1NEK A;  2XLP A;  4U8K A;  2WPF A;  2YR4 A;  4YTN A;  5HBQ A;  2R0G A;  5M10 A;  2C76 A;  3SXI A;  1QXN A;  2GQF A;  1IJH A;  1IUW A;  1XAN A;  4JY3 A;  2MOI A;  2FJB A;  2EQ6 A;  4H2P A;  1E1L A;  1PXC A;  2GR1 A;  1DP2 A;  4D03 A;  2VRL A;  3RNM A;  1KDG A;  3CN8 A;  2E1M A;  1MXT A;  1IUX A;  2WP5 A;  1DJN A;  3P1W A;  1PXA A;  2J3N A;  5J60 A;  3CGC A;  3KA7 A;  2IVE A;  4AP3 A;  1OJD A;  4Y4L A;  5HYM A;  3OLH A;  3GSI A;  4IVM B;  1S2Q A;  2XLU A;  1NEN A;  5KMP A;  4WH9 A;  2GMH A;  3SM8 A;  4U8O A;  5JCL A;  3BI4 A;  3SGL A;  4EIP A;  2UZQ A;  1CJC A;  2WOW A;  2WPE A;  3AD9 B;  4HB9 A;  2A87 A;  4NTE A;  3HYW A;  2JTS A;  1Q1R A;  3ALL A;  4II3 A;  5EBK A;  4A65 A;  4B69 A;  3DJG X;  1N4U A;  2QA2 A;  3AEC A;  1ZKQ A;  4P9S A;  2OAM A;  4HA6 A;  1KSU A;  4K2X A;  2WS3 A;  2YG3 A;  3CGE A;  4H4V A;  5BRT A;  3FLH A;  1OJ9 A;  3L1R A;  3NN6 X;  3UTH A;  4K5R A;  1C25 A;  2NVK X;  3QSE A;  3URH A;  4DSH A;  1QB0 A;  3QSM A;  3AEE A;  4AT0 A;  2XVF A;  3M13 A;  3UTG A;  3UCL A;  3BI2 A;  2R46 A;  1TDK A;  2WDR A;  3I2V A;  3UKA A;  2IFD A;  1F6M A;  1GND A;  1TYP A;  4MJW A;  4YWO A;  1KF6 A;  2XLS A;  1QO8 A;  1H7W A;  2CDU A;  3ALJ A;  1IUS A;  1SEZ A;  4Z44 A;  3DK4 A;  1GER A;  2RGJ A;  4H4Z A;  3AE1 A;  1CWR A;  2BCG G;  3ICS A;  2WDV A;  4A9W A;  3IPP A;  1GET A;  3K7Q X;  3T14 A;  4CCQ A;  4RG4 A;  1F8R A;  3BNU A;  1REO A;  2H88 A;  3DGZ A;  2XFQ A;  2XVE A;  2XYO A;  4RSL A;  4XWZ A;  1XHC A;  2WU2 A;  1E6E A;  1KFY A;  3KU9 A;  3G5Q A;  4JGT A;  1AOG A;  5FS8 A;  1FEB A;  4B67 A;  4UDP A;  4C5O A;  1LV0 A;  2BC1 A;  1YKJ A;  2DKH A;  5LAO A;  4Y4M A;  2GEW A;  3DME A;  1UAR A;  3UTF A;  3GK5 A;  1GRF A;  3DJJ A;  3K7T A;  1LJ1 A;  2C66 A;  3AE5 A;  4OPT A;  1NHP A;  2V3A A;  1N4V A;  1PBB A;  3CGB A;  4JDR A;  1YQ3 A;  4FX9 A;  2C70 A;  4Z24 A;  2FBW A;  4Z43 A;  2WU5 A;  3QSS A;  2EQ8 A;  1NAA A;  1ZMC A;  2VQB A;  1TDF A;  2JBV A;  4FK1 C;  1YML A;  1DOB A;  4RG3 A;  2YM2 A;  3IWH A;  2GR3 A;  3CPH G;  5LV9 A;  4U8N A;  2B7S A;  4B66 A;  1H81 A;  4NTC A;  4J33 A;  3LAD A;  1X31 B;  1NHR A;  2FJA A;  5KMS A;  1GN0 A;  3QVP A;  1PJ6 A;  1KNP A;  3NH3 X;  3FIM B;  3BHK A;  1EL8 A;  1BOH A;  