3HWIA

Crystal structure of probable thiosulfate sulfurtransferase cysa2 (rhodanese-like protein) from mycobacterium tuberculosis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
275
structure length
267
Chain Sequence
RCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRDHIAGAIKLDWRTDLQDPVKRDFVDAQQFSKLLSERGIANEDTVILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASPPDNTIRAFRDEVLAAINVKNLIDVRSPDEFSGKILAPQRPGHIPGAINVPWSRAANEDGTFKSDEELAKLYADAGLDNSKETIAYCRIGERSSHTWFVLRELLGHQNVKNYDGSWTEYGSLVGAPIELGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thiosulfate sulfurtransferase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 95
structure length 267
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.8.1.1: Thiosulfate sulfurtransferase.
pdb deposition date 2009-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3hwiA02
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3hwiA01
3IPOA 5HBLA 3ICRA 1H4MX 3AAYA 5HBOA 4F67A 2DCQA 1DP2A 1RHSA 3P3AA 2ORAA 5LAMA 4WH7A 2WLXA 5LAOA 2K0ZA 5HBQA 3OLHA 1GN0A 2MRMA 3IWHA 2EG4B 1WHBA 3AAXA 1YMDA 3FNJA 2MOIA 2MOLA 3IPPA 3MZZA 3G5JA 3HZUA 3GK5A 4OCGA 1OKGA 1BOIA 1YMLA 2WLRA 3FLHA 3HIXA 1QXNA 3R2UA 3K9RA 1YMKA 2HHGA 2FSXA 3FS5A 3I3UA 3TP9A 1UARA 3TG3A 1CWSA 2IFDA 3FOJA 2IFVA 3D1PA 1URHA 3NHVA 2GWFA 1YM9A 1H4KX 3OP3A 1RHDA 3HWIA 2J6PA 3NTAA 2A2KA 3NTDA 1YS0A 5HBPA 1ORBA 3TG1B 2KL3A 3O3WA 1CWRA 1TQ1A 1VEEA 3NT6A 2EG4A 2JTRA 5HPAA 1WV9A 2EG3A 1T3KA 2JTQA 3F4AA 4WH9A 3UTNX 3ICTA 1E0CA 3ILMA 2UZQA 1HZMA 1CWTA 3I2VA 3ICSA 2JTSA 1BOHA 1C25A 4JGTA 1GMXA 2OUCA 1QB0A 2VSWA 1YT8A
chains in the Genus database with same CATH superfamily
3IPOA 5HBLA 3ICRA 1H4MX 3AAYA 5HBOA 4F67A 2DCQA 1DP2A 1RHSA 3P3AA 2ORAA 5LAMA 4WH7A 2WLXA 5LAOA 2K0ZA 5HBQA 3OLHA 1GN0A 2MRMA 3IWHA 2EG4B 1WHBA 3AAXA 2Q82A 1YMDA 3FNJA 2MOIA 2MOLA 3IPPA 3MZZA 3G5JA 3HZUA 3GK5A 4OCGA 1OKGA 1BOIA 1YMLA 2WLRA 3FLHA 3HIXA 1QXNA 3R2UA 3K9RA 1YMKA 2HHGA 2FSXA 3FS5A 3I3UA 3TP9A 1UARA 3TG3A 1CWSA 2IFDA 3FOJA 2IFVA 3D1PA 1URHA 3NHVA 2GWFA 1YM9A 1H4KX 3OP3A 1RHDA 3HWIA 2J6PA 3NTAA 2A2KA 3NTDA 1YS0A 5HBPA 1ORBA 3TG1B 2KL3A 3O3WA 1CWRA 1TQ1A 1VEEA 3NT6A 2EG4A 2JTRA 5HPAA 1WV9A 2EG3A 1T3KA 2JTQA 3F4AA 4WH9A 3UTNX 3ICTA 1E0CA 3ILMA 2UZQA 1HZMA 1CWTA 3I2VA 3ICSA 2JTSA 1BOHA 1C25A 4JGTA 1GMXA 2OUCA 1QB0A 2VSWA 1YT8A
