3D1PA

Atomic resolution structure of uncharacterized protein from saccharomyces cerevisiae
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
120
structure length
120
Chain Sequence
SNIQSYSFEDMKRIVGKHDPNVVLVDVREPSEYSIVHIPASINVPYRSHPDAFALDPLEFEKQIGIPKPDSAKELIFYCASGKRGGEAQKVASSHGYSNTSLYPGSMNDWVSHGGDKLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative thiosulfate sulfurtransferase YOR285W
publication title Atomic resolution structure of uncharacterized protein from Saccharomyces cerevisiae.
rcsb
source organism Saccharomyces cerevisiae
total genus 37
structure length 120
sequence length 120
ec nomenclature ec 2.8.1.1: Thiosulfate sulfurtransferase.
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3d1pA00
2HHGA 4F67A 2J6PA 1CWSA 1RHSA 1H4MX 1UARA 3HWIA 1DP2A 4WH7A 2DCQA 3FOJA 2ORAA 3G5JA 4JGTA 3ICRA 3AAXA 1WV9A 2JTSA 2MOLA 3NT6A 3TG1B 1CWRA 1QXNA 1OKGA 3D1PA 5HPAA 1CWTA 1T3KA 1YT8A 3AAYA 3MZZA 2WLRA 5HBLA 3I2VA 4WH9A 1YMDA 1URHA 1YMKA 5HBPA 3IWHA 3NTDA 3OP3A 5HBQA 2A2KA 1BOIA 5HBOA 1HZMA 1YS0A 3NTAA 1QB0A 3TP9A 3HZUA 3R2UA 2JTRA 2GWFA 3I3UA 2EG4A 1GMXA 3O3WA 1WHBA 1TQ1A 1E0CA 2WLXA 2K0ZA 1YM9A 1GN0A 3FLHA 2MOIA 3UTNX 3GK5A 2UZQA 2MRMA 2VSWA 1VEEA 3IPOA 3ILMA 2KL3A 3ICSA 3IPPA 2FSXA 4OCGA 2IFVA 5LAMA 2EG4B 3TG3A 2JTQA 3FNJA 1ORBA 3ICTA 2EG3A 3FS5A 3NHVA 1H4KX 3P3AA 3OLHA 1YMLA 3K9RA 2OUCA 3HIXA 1RHDA 1BOHA 5LAOA 1C25A 2IFDA 3F4AA
chains in the Genus database with same CATH superfamily
2HHGA 4F67A 2J6PA 1CWSA 1RHSA 1H4MX 1UARA 3HWIA 1DP2A 4WH7A 2DCQA 3FOJA 2ORAA 3G5JA 4JGTA 3ICRA 3AAXA 1WV9A 2JTSA 2MOLA 3NT6A 3TG1B 1CWRA 1QXNA 1OKGA 3D1PA 5HPAA 1CWTA 1T3KA 1YT8A 3AAYA 3MZZA 2WLRA 5HBLA 3I2VA 4WH9A 1YMDA 1URHA 1YMKA 5HBPA 3IWHA 3NTDA 3OP3A 5HBQA 2A2KA 1BOIA 5HBOA 1HZMA 1YS0A 3NTAA 1QB0A 3TP9A 3HZUA 3R2UA 2JTRA 2GWFA 3I3UA 2EG4A 1GMXA 3O3WA 1WHBA 1TQ1A 1E0CA 2WLXA 2K0ZA 1YM9A 1GN0A 3FLHA 2MOIA 3UTNX 3GK5A 2UZQA 2MRMA 2VSWA 1VEEA 3IPOA 3ILMA 2KL3A 3ICSA 3IPPA 2FSXA 4OCGA 2IFVA 5LAMA 2EG4B 3TG3A 2JTQA 3FNJA 1ORBA 3ICTA 2EG3A 3FS5A 3NHVA 1H4KX 3P3AA 3OLHA 2Q82A 1YMLA 3K9RA 2OUCA 3HIXA 1RHDA 1BOHA 5LAOA 1C25A 2IFDA 3F4AA
chains in the Genus database with same CATH topology
2HHGA 4F67A 2J6PA 1CWSA 1RHSA 1H4MX 1UARA 3HWIA 1DP2A 4WH7A 2DCQA 3FOJA 2ORAA 3G5JA 4JGTA 3ICRA 3AAXA 1WV9A 2JTSA 2MOLA 3NT6A 3TG1B 1CWRA 1QXNA 1OKGA 3D1PA 5HPAA 1CWTA 1T3KA 1YT8A 3AAYA 3MZZA 2WLRA 5HBLA 3I2VA 4WH9A 1YMDA 1URHA 1YMKA 5HBPA 3IWHA 3NTDA 3OP3A 5HBQA 2A2KA 1BOIA 5HBOA 1HZMA 1YS0A 3NTAA 1QB0A 3TP9A 3HZUA 3R2UA 2JTRA 2GWFA 3I3UA 2EG4A 1GMXA 3O3WA 1WHBA 1TQ1A 1E0CA 2WLXA 2K0ZA 1YM9A 1GN0A 3FLHA 2MOIA 3UTNX 3GK5A 2UZQA 2MRMA 2VSWA 1VEEA 3IPOA 3ILMA 2KL3A 3ICSA 3IPPA 2FSXA 4OCGA 2IFVA 5LAMA 2EG4B 3TG3A 2JTQA 3FNJA 1ORBA 3ICTA 2EG3A 3FS5A 3NHVA 1H4KX 3P3AA 3OLHA 1YMLA 3K9RA 2OUCA 3HIXA 1RHDA 1BOHA 5LAOA 1C25A 2IFDA 3F4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHG A;  4F67 A;  2J6P A;  1CWS A;  1RHS A;  1H4M X;  1UAR A;  3HWI A;  1DP2 A;  4WH7 A;  2DCQ A;  3FOJ A;  2ORA A;  