2ARD A;  2I0Z A;  1Z6L A;  1WHB A;  4DNA A;  4H4Y A;  1EL7 A;  3RHA A;  4OCG A;  3ABV A;  1ZK7 A;  1ZOV A;  3GD3 A;  3UP4 A;  4BK3 A;  3M0O A;  2WP6 A;  2WHD A;  2B76 A;  3ATQ A;  1M6I A;  3KPK A;  4Z2R A;  2C3D A;  5JCN A;  2H89 A;  3AE4 A;  2WEU A;  1QJD A;  3HYV A;  3GYJ A;  1FEA A;  1YS0 A;  3UKF A;  3AAX A;  4IA5 A;  3HYX A;  5KXJ A;  4TLZ A;  4Z26 A;  3UOX A;  2ACZ A;  5U1O A;  5KVH A;  1OJA A;  2CUL A;  2MRM A;  1Q1W A;  1NPX A;  4CBQ A;  1FL2 A;  2Q0L A;  1CL0 A;  3NK0 X;  2BK5 A;  4K7Z A;  4OPG A;  4ZN0 A;  2TMD A;  3KVE A;  2MOL A;  5HBO A;  1H84 A;  4B63 A;  4CY6 A;  4LU6 A;  3IF9 A;  4LA1 A;  1ZP0 A;  1LQT A;  5LAM A;  2J6P A;  2RAB A;  5FS9 A;  1S3E A;  2BYB A;  1PBC A;  2CVJ A;  2GF3 A;  3B3R A;  2R4J A;  3FS5 A;  4N9X A;  2TPR A;  1Q9I A;  2B9X A;  1K0L A;  3AEB A;  3C4N A;  1OKG A;  1ZX9 A;  3NYF A;  1GAL A;  1NG3 A;  4XXG A;  4BUR A;  4EQX A;  4H50 A;  4EQR A;  3NK2 X;  2IID A;  4TM1 A;  1N4W A;  2JKC A;  4A6N B;  2VZ2 A;  1KSS A;  3NN0 X;  1CF3 A;  2GRT A;  3AE2 A;  2YQU A;  2X8H A;  1NHQ A;  4YT0 A;  2XCG A;  2EG4 B;  3EF6 A;  3LOV A;  4F67 A;  1H83 A;  3T2Y A;  1VG0 A;  1EL9 A;  1ZDL A;  1ZMD A;  2QAE A;  3CIR A;  4TLX A;  4II2 A;  5HPA A;  3AE6 A;  1ZOY A;  4J2W A;  3P9U A;  1BGJ A;  1PJ5 A;  5BUL A;  1GOS A;  2Q82 A;  1F8W A;  1IUT A;  3ADA B;  1JOA A;  3NYC A;  2WBA A;  2V5Z A;  5HBP A;  2Q7V A;  5KNL A;  1D4C A;  1FOH A;  1NG4 A;  1PJ7 A;  2BXS A;  3UKQ A;  2C72 A;  2DCQ A;  4X9M A;  1L0V A;  3G5R A;  3IHG A;  3C96 A;  2YG4 A;  4JY2 A;  3P4R A;  1E0C A;  5HXI A;  2GR2 A;  2X3N A;  3ZDN A;  2OA1 A;  1V59 A;  1H7X A;  3AE7 A;  3NK1 X;  4NEW A;  3LB8 A;  2JAE A;  3GRS A;  1DOD A;  3G5J A;  2C3C A;  4H2R A;  2GWF A;  4X4J A;  1YT8 A;  1COY A;  4GRT A;  4AOX A;  3D1C A;  2IFV A;  3ITJ A;  2BK4 A;  1N1P A;  2A8X A;  4ZCC A;  3F8P A;  3MZZ A;  1O95 A;  3EAO A;  4YTM A;  4A7A A;  3LZW A;  4GDP A;  3KD9 A;  5BVA A;  3QJ4 A;  2EQ7 A;  1JRX A;  1JU2 A;  1OJT A;  3I3L A;  3UKP A;  1VQW A;  3CMM A;  4H2Q A;  1RP0 A;  3UTE A;  4H4U A;  1URH A;  1LQU A;  3ICT A;  1XPQ A;  3AB1 A;  2XVJ A;  4APN A;  4GUV A;  1H4M X;  1H86 A;  4JN9 A;  2BCP A;  2WPC A;  4FK1 A;  2XLT A;  4D04 A;  3M12 A;  1BKW