3ED7A

Replacement of val3 in human thymidylate synthase affects its kinetic properties and intracellular stability
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
Knots found
sequence length
289
structure length
284
Chain Sequence
LXXXXPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase
publication title Replacement of Val3 in human thymidylate synthase affects its kinetic properties and intracellular stability .
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 284
sequence length 289
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 3ed7A00
2TSRA 3JSUA 3N5GA 3OB7A 4UP1A 1JU6A 2ONBA 1TSDA 2H2QA 1KZJA 1TSVA 1JUTA 1VZEA 2FTQA 3C0AA 1EV5A 3IX6A 1BQ1A 1F28A 2G8AA 1CI7A 1TYSA 1TSWA 1VZBA 5HS3A 1BP0A 1TRGA 1NJBA 1RTSA 1SEJA 1F4DA 1EVGA 4FOXA 3QGTA 4O1XA 1HW3A 1LCAA 2FTNA 1TDUA 2VF0A 3BGXA 4PSGA 3TMSA 3EF9A 2VETA 2FTOX 2G8XA 4LRRA 1HZWA 1VZAA 1TSMA 5FCTA 1DDUA 3V8HA 1TLSA 3HJ3A 4GEVA 4EZ8A 4E5OA 1JG0A 1F4CA 1J3KC 1NCEA 3EDWX 4IRRA 4EB4A 3I3RA 1TSYA 1I00A 1TVUA 3EAWX 3UM5A 1LCBA 4XSDA 3BYXA 1BKPA 4IQQA 4G2OX 4EINA 2RDAA 1FWMA 1JMGA 3IRMA 1JUJA 4KY4A 3DL5A 1TISA 3BHLA 1B5DA 1FFLA 1TSXA 3EHIX 1HVYA 4KNZA 2RD8B 3BFIA 3EGYX 1AOBA 1TSNA 1AN5A 3IHIA 2G89A 5BY6A 1F4EA 1B49A 1F4FA 3CL9A 3EBUA 4H0UA 3UM6A 3DL6A 5H38A 1NJDA 3ED7A 1BQ2A 2G86A 4XSCA 4G6WX 1TLCA 3GH2X 1AXWA 1BDUA 1HW4A 3H9KA 4FOGA 1TDAA 2TSCA 1NJEA 4DP3A 1THYA 2OIPA 4DPDA 3IK1A 1VZCA 1BPJA 1NJAA 1TVVA 3KJSA 5H39A 1EVFA 1AIQA 1JMFA 3UWLB 1JTQA 3HBBA 3N5EA 1BSFA 2RD8A 1BO7A 4IQBA 1JMIA 3HB8A 3KJRA 3QJ7A 1B5EA 2G8DA 3N5EB 2TDDA 2KCEA 3BHRA 4EILA 2TDMA 3GH0A 4JEFA 3B5BA 4O1UA 4FOAA 1BJGA 1TSLA 4XSEA 4GD7A 4KYAA 4H0RA 4KY8A 4O1XD 3KGBA 4F2VA 1BKOA 1NJCA 1TVWA 4Q0EA 4GYHA 1TSZA 3UM8A 1B02A 1EV8A 4TMSA 4FQSA 1J3IC 3EJLA 3NRRA 1SYNA 3UWLA 3IK0A 4ECKA 4DPHA 1ZPRA 1BIDA 1TDBA 4ISKA 1QQQA 3GG5A 4ISWA 1VZDA 4E28A 1KZIA 1F4GA 4H1IA 3DG8C 1TJSA 4FGTA 1JTUA 3BNZA 1AJMA 1BP6A 1J3JC 1JMHA 1TDCA 1QZFA 1YPVA 2A9WA 2BBQA 3IROA 3IRNA 1BO8A 4Q0DA 4KPWA 1F4BA 3CLBA 2AAZA 5WRNA 5H3AA 1DNAA 3IJZA 3BZ0A 3B9HA 1LCEA 4DQ1A 3DGAC 1BSPA 3C06A 3QG2A 4O7UA 3K2HA 1KCEA 5J7WA 3INVA
chains in the Genus database with same CATH superfamily