chains in the Genus database with same CATH topology
3IPOA 5HBLA 3ICRA 1H4MX 3AAYA 5HBOA 4F67A 2DCQA 1DP2A 1RHSA 3P3AA 2ORAA 5LAMA 4WH7A 2WLXA 5LAOA 2K0ZA 5HBQA 3OLHA 1GN0A 2MRMA 3IWHA 2EG4B 1WHBA 3AAXA 1YMDA 3FNJA 2MOIA 2MOLA 3IPPA 3MZZA 3G5JA 3HZUA 3GK5A 4OCGA 1OKGA 1BOIA 1YMLA 2WLRA 3FLHA 3HIXA 1QXNA 3R2UA 3K9RA 1YMKA 2HHGA 2FSXA 3FS5A 3I3UA 3TP9A 1UARA 3TG3A 1CWSA 2IFDA 3FOJA 2IFVA 3D1PA 1URHA 3NHVA 2GWFA 1YM9A 1H4KX 3OP3A 1RHDA 3HWIA 2J6PA 3NTAA 2A2KA 3NTDA 1YS0A 5HBPA 1ORBA 3TG1B 2KL3A 3O3WA 1CWRA 1TQ1A 1VEEA 3NT6A 2EG4A 2JTRA 5HPAA 1WV9A 2EG3A 1T3KA 2JTQA 3F4AA 4WH9A 3UTNX 3ICTA 1E0CA 3ILMA 2UZQA 1HZMA 1CWTA 3I2VA 3ICSA 2JTSA 1BOHA 1C25A 4JGTA 1GMXA 2OUCA 1QB0A 2VSWA 1YT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IPO A;  5HBL A;  3ICR A;  1H4M X;  3AAY A;  5HBO A;  4F67 A;  2DCQ A;  1DP2 A;  1RHS A;  3P3A A;  2ORA A;  5LAM A;  4WH7 A;  2WLX A;  5LAO A;  2K0Z A;  5HBQ A;  3OLH A;  1GN0 A;  2MRM A;  3IWH A;  2EG4 B;  1WHB A;  3AAX A;  1YMD A;  3FNJ A;  2MOI A;  2MOL A;  3IPP A;  3MZZ A;  3G5J A;  3HZU A;  3GK5 A;  4OCG A;  1OKG A;  1BOI A;  1YML A;  2WLR A;  3FLH A;  3HIX A;  1QXN A;  3R2U A;  3K9R A;  1YMK A;  2HHG A;  2FSX A;  3FS5 A;  3I3U A;  3TP9 A;  1UAR A;  3TG3 A;  1CWS A;  2IFD A;  3FOJ A;  2IFV A;  3D1P A;  1URH A;  3NHV A;  2GWF A;  1YM9 A;  1H4K X;  3OP3 A;  1RHD A;  3HWI A;  2J6P A;  3NTA A;  2A2K A;  3NTD A;  1YS0 A;  5HBP A;  1ORB A;  3TG1 B;  2KL3 A;  3O3W A;  1CWR A;  1TQ1 A;  1VEE A;  3NT6 A;  2EG4 A;  2JTR A;  5HPA A;  1WV9 A;  2EG3 A;  1T3K A;  2JTQ A;  3F4A A;  4WH9 A;  3UTN X;  3ICT A;  1E0C A;  3ILM A;  2UZQ A;  1HZM A;  1CWT A;  3I2V A;  3ICS A;  2JTS A;  1BOH A;  1C25 A;  4JGT A;  1GMX A;  2OUC A;  1QB0 A;  2VSW A;  1YT8 A; 
#chains in the Genus database with same CATH topology