A;  3P4S A;  1W4X A;  3FPZ A;  2VVL A;  4AT2 A;  1E1K A;  3DH9 A;  4YKF A;  2ZZB A;  2R9Z A;  2R0P A;  3F8R A;  4G74 A;  2DKI A;  3NLC A;  4EQS A;  3RP7 A;  5FS7 A;  3T2K A;  2WLX A;  4YKG A;  2APG A;  2WLR A;  3SZF A;  2XDO A;  4B68 A;  3F8D A;  1CWS A;  1O5W A;  3LJP A;  2GAH B;  4EM4 A;  3P4P A;  5C3J A;  4B1B A;  1E39 A;  3EPT A;  4H4Q A;  4U8M A;  1BGN A;  1FEC A;  2VVL G;  2XFN A;  1VEE A;  3P3A A;  4JNQ A;  3WE0 A;  3T2Z A;  2GR0 A;  3S5W A;  1GRA A;  4A6N A;  2BS4 A;  3NT6 A;  3NTA A;  1ZY8 A;  2X99 A;  4NEV A;  3AYL A;  1CC4 A;  3KKJ A;  3L8K A;  4Y4N A;  2EG4 A;  3AD8 B;  4NTD A;  4U8I A;  4C3X A;  3FG2 P;  3SX6 A;  3II4 A;  2KL3 A;  1K4Q A;  1PBE A;  1PHH A;  2YWL A;  2BK3 A;  3CNS A;  3G5S A;  3CNT A;  2JB1 A;  3OZ2 A;  4H7U A;  3AWI A;  5FMH A;  3IPO A;  2FJE A;  4H4P A;  3V3N A;  3AEA A;  2BA9 A;  5C2T A;  1CBO A;  2XFU A;  1TDO A;  1BOI A;  3RP6 A;  4EM3 A;  4PAB A;  1CWT A;  4GAP A;  1E1M A;  4U2L A;  3UOY A;  3I6D A;  1IUU A;  2WQY A;  1D5T A;  3ICR A;  2A89 A;  4CCR A;  2C67 A;  1YM9 A;  1Y56 B;  5U63 A;  4J36 A;  2WOI A;  1CHU A;  1PDH A;  1PXB A;  3SZW A;  2YR5 A;  1GRT A;  4BJZ A;  1F8S A;  4BK2 A;  1L9E A;  2BAB A;  4EMI A;  5GSN A;  4B64 A;  3AYI A;  2EG3 A;  3DJD A;  3UKH A;  2YLW A;  3BNM A;  4YSZ A;  4KPR A;  3R2U A;  1CJ2 A;  1T3K A;  4GDE A;  4A5L A;  2WOV A;  2GQW A;  4J34 A;  1GXF A;  2BXR A;  3SZ0 A;  4J57 A;  3BHF A;  4ZCD A;  3TG3 A;  4H4R A;  4ADW A;  2Z5X A;  4USR A;  1DOE A;  2WES A;  5IPY A;  1JNR A;  2YLT A;  4DGK A;  2GVC A;  3SYI A;  2YG6 A;  3AEF A;  4BJY A;  2JK6 A;  4OPC A;  2VVM A;  5KRQ A;  3R9U A;  1JRZ A;  3IC9 A;  4U8P A;  4H4S A;  5TR3 A;  2JB3 A;  1PBF A;  4GR1 A;  4K8D A;  1VDC A;  4WCT A;  1M64 A;  4WX1 A;  4UP3 A;  1B4V A;  1VRQ B;  1GV4 A;  3B6D A;  4AP1 A;  2GH5 A;  1OJC A;  5KOW A;  1GMX A;  3GDP A;  2VRM A;  3DK8 A;  4GCM A;  4PAA A;  4G9K A;  4U8L A;  2QA1 A;  1HZM A;  1D4E A;  5JCK A;  3V3O A;  3TG1 B;  2F5Z A;  4K5S A;  4YXD A;  2BS3 A;  3SFD A;  3ILM A;  2FJD A;  3NTD A;  2YLS A;  1GTE A;  2VQ7 A;  1ORB A;  4UDR A;  2BAC A;  3T31 A;  4NNJ A;  4C77 A;  1CC2 A;  2OLN A;  3PVC A;  4EMJ A;  4AOS A;  3AAY A;  3CNJ A;  1CJ3 A;  3SQP A;  4X9N A;  3NHO