2MRMA

Solution structure of the rhodanese domain of ygap from e. coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
107
structure length
107
Chain Sequence
MALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGIDGWKRAGLPVAVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Membrane protein
publication title Fast conformational exchange between the sulfur-free and persulfide-bound rhodanese domain of E. coli YgaP
pubmed doi rcsb
source organism Escherichia coli
total genus 18
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2014-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 2mrmA00
1UARA 3OP3A 2HHGA 2ORAA 5HBPA 3HIXA 3ICSA 2MOLA 3TG3A 1VEEA 3MZZA 3O3WA 1BOIA 1URHA 1T3KA 3ICTA 2KL3A 3NHVA 2EG4A 2J6PA 2OUCA 3HZUA 2GWFA 3TG1B 4WH7A 3FS5A 1WHBA 3G5JA 3FOJA 2IFVA 1OKGA 3OLHA 2MOIA 1RHDA 2IFDA 2WLRA 3NTAA 1QXNA 5HBQA 1CWTA 3IPOA 2VSWA 3TP9A 1YS0A 2JTSA 1H4KX 1WV9A 5HPAA 3FLHA 3IWHA 3K9RA 2UZQA 3IPPA 3R2UA 1CWRA 4JGTA 3AAYA 1GMXA 1BOHA 1YT8A 2EG3A 1ORBA 3NTDA 2EG4B 3FNJA 4OCGA 3F4AA 3NT6A 3HWIA 3D1PA 2JTRA 1C25A 2MRMA 2WLXA 1E0CA 5HBLA 3P3AA 1TQ1A 4F67A 3I3UA 3ICRA 1GN0A 1DP2A 3GK5A 1YMLA 4WH9A 2FSXA 5LAOA 5LAMA 2DCQA 3UTNX 3ILMA 1H4MX 2A2KA 1HZMA 3AAXA 1RHSA 1QB0A 2K0ZA 3I2VA 1YMKA 5HBOA 1YM9A 1CWSA 2JTQA 1YMDA
chains in the Genus database with same CATH superfamily
1UARA 3OP3A 2HHGA 2ORAA 5HBPA 3HIXA 2Q82A 3ICSA 2MOLA 3TG3A 1VEEA 3MZZA 3O3WA 1BOIA 1URHA 1T3KA 3ICTA 2KL3A 3NHVA 2EG4A 2J6PA 2OUCA 3HZUA 2GWFA 3TG1B 4WH7A 3FS5A 1WHBA 3G5JA 3FOJA 2IFVA 1OKGA 3OLHA 2MOIA 1RHDA 2IFDA 2WLRA 3NTAA 1QXNA 5HBQA 1CWTA 3IPOA 2VSWA 3TP9A 1YS0A 2JTSA 1H4KX 1WV9A 5HPAA 3FLHA 3IWHA 3K9RA 2UZQA 3IPPA 3R2UA 1CWRA 4JGTA 3AAYA 1GMXA 1BOHA 1YT8A 2EG3A 1ORBA 3NTDA 2EG4B 3FNJA 4OCGA 3F4AA 3NT6A 3HWIA 3D1PA 2JTRA 1C25A 2MRMA 2WLXA 1E0CA 5HBLA 3P3AA 1TQ1A 4F67A 3I3UA 3ICRA 1GN0A 1DP2A 3GK5A 1YMLA 4WH9A 2FSXA 5LAOA 5LAMA 2DCQA 3UTNX 3ILMA 1H4MX 2A2KA 1HZMA 3AAXA 1RHSA 1QB0A 2K0ZA 3I2VA 1YMKA 5HBOA 1YM9A 1CWSA 2JTQA 1YMDA
chains in the Genus database with same CATH topology
1UARA 3OP3A 2HHGA 2ORAA 5HBPA 3HIXA 3ICSA 2MOLA 3TG3A 1VEEA 3MZZA 3O3WA 1BOIA 1URHA 1T3KA 3ICTA 2KL3A 3NHVA 2EG4A 2J6PA 2OUCA 3HZUA 2GWFA 3TG1B 4WH7A 3FS5A 1WHBA 3G5JA 3FOJA 2IFVA 1OKGA 3OLHA 2MOIA 1RHDA 2IFDA 2WLRA 3NTAA 1QXNA 5HBQA 1CWTA 3IPOA 2VSWA 3TP9A 1YS0A 2JTSA 1H4KX 1WV9A 5HPAA 3FLHA 3IWHA 3K9RA 2UZQA 3IPPA 3R2UA 1CWRA 4JGTA 3AAYA 1GMXA 1BOHA 1YT8A 2EG3A 1ORBA 3NTDA 2EG4B 3FNJA 4OCGA 3F4AA 3NT6A 3HWIA 3D1PA 2JTRA 1C25A 2MRMA 2WLXA 1E0CA 5HBLA 3P3AA 1TQ1A 4F67A 3I3UA 3ICRA 1GN0A 1DP2A 3GK5A 1YMLA 4WH9A 2FSXA 5LAOA 5LAMA 2DCQA 3UTNX 3ILMA 1H4MX 2A2KA 1HZMA 3AAXA 1RHSA 1QB0A 2K0ZA 3I2VA 1YMKA 5HBOA 1YM9A 1CWSA 2JTQA 1YMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UAR A;  3OP3 A;  2HHG A;  2ORA A;  5HBP A;  3HIX A;  3ICS A;  2MOL A;  3TG3 A;  1VEE A;  3MZZ A;  3O3W A;  1BOI A;  1URH A;  1T3K A;  3ICT A;  2KL3 A;  3NHV A;  2EG4 A;  2J6P