 3IPO A;  5HBL A;  3ICR A;  1H4M X;  3AAY A;  5HBO A;  4F67 A;  2DCQ A;  1DP2 A;  1RHS A;  3P3A A;  2ORA A;  5LAM A;  4WH7 A;  2WLX A;  5LAO A;  2K0Z A;  5HBQ A;  3OLH A;  1GN0 A;  2MRM A;  3IWH A;  2EG4 B;  1WHB A;  3AAX A;  2Q82 A;  1YMD A;  3FNJ A;  2MOI A;  2MOL A;  3IPP A;  3MZZ A;  3G5J A;  3HZU A;  3GK5 A;  4OCG A;  1OKG A;  1BOI A;  1YML A;  2WLR A;  3FLH A;  3HIX A;  1QXN A;  3R2U A;  3K9R A;  1YMK A;  2HHG A;  2FSX A;  3FS5 A;  3I3U A;  3TP9 A;  1UAR A;  3TG3 A;  1CWS A;  2IFD A;  3FOJ A;  2IFV A;  3D1P A;  1URH A;  3NHV A;  2GWF A;  1YM9 A;  1H4K X;  3OP3 A;  1RHD A;  3HWI A;  2J6P A;  3NTA A;  2A2K A;  3NTD A;  1YS0 A;  5HBP A;  1ORB A;  3TG1 B;  2KL3 A;  3O3W A;  1CWR A;  1TQ1 A;  1VEE A;  3NT6 A;  2EG4 A;  2JTR A;  5HPA A;  1WV9 A;  2EG3 A;  1T3K A;  2JTQ A;  3F4A A;  4WH9 A;  3UTN X;  3ICT A;  1E0C A;  3ILM A;  2UZQ A;  1HZM A;  1CWT A;  3I2V A;  3ICS A;  2JTS A;  1BOH A;  1C25 A;  4JGT A;  1GMX A;  2OUC A;  1QB0 A;  2VSW A;  1YT8 A; 
#chains in the Genus database with same CATH homology
 3IPO A;  5HBL A;  3ICR A;  1H4M X;  3AAY A;  5HBO A;  4F67 A;  2DCQ A;  1DP2 A;  1RHS A;  3P3A A;  2ORA A;  5LAM A;  4WH7 A;  2WLX A;  5LAO A;  2K0Z A;  5HBQ A;  3OLH A;  1GN0 A;  2MRM A;  3IWH A;  2EG4 B;  1WHB A;  3AAX A;  1YMD A;  3FNJ A;  2MOI A;  2MOL A;  3IPP A;  3MZZ A;  3G5J A;  3HZU A;  3GK5 A;  4OCG A;  1OKG A;  1BOI A;  1YML A;  2WLR A;  3FLH A;  3HIX A;  1QXN A;  3R2U A;  3K9R A;  1YMK A;  2HHG A;  2FSX A;  3FS5 A;  3I3U A;  3TP9 A;  1UAR A;  3TG3 A;  1CWS A;  2IFD A;  3FOJ A;  2IFV A;  3D1P A;  1URH A;  3NHV A;  2GWF A;  1YM9 A;  1H4K X;  3OP3 A;  1RHD A;  3HWI A;  2J6P A;  3NTA A;  2A2K A;  3NTD A;  1YS0 A;  5HBP A;  1ORB A;  3TG1 B;  2KL3 A;  3O3W A;  1CWR A;  1TQ1 A;  1VEE A;  3NT6 A;  2EG4 A;  2JTR A;  5HPA A;  1WV9 A;  2EG3 A;  1T3K A;  2JTQ A;  3F4A A;  4WH9 A;  3UTN X;  3ICT A;  1E0C A;  3ILM A;  2UZQ A;  1HZM A;  1CWT A;  3I2V A;  3ICS A;  2JTS A;  1BOH A;  1C25 A;  4JGT A;  1GMX A;  2OUC A;  1QB0 A;  2VSW A;  1YT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...