X;  3GRT A;  2YVG A;  4BV6 A;  3CTY A;  4TM3 A;  1WV9 A;  1PN0 A;  1RHD A;  1YQZ A;  4G73 A;  3AED A;  4H2N A;  1LVL A;  3CND A;  1Y0P A;  2OLO A;  1GRE A;  5ER0 A;  3UOZ A;  3KLJ A;  2R45 A;  4Z2U A;  3FNJ A;  3DK9 A;  1PBD A;  5U25 A;  3T37 A;  1TDN A;  3DJE A;  3GD4 A;  2YLZ A;  3CNP A;  3FMW A;  1GRH A;  5JCM A;  3H4K A;  2Z5Y A;  1GT8 A;  2WET A;  3VR8 A;  2R0C A;  3IHM A;  5CQF A;  4BK1 A;  4U2S A;  3SY4 A;  1BZL A;  2B7R A;  4K22 A;  5KWF A;  2QCU A;  3TP9 A;  3QFA A;  1GSN A;  3LXD A;  2XFO A;  1RHS A;  1Y56 A;  3GMC A;  1S3B A;  3P4Q A;  1O94 A;  1JEH A;  4TM4 A;  1GEU A;  2JTR A;  5EB4 A;  4CNK A;  1KNR A;  2C65 A;  2XFP A;  3V76 A;  4KX6 A;  2A2K A;  3K9R A;  2X8G A;  2C7G A;  3AXB A;  4NZH A;  1GRB A;  3AE3 A;  5EOW A;  3D8X A;  5HHF A;  4OPL A;  4IV9 A;  4H4W A;  3NHV A;  2WP9 A;  5M0Z A;  4Z25 A;  2YLX A;  3KPF A;  4GAV A;  3UKL A;  4H4X A;  1H6V A;  4GF7 A;  1CC6 A;  4B65 A; 
#chains in the Genus database with same CATH homology
 1H82 A;  3AEG A;  2OUC A;  2B9Y A;  1HYU A;  2NPX A;  1B37 A;  3ZYX A;  1E7P A;  4A79 A;  1JNZ A;  5L46 A;  1F3P A;  3HZU A;  2R4E A;  2VOU A;  1BF3 A;  4J56 A;  3K7M X;  4G6G A;  5FS6 A;  4EMW A;  1NDA A;  3QVR A;  4OPI A;  4REK A;  2K0Z A;  3UTN X;  1UKV G;  1P2E A;  3RED A;  1K0I A;  1EL5 A;  3AE8 A;  3Q9T A;  3BI5 A;  2YAU A;  2B9W A;  3CPJ G;  1VG9 A;  2OAL A;  2UZZ A;  2XVH A;  3ALM A;  4CRT A;  4G6H A;  3GWD A;  4DSG A;  1ONF A;  1P2H A;  2C73 A;  2BC0 A;  3LZX A;  4J31 A;  1MOK A;  4C3Y A;  2GB0 A;  2X50 A;  1D4D A;  1D7L A;  3UKK A;  3QFB A;  4IVO B;  1JRY A;  1YMK A;  4ICY A;  3GWF A;  5KMQ A;  3VR9 A;  1B8S A;  1L9D A;  3Q6J A;  2BS2 A;  5GRT A;  4C74 A;  3HZL A;  4EIQ A;  1LTX R;  4XWR A;  2JB2 A;  5IQ4 A;  1YMD A;  1FCD A;  4JNA A;  5KMR A;  2AQJ A;  4WH7 A;  2V60 A;  2YM1 A;  5HY5 A;  3IWA A;  2JTQ A;  1EBD A;  2VSW A;  2Q0K A;  3NYE A;  3VQR A;  3D1P A;  1ELI A;  3K30 A;  5HBL A;  2RGO A;  1PS9 A;  4LII A;  4TM0 A;  3RP8 A;  2IVD A;  5EB5 A;  3COX A;  4IA6 A;  2Q6U A;  1GTH A;  3O3W A;  2V6O A;  5JCI A;  2C75 A;  3AYJ A;  3NNE A;  2ORA A;  4M52 A;  3FOJ A;  4O5Q A;  3UOV A;  4YSH A;  4YTP A;  4Z2T A;  1DNC A;  3H8I A;  4ECH A;  3ATR A;  3SZC A;  