A;  2OUC A;  3HZU A;  2GWF A;  3TG1 B;  4WH7 A;  3FS5 A;  1WHB A;  3G5J A;  3FOJ A;  2IFV A;  1OKG A;  3OLH A;  2MOI A;  1RHD A;  2IFD A;  2WLR A;  3NTA A;  1QXN A;  5HBQ A;  1CWT A;  3IPO A;  2VSW A;  3TP9 A;  1YS0 A;  2JTS A;  1H4K X;  1WV9 A;  5HPA A;  3FLH A;  3IWH A;  3K9R A;  2UZQ A;  3IPP A;  3R2U A;  1CWR A;  4JGT A;  3AAY A;  1GMX A;  1BOH A;  1YT8 A;  2EG3 A;  1ORB A;  3NTD A;  2EG4 B;  3FNJ A;  4OCG A;  3F4A A;  3NT6 A;  3HWI A;  3D1P A;  2JTR A;  1C25 A;  2MRM A;  2WLX A;  1E0C A;  5HBL A;  3P3A A;  1TQ1 A;  4F67 A;  3I3U A;  3ICR A;  1GN0 A;  1DP2 A;  3GK5 A;  1YML A;  4WH9 A;  2FSX A;  5LAO A;  5LAM A;  2DCQ A;  3UTN X;  3ILM A;  1H4M X;  2A2K A;  1HZM A;  3AAX A;  1RHS A;  1QB0 A;  2K0Z A;  3I2V A;  1YMK A;  5HBO A;  1YM9 A;  1CWS A;  2JTQ A;  1YMD A; 
#chains in the Genus database with same CATH topology
 1UAR A;  3OP3 A;  2HHG A;  2ORA A;  5HBP A;  3HIX A;  2Q82 A;  3ICS A;  2MOL A;  3TG3 A;  1VEE A;  3MZZ A;  3O3W A;  1BOI A;  1URH A;  1T3K A;  3ICT A;  2KL3 A;  3NHV A;  2EG4 A;  2J6P A;  2OUC A;  3HZU A;  2GWF A;  3TG1 B;  4WH7 A;  3FS5 A;  1WHB A;  3G5J A;  3FOJ A;  2IFV A;  1OKG A;  3OLH A;  2MOI A;  1RHD A;  2IFD A;  2WLR A;  3NTA A;  1QXN A;  5HBQ A;  1CWT A;  3IPO A;  2VSW A;  3TP9 A;  1YS0 A;  2JTS A;  1H4K X;  1WV9 A;  5HPA A;  3FLH A;  3IWH A;  3K9R A;  2UZQ A;  3IPP A;  3R2U A;  1CWR A;  4JGT A;  3AAY A;  1GMX A;  1BOH A;  1YT8 A;  2EG3 A;  1ORB A;  3NTD A;  2EG4 B;  3FNJ A;  4OCG A;  3F4A A;  3NT6 A;  3HWI A;  3D1P A;  2JTR A;  1C25 A;  2MRM A;  2WLX A;  1E0C A;  5HBL A;  3P3A A;  1TQ1 A;  4F67 A;  3I3U A;  3ICR A;  1GN0 A;  1DP2 A;  3GK5 A;  1YML A;  4WH9 A;  2FSX A;  5LAO A;  5LAM A;  2DCQ A;  3UTN X;  3ILM A;  1H4M X;  2A2K A;  1HZM A;  3AAX A;  1RHS A;  1QB0 A;  2K0Z A;  3I2V A;  1YMK A;  5HBO A;  1YM9 A;  1CWS A;  2JTQ A;  1YMD A; 
#chains in the Genus database with same CATH homology
 1UAR A;  3OP3 A;  2HHG A;  2ORA A;  5HBP A;  3HIX A;  3ICS A;  2MOL A;  3TG3 A;  1VEE A;  3MZZ A;  3O3W A;  1BOI A;  1URH A;  1T3K A;  3ICT A;  2KL3 A;  3NHV A;  2EG4 A;  2J6P A;  2OUC A;  3HZU A;  2GWF A;  3TG1 B;  4WH7 A;  3FS5 A;  1WHB A;  3G5J A;  3FOJ A;  2IFV A;  1OKG A;  3OLH A;  2MOI A;  1RHD A;  2IFD A;  2WLR A;  3NTA A;  1QXN A;  5HBQ A;  1CWT A;  3IPO A;  2VSW A;  3TP9 A;  1YS0 A;  2JTS A;  1H4K X;  1WV9 A;  5HPA A;  3FLH A;  3IWH A;  3K9R A;  2UZQ A;  3IPP A;  3R2U A;  1CWR A;  4JGT A;  3AAY A;  1GMX A;  1BOH A;  1YT8 A;  2EG3 A;  1ORB A;  3NTD A;  2EG4 B;  3FNJ A;  4OCG A;  3F4A A;  3NT6 A;  3HWI A;  3D1P A;  2JTR A;  1C25 A;  2MRM A;  2WLX A;  1E0C A;  5HBL A;  3P3A A;  1TQ1 A;  4F67 A;  3I3U A;  3ICR A;  1GN0 A;  1DP2 A;  3GK5 A;  1YML A;  4WH9 A;  2FSX A;  5LAO A;  5LAM A;  2DCQ A;  3UTN X;  3ILM A;  1H4M X;  2A2K A;  1HZM A;  3AAX A;  1RHS A;  1QB0 A;  2K0Z A;  3I2V A;  1YMK A;  5HBO A;  1YM9 A;  1CWS A;  2JTQ A;  1YMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...