3G5J A;  4JGT A;  3ICR A;  3AAX A;  1WV9 A;  2JTS A;  2MOL A;  3NT6 A;  3TG1 B;  1CWR A;  1QXN A;  1OKG A;  3D1P A;  5HPA A;  1CWT A;  1T3K A;  1YT8 A;  3AAY A;  3MZZ A;  2WLR A;  5HBL A;  3I2V A;  4WH9 A;  1YMD A;  1URH A;  1YMK A;  5HBP A;  3IWH A;  3NTD A;  3OP3 A;  5HBQ A;  2A2K A;  1BOI A;  5HBO A;  1HZM A;  1YS0 A;  3NTA A;  1QB0 A;  3TP9 A;  3HZU A;  3R2U A;  2JTR A;  2GWF A;  3I3U A;  2EG4 A;  1GMX A;  3O3W A;  1WHB A;  1TQ1 A;  1E0C A;  2WLX A;  2K0Z A;  1YM9 A;  1GN0 A;  3FLH A;  2MOI A;  3UTN X;  3GK5 A;  2UZQ A;  2MRM A;  2VSW A;  1VEE A;  3IPO A;  3ILM A;  2KL3 A;  3ICS A;  3IPP A;  2FSX A;  4OCG A;  2IFV A;  5LAM A;  2EG4 B;  3TG3 A;  2JTQ A;  3FNJ A;  1ORB A;  3ICT A;  2EG3 A;  3FS5 A;  3NHV A;  1H4K X;  3P3A A;  3OLH A;  1YML A;  3K9R A;  2OUC A;  3HIX A;  1RHD A;  1BOH A;  5LAO A;  1C25 A;  2IFD A;  3F4A A; 
#chains in the Genus database with same CATH topology
 2HHG A;  4F67 A;  2J6P A;  1CWS A;  1RHS A;  1H4M X;  1UAR A;  3HWI A;  1DP2 A;  4WH7 A;  2DCQ A;  3FOJ A;  2ORA A;  3G5J A;  4JGT A;  3ICR A;  3AAX A;  1WV9 A;  2JTS A;  2MOL A;  3NT6 A;  3TG1 B;  1CWR A;  1QXN A;  1OKG A;  3D1P A;  5HPA A;  1CWT A;  1T3K A;  1YT8 A;  3AAY A;  3MZZ A;  2WLR A;  5HBL A;  3I2V A;  4WH9 A;  1YMD A;  1URH A;  1YMK A;  5HBP A;  3IWH A;  3NTD A;  3OP3 A;  5HBQ A;  2A2K A;  1BOI A;  5HBO A;  1HZM A;  1YS0 A;  3NTA A;  1QB0 A;  3TP9 A;  3HZU A;  3R2U A;  2JTR A;  2GWF A;  3I3U A;  2EG4 A;  1GMX A;  3O3W A;  1WHB A;  1TQ1 A;  1E0C A;  2WLX A;  2K0Z A;  1YM9 A;  1GN0 A;  3FLH A;  2MOI A;  3UTN X;  3GK5 A;  2UZQ A;  2MRM A;  2VSW A;  1VEE A;  3IPO A;  3ILM A;  2KL3 A;  3ICS A;  3IPP A;  2FSX A;  4OCG A;  2IFV A;  5LAM A;  2EG4 B;  3TG3 A;  2JTQ A;  3FNJ A;  1ORB A;  3ICT A;  2EG3 A;  3FS5 A;  3NHV A;  1H4K X;  3P3A A;  3OLH A;  2Q82 A;  1YML A;  3K9R A;  2OUC A;  3HIX A;  1RHD A;  1BOH A;  5LAO A;  1C25 A;  2IFD A;  3F4A A; 
#chains in the Genus database with same CATH homology
 2HHG A;  4F67 A;  2J6P A;  1CWS A;  1RHS A;  1H4M X;  1UAR A;  3HWI A;  1DP2 A;  4WH7 A;  2DCQ A;  3FOJ A;  2ORA A;  3G5J A;  4JGT A;  3ICR A;  3AAX A;  1WV9 A;  2JTS A;  2MOL A;  3NT6 A;  3TG1 B;  1CWR A;  1QXN A;  1OKG A;  3D1P A;  5HPA A;  1CWT A;  1T3K A;  1YT8 A;  3AAY A;  3MZZ A;  2WLR A;  5HBL A;  3I2V A;  4WH9 A;  1YMD A;  1URH A;  1YMK A;  5HBP A;  3IWH A;  3NTD A;  3OP3 A;  5HBQ A;  2A2K A;  1BOI A;  5HBO A;  1HZM A;  1YS0 A;  3NTA A;  1QB0 A;  3TP9 A;  3HZU A;  3R2U A;  2JTR A;  2GWF A;  3I3U A;  2EG4 A;  1GMX A;  3O3W A;  1WHB A;  1TQ1 A;  1E0C A;  2WLX A;  2K0Z A;  1YM9 A;  1GN0 A;  3FLH A;  2MOI A;  3UTN X;  3GK5 A;  2UZQ A;  2MRM A;  2VSW A;  1VEE A;  3IPO A;  3ILM A;  2KL3 A;  3ICS A;  3IPP A;  2FSX A;  4OCG A;  2IFV A;  5LAM A;  2EG4 B;  3TG3 A;  2JTQ A;  3FNJ A;  1ORB A;  3ICT A;  2EG3 A;  3FS5 A;  3NHV A;  1H4K X;  3P3A A;  3OLH A;  1YML A;  3K9R A;  2OUC A;  3HIX A;  1RHD A;  1BOH A;  5LAO A;  1C25 A;  2IFD A;  3F4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...