3AD7 B;  1RYI A;  1LPF A;  4USQ A;  3ISH A;  4I59 A;  5CKU A;  4U8J A;  3S61 A;  3H8L A;  1TDE A;  3VRB A;  4U2T A;  1TQ1 A;  2FSX A;  1QLB A;  2YVF A;  1DOC A;  2WDQ A;  2V61 A;  1CJ4 A;  2PHH A;  3OC4 A;  4OPU A;  1E1N A;  2HHG A;  3PO7 A;  1B5Q A;  2YLR A;  3DGH A;  3VRD B;  5DBJ A;  4A99 A;  4OPD A;  4FDC B;  4UDQ A;  2W0H A;  2BRY A;  3GDN A;  2YVJ A;  5KOX A;  5IQ1 A;  2AR8 A;  2BRA A;  2CFY A;  2X8C A;  3C4A A;  2GV8 A;  3OP3 A;  3GYI A;  2GAG B;  5BUK A;  5J7X A;  3CGD A;  1GPE A;  2ZBW A;  3E1T A;  2HQM A;  3NG7 X;  3T0K A;  4EQW A;  2YG5 A;  1YQ4 A;  1DJQ A;  1K0J A;  1MO9 A;  2Y6Q A;  1IUV A;  2GMJ A;  3HIX A;  2ZZ0 A;  3AE9 A;  1TRB A;  2EQ9 A;  3HWI A;  2RGH A;  4O5U A;  3VRA A;  4JQ9 A;  3EAN A;  3F4A A;  1BWC A;  4YSY A;  2E4G A;  2C64 A;  1GRG A;  2PYX A;  2YR6 A;  4E0V A;  2E5V A;  3I3U A;  3CPI G;  1GES A;  1S2Y A;  3GMB A;  3NRN A;  5KVI A;  3FBS A;  4YSX A;  1NHS A;  2YG7 A;  3GYX A;  4I58 A;  2XVI A;  3O0H A;  3DA1 A;  1YY5 A;  3SFE A;  4CY8 A;  3JSK A;  1RSG A;  4H4T A;  3UP5 A;  4NWZ A;  2O9Z A;  2Y6R A;  2V3B A;  2ZZC A;  1DXL A;  1TYT A;  3NKS A;  4CNJ A;  1D7Y A;  2AAQ A;  3NGC X;  1H4K X;  2C4C A;  1XDI A;  4OVI A;  3NIX A;  3PS9 A;  2XLR A;  1L9C A;  1NEK A;  2XLP A;  4U8K A;  2WPF A;  2YR4 A;  4YTN A;  5HBQ A;  2R0G A;  5M10 A;  2C76 A;  3SXI A;  1QXN A;  2GQF A;  1IJH A;  1IUW A;  1XAN A;  4JY3 A;  2MOI A;  2FJB A;  2EQ6 A;  4H2P A;  1E1L A;  1PXC A;  2GR1 A;  1DP2 A;  4D03 A;  2VRL A;  3RNM A;  1KDG A;  3CN8 A;  2E1M A;  1MXT A;  1IUX A;  2WP5 A;  1DJN A;  3P1W A;  1PXA A;  2J3N A;  5J60 A;  3CGC A;  3KA7 A;  2IVE A;  4AP3 A;  1OJD A;  4Y4L A;  5HYM A;  3OLH A;  3GSI A;  4IVM B;  1S2Q A;  2XLU A;  1NEN A;  5KMP A;  4WH9 A;  2GMH A;  3SM8 A;  4U8O A;  5JCL A;  3BI4 A;  3SGL A;  4EIP A;  2UZQ A;  1CJC A;  2WOW A;  2WPE A;  3AD9 B;  4HB9 A;  2A87 A;  4NTE A;  3HYW A;  2JTS A;  1Q1R A;  3ALL A;  4II3 A;  5EBK A;  4A65 A;  4B69 A;  3DJG X;  1N4U A;  2QA2 A;  3AEC A;  1ZKQ A;  4P9S A;  2OAM A;  4HA6 A;  1KSU A;  4K2X A;  2WS3 A;  2YG3 A;  3CGE A;  4H4V A;  5BRT A;  3FLH A;  1OJ9 A;  3L1R A;  3NN6 X;  3UTH A;  4K5R A;  1C25 A;  2NVK X;  3QSE A;  3URH A;  4DSH A;  1QB0 A;  3QSM A;  