The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
30
|
sequence length |
116
|
structure length |
114
|
Chain Sequence |
ELQNRLAQYETSLMVMSHNGDVPVITGFNVMRVTTMLDALKVPAVAVLGDDAQDLAYVFGARPLAVGVNIIRVVDVPGQQPSALVDAELGALHEVSMVRVLNDIADEQLVKANM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure and dynamics of the P7 protein from the bacteriophage phi 12.
pubmed doi rcsb |
| molecule tags |
Structural protein
|
| source organism |
Pseudomonas phage phi12
|
| molecule keywords |
Core protein P7
|
| total genus |
30
|
| structure length |
114
|
| sequence length |
116
|
| ec nomenclature | |
| pdb deposition date | 2007-06-08 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Oxidized Rhodanese; domain 1 | Oxidized Rhodanese; domain 1 |
#chains in the Genus database with same CATH superfamily 2Q82 A; #chains in the Genus database with same CATH topology 1GMX A; 3AAY A; 1H4M X; 3IPP A; 1H4K X; 1E0C A; 1CWT A; 3FLH A; 2MOI A; 1YS0 A; 2A2K A; 2JTQ A; 2J6P A; 1RHS A; 3IPO A; 3OP3 A; 2WLX A; 3F4A A; 3HZU A; 5HBP A; 3IWH A; 1YMK A; 5HPA A; 1HZM A; 3ILM A; 2Q82 A; 1DP2 A; 3ICT A; 1QXN A; 5HBL A; 1CWS A; 1YMD A; 2GWF A; 1T3K A; 3GK5 A; 3I3U A; 1C25 A; 1WHB A; 5HBQ A; 2MRM A; 1YML A; 3HIX A; 1OKG A; 2JTS A; 3K9R A; 3HWI A; 2OUC A; 2DCQ A; 3AAX A; 5HBO A; 1WV9 A; 3G5J A; 5LAO A; 3ICR A; 4WH9 A; 2HHG A; 3NHV A; 1ORB A; 2K0Z A; 2EG3 A; 1GN0 A; 3P3A A; 3D1P A; 3MZZ A; 1VEE A; 1YM9 A; 3R2U A; 1TQ1 A; 2JTR A; 2FSX A; 1BOI A; 3O3W A; 2WLR A; 4WH7 A; 3NTA A; 2VSW A; 2ORA A; 3TP9 A; 2IFV A; 1CWR A; 3FNJ A; 1RHD A; 2MOL A; 3ICS A; 2EG4 B; 1URH A; 3I2V A; 3TG1 B; 2KL3 A; 1UAR A; 1QB0 A; 1BOH A; 4F67 A; 2UZQ A; 5LAM A; 3UTN X; 2EG4 A; 2IFD A; 3NTD A; 3OLH A; 3TG3 A; 4OCG A; 3FOJ A; 4JGT A; 1YT8 A; 3NT6 A; 3FS5 A; #chains in the Genus database with same CATH homology 2Q82 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