3AEE A;  4AT0 A;  2XVF A;  3M13 A;  3UTG A;  3UCL A;  3BI2 A;  2R46 A;  1TDK A;  2WDR A;  3I2V A;  3UKA A;  2IFD A;  1F6M A;  1GND A;  1TYP A;  4MJW A;  4YWO A;  1KF6 A;  2XLS A;  1QO8 A;  1H7W A;  2CDU A;  3ALJ A;  1IUS A;  1SEZ A;  4Z44 A;  3DK4 A;  1GER A;  2RGJ A;  4H4Z A;  3AE1 A;  1CWR A;  2BCG G;  3ICS A;  2WDV A;  4A9W A;  3IPP A;  1GET A;  3K7Q X;  3T14 A;  4CCQ A;  4RG4 A;  1F8R A;  3BNU A;  1REO A;  2H88 A;  3DGZ A;  2XFQ A;  2XVE A;  2XYO A;  4RSL A;  4XWZ A;  1XHC A;  2WU2 A;  1E6E A;  1KFY A;  3KU9 A;  3G5Q A;  4JGT A;  1AOG A;  5FS8 A;  1FEB A;  4B67 A;  4UDP A;  4C5O A;  1LV0 A;  2BC1 A;  1YKJ A;  2DKH A;  5LAO A;  4Y4M A;  2GEW A;  3DME A;  1UAR A;  3UTF A;  3GK5 A;  1GRF A;  3DJJ A;  3K7T A;  1LJ1 A;  2C66 A;  3AE5 A;  4OPT A;  1NHP A;  2V3A A;  1N4V A;  1PBB A;  3CGB A;  4JDR A;  1YQ3 A;  4FX9 A;  2C70 A;  4Z24 A;  2FBW A;  4Z43 A;  2WU5 A;  3QSS A;  2EQ8 A;  1NAA A;  1ZMC A;  2VQB A;  1TDF A;  2JBV A;  4FK1 C;  1YML A;  1DOB A;  4RG3 A;  2YM2 A;  3IWH A;  2GR3 A;  3CPH G;  5LV9 A;  4U8N A;  2B7S A;  4B66 A;  1H81 A;  4NTC A;  4J33 A;  3LAD A;  1X31 B;  1NHR A;  2FJA A;  5KMS A;  1GN0 A;  3QVP A;  1PJ6 A;  1KNP A;  3NH3 X;  3FIM B;  3BHK A;  1EL8 A;  1BOH A;  2ARD A;  2I0Z A;  1Z6L A;  1WHB A;  4DNA A;  4H4Y A;  1EL7 A;  3RHA A;  4OCG A;  3ABV A;  1ZK7 A;  1ZOV A;  3GD3 A;  3UP4 A;  4BK3 A;  3M0O A;  2WP6 A;  2WHD A;  2B76 A;  3ATQ A;  1M6I A;  3KPK A;  4Z2R A;  2C3D A;  5JCN A;  2H89 A;  3AE4 A;  2WEU A;  1QJD A;  3HYV A;  3GYJ A;  1FEA A;  1YS0 A;  3UKF A;  3AAX A;  4IA5 A;  3HYX A;  5KXJ A;  4TLZ A;  4Z26 A;  3UOX A;  2ACZ A;  5U1O A;  5KVH A;  1OJA A;  2CUL A;  2MRM A;  1Q1W A;  1NPX A;  4CBQ A;  1FL2 A;  2Q0L A;  1CL0 A;  3NK0 X;  2BK5 A;  4K7Z A;  4OPG A;  4ZN0 A;  2TMD A;  3KVE A;  2MOL A;  5HBO A;  1H84 A;  4B63 A;  4CY6 A;  4LU6 A;  3IF9 A;  4LA1 A;  1ZP0 A;  1LQT A;  5LAM A;  2J6P A;  2RAB A;  5FS9 A;  1S3E A;  2BYB A;  1PBC A;  2CVJ A;  2GF3 A;  3B3R A;  2R4J A;  3FS5 A;  4N9X A;  2TPR A;  1Q9I A;  2B9X A;  1K0L A;  3AEB A;  3C4N A;  1OKG A;  1ZX9 A;  3NYF A;  1GAL A;  1NG3 A;  4XXG A;  4BUR A;  4EQX A;  4H50 A;  4EQR A;  3NK2 X;  2IID A;  4TM1 A;  1N4W A;  2JKC A;  4A6N B;  2VZ2 A;  1KSS A;  3NN0 X;  1CF3 A;  2GRT A;  3AE2 A;  2YQU A;  2X8H A;  1NHQ A;  4YT0 A;  2XCG A;  2EG4 B;  3EF6 A;  3LOV A;  4F67 A;  1H83 A;  3T2Y A;  1VG0 A;  1EL9 A;  1ZDL A;  1ZMD A;  2QAE A;  3CIR A;  4TLX A;  4II2 A;  5HPA A;  3AE6 A;  1ZOY A;  4J2W A;  3P9U A;  1BGJ A;  1PJ5 A;  5BUL A;  1GOS A;  1F8W A;  1IUT A;  3ADA B;  1JOA A;  3NYC A;  2WBA A;  2V5Z A;  5HBP A;  2Q7V A;  5KNL A;  1D4C A;  1FOH A;  1NG4 A;  1PJ7 A;  2BXS A;  3UKQ A;  2C72 A;  2DCQ A;  4X9M A;  1L0V A;  3G5R A;  3IHG A;  3C96 A;  2YG4 A;  4JY2 A;  3P4R A;  1E0C A;  5HXI A;  2GR2 A;  2X3N A;  3ZDN A;  2OA1 A;  1V59 A;  1H7X A;  3AE7 A;  3NK1 X;  4NEW A;  3LB8 A;  2JAE A;  3GRS A;  1DOD A;  3G5J A;  2C3C A;  4H2R A;  2GWF A;  4X4J A;  1YT8 A;  1COY A;  4GRT A;  4AOX A;  3D1C A;  2IFV A;  3ITJ A;  2BK4 A;  1N1P A;  2A8X A;  4ZCC A;  3F8P A;  3MZZ A;  1O95 A;  3EAO A;  4YTM A;  4A7A A;  3LZW A;  4GDP A;  3KD9 A;  5BVA A;  3QJ4 A;  2EQ7 A;  1JRX A;  1JU2 A;  1OJT A;  3I3L A;  3UKP A;  1VQW A;  3CMM A;  4H2Q A;  1RP0 A;  3UTE A;  4H4U A;  1URH A;  1LQU A;  3ICT A;  1XPQ A;  3AB1 A;  2XVJ A;  4APN A;  4GUV A;  1H4M X;  1H86 A;  4JN9 A;  2BCP A;  2WPC A;  4FK1 A;  2XLT A;  4D04 A;  3M12 A;  1BKW A;  3P4S A;  1W4X A;  3FPZ A;  2VVL A;  4AT2 A;  1E1K A;  3DH9 A;  4YKF A;  2ZZB A;  2R9Z A;  2R0P A;  3F8R A;  4G74 A;  2DKI A;  3NLC A;  4EQS A;  3RP7 A;  5FS7 A;  3T2K A;  2WLX A;  4YKG A;  2APG A;  2WLR A;  3SZF A;  2XDO A;  4B68 A;  3F8D A;  1CWS A;  1O5W A;  3LJP A;  2GAH B;  4EM4 A;  3P4P A;  5C3J A;  4B1B A;  1E39 A;  3EPT A;  4H4Q A;  4U8M A;  1BGN A;  1FEC A;  2VVL G;  2XFN A;  1VEE A;  3P3A A;  4JNQ A;  3WE0 A;  3T2Z A;  2GR0 A;  3S5W A;  1GRA A;  4A6N A;  2BS4 A;  3NT6 A;  3NTA A;  1ZY8 A;  2X99 A;  4NEV A;  3AYL A;  1CC4 A;  3KKJ A;  3L8K A;  4Y4N A;  2EG4 A;  3AD8 B;  4NTD A;  4U8I A;  4C3X A;  3FG2 P;  3SX6 A;  3II4 A;  2KL3 A;  1K4Q A;  1PBE A;  1PHH A;  2YWL A;  2BK3 A;  3CNS A;  3G5S A;  3CNT A;  2JB1 A;  3OZ2 A;  4H7U A;  3AWI A;  5FMH A;  3IPO A;  2FJE A;  4H4P A;  3V3N A;  3AEA A;  2BA9 A;  5C2T A;  1CBO A;  2XFU A;  1TDO A;  1BOI A;  3RP6 A;  4EM3 A;  4PAB A;  1CWT A;  4GAP A;  1E1M A;  4U2L A;  3UOY A;  3I6D A;  1IUU A;  2WQY A;  1D5T A;  3ICR A;  2A89 A;  4CCR A;  2C67 A;  1YM9 A;  1Y56 B;  5U63 A;  4J36 A;  2WOI A;  1CHU A;  1PDH A;  1PXB A;  3SZW A;  2YR5 A;  1GRT A;  4BJZ A;  1F8S A;  4BK2 A;  1L9E A;  2BAB A;  4EMI A;  5GSN A;  4B64 A;  3AYI A;  2EG3 A;  3DJD A;  3UKH A;  2YLW A;  3BNM A;  4YSZ A;  4KPR A;  3R2U A;  1CJ2 A;  1T3K A;  4GDE A;  4A5L A;  2WOV A;  2GQW A;  4J34 A;  1GXF A;  2BXR A;  3SZ0 A;  4J57 A;  3BHF A;  4ZCD A;  3TG3 A;  4H4R A;  4ADW A;  2Z5X A;  4USR A;  1DOE A;  2WES A;  5IPY A;  1JNR A;  2YLT A;  4DGK A;  2GVC A;  3SYI A;  2YG6 A;  3AEF A;  4BJY A;  2JK6 A;  4OPC A;  2VVM A;  5KRQ A;  3R9U A;  1JRZ A;  3IC9 A;  4U8P A;  4H4S A;  5TR3 A;  2JB3 A;  1PBF A;  4GR1 A;  4K8D A;  1VDC A;  4WCT A;  1M64 A;  4WX1 A;  4UP3 A;  1B4V A;  1VRQ B;  1GV4 A;  3B6D A;  4AP1 A;  2GH5 A;  1OJC A;  5KOW A;  1GMX A;  3GDP A;  2VRM A;  3DK8 A;  4GCM A;  4PAA A;  4G9K A;  4U8L A;  2QA1 A;  1HZM A;  1D4E A;  5JCK A;  3V3O A;  3TG1 B;  2F5Z A;  4K5S A;  4YXD A;  2BS3 A;  3SFD A;  3ILM A;  2FJD A;  3NTD A;  2YLS A;  1GTE A;  2VQ7 A;  1ORB A;  4UDR A;  2BAC A;  3T31 A;  4NNJ A;  4C77 A;  1CC2 A;  2OLN A;  3PVC A;  4EMJ A;  4AOS A;  3AAY A;  3CNJ A;  1CJ3 A;  3SQP A;  4X9N A;  3NHO X;  3GRT A;  2YVG A;  4BV6 A;  3CTY A;  4TM3 A;  1WV9 A;  1PN0 A;  1RHD A;  1YQZ A;  4G73 A;  3AED A;  4H2N A;  1LVL A;  3CND A;  1Y0P A;  2OLO A;  1GRE A;  5ER0 A;  3UOZ A;  3KLJ A;  2R45 A;  4Z2U A;  3FNJ A;  3DK9 A;  1PBD A;  5U25 A;  3T37 A;  1TDN A;  3DJE A;  3GD4 A;  2YLZ A;  3CNP A;  3FMW A;  1GRH A;  5JCM A;  3H4K A;  2Z5Y A;  1GT8 A;  2WET A;  3VR8 A;  2R0C A;  3IHM A;  5CQF A;  4BK1 A;  4U2S A;  3SY4 A;  1BZL A;  2B7R A;  4K22 A;  5KWF A;  2QCU A;  3TP9 A;  3QFA A;  1GSN A;  3LXD A;  2XFO A;  1RHS A;  1Y56 A;  3GMC A;  1S3B A;  3P4Q A;  1O94 A;  1JEH A;  4TM4 A;  1GEU A;  2JTR A;  5EB4 A;  4CNK A;  1KNR A;  2C65 A;  2XFP A;  3V76 A;  4KX6 A;  2A2K A;  3K9R A;  2X8G A;  2C7G A;  3AXB A;  4NZH A;  1GRB A;  3AE3 A;  5EOW A;  3D8X A;  5HHF A;  4OPL A;  4IV9 A;  4H4W A;  3NHV A;  2WP9 A;  5M0Z A;  4Z25 A;  2YLX A;  3KPF A;  4GAV A;  3UKL A;  4H4X A;  1H6V A;  4GF7 A;  1CC6 A;  4B65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...