2TSRA 3JSUA 3N5GA 3OB7A 4UP1A 1JU6A 2ONBA 1TSDA 2H2QA 1KZJA 1TSVA 1JUTA 1VZEA 2FTQA 3C0AA 1EV5A 3IX6A 1BQ1A 1F28A 2G8AA 1CI7A 1TYSA 1TSWA 1VZBA 5HS3A 1BP0A 1TRGA 1NJBA 1RTSA 1SEJA 1F4DA 1EVGA 4FOXA 3QGTA 4O1XA 1HW3A 1LCAA 2FTNA 1TDUA 2VF0A 3BGXA 4PSGA 3TMSA 3EF9A 2VETA 2FTOX 2G8XA 4LRRA 1HZWA 1VZAA 1TSMA 5FCTA 1DDUA 3V8HA 1TLSA 3HJ3A 4GEVA 4EZ8A 4E5OA 1JG0A 1F4CA 1J3KC 1NCEA 3EDWX 4IRRA 4EB4A 3I3RA 1TSYA 1I00A 1TVUA 3EAWX 3UM5A 1LCBA 4XSDA 3BYXA 1BKPA 4IQQA 4G2OX 4EINA 2RDAA 1FWMA 1JMGA 3IRMA 1JUJA 4KY4A 3DL5A 1TISA 3BHLA 1B5DA 1FFLA 1TSXA 3EHIX 1HVYA 4KNZA 2RD8B 3BFIA 3EGYX 1AOBA 1TSNA 1AN5A 3IHIA 2G89A 5BY6A 1F4EA 1B49A 1F4FA 3CL9A 3EBUA 4H0UA 3UM6A 3DL6A 5H38A 1NJDA 3ED7A 1BQ2A 2G86A 4XSCA 4G6WX 1TLCA 3GH2X 1AXWA 1BDUA 1HW4A 3H9KA 4FOGA 1TDAA 2TSCA 1NJEA 4DP3A 1THYA 2OIPA 4DPDA 3IK1A 1VZCA 1BPJA 1NJAA 1TVVA 3KJSA 5H39A 1EVFA 1AIQA 1JMFA 3UWLB 1JTQA 3HBBA 3N5EA 1BSFA 2RD8A 1BO7A 4IQBA 1JMIA 3HB8A 3KJRA 3QJ7A 1B5EA 2G8DA 3N5EB 2TDDA 2KCEA 3BHRA 4EILA 2TDMA 3GH0A 4JEFA 3B5BA 4O1UA 4FOAA 1BJGA 1TSLA 4XSEA 4GD7A 4KYAA 4H0RA 4KY8A 4O1XD 3KGBA 4F2VA 1BKOA 1NJCA 1TVWA 4Q0EA 4GYHA 1TSZA 3UM8A 1B02A 1EV8A 4TMSA 4FQSA 1J3IC 3EJLA 3NRRA 1SYNA 3UWLA 3IK0A 4ECKA 4DPHA 1ZPRA 1BIDA 1TDBA 4ISKA 1QQQA 3GG5A 4ISWA 1VZDA 4E28A 1KZIA 1F4GA 4H1IA 3DG8C 1TJSA 4FGTA 1JTUA 3BNZA 1AJMA 1BP6A 1J3JC 1JMHA 1TDCA 1QZFA 1YPVA 2A9WA 2BBQA 3IROA 3IRNA 1BO8A 4Q0DA 4KPWA 1F4BA 3CLBA 2AAZA 5WRNA 5H3AA 1DNAA 3IJZA 3BZ0A 3B9HA 1LCEA 4DQ1A 3DGAC 1BSPA 3C06A 3QG2A 4O7UA 3K2HA 1KCEA 5J7WA 3INVA
chains in the Genus database with same CATH topology
2TSRA 3JSUA 3N5GA 3OB7A 4UP1A 1JU6A 2ONBA 1TSDA 2H2QA 1KZJA 1TSVA 1JUTA 1VZEA 2FTQA 3C0AA 1EV5A 3IX6A 1BQ1A 1F28A 2G8AA 1CI7A 1TYSA 1TSWA 1VZBA 5HS3A 1BP0A 1TRGA 1NJBA 1RTSA 1SEJA 1F4DA 1EVGA 4FOXA 3QGTA 4O1XA 1HW3A 1LCAA 2FTNA 1TDUA 2VF0A 3BGXA 4PSGA 3TMSA 3EF9A 2VETA 2FTOX 2G8XA 4LRRA 1HZWA 1VZAA 1TSMA 5FCTA 1DDUA 3V8HA 1TLSA 3HJ3A 4GEVA 4EZ8A 4E5OA 1JG0A 1F4CA 1J3KC 1NCEA 3EDWX 4IRRA 4EB4A 3I3RA 1TSYA 1I00A 1TVUA 3EAWX 3UM5A 1LCBA 4XSDA 3BYXA 1BKPA 4IQQA 4G2OX 4EINA 2RDAA 1FWMA 1JMGA 3IRMA 1JUJA 4KY4A 3DL5A 1TISA 3BHLA 1B5DA 1FFLA 1TSXA 3EHIX 1HVYA 4KNZA 2RD8B 3BFIA 3EGYX 1AOBA 1TSNA 1AN5A 3IHIA 2G89A 5BY6A 1F4EA 1B49A 1F4FA 3CL9A 3EBUA 4H0UA 3UM6A 3DL6A 5H38A 1NJDA 3ED7A 1BQ2A 2G86A 4XSCA 4G6WX 1TLCA 3GH2X 1AXWA 1BDUA 1HW4A 3H9KA 4FOGA 1TDAA 2TSCA 1NJEA 4DP3A 1THYA 2OIPA 4DPDA 3IK1A 1VZCA 1BPJA 1NJAA 1TVVA 3KJSA 5H39A 1EVFA 1AIQA 1JMFA 3UWLB 1JTQA 3HBBA 3N5EA 1BSFA 2RD8A 1BO7A 4IQBA 1JMIA 3HB8A 3KJRA 3QJ7A 1B5EA 2G8DA 3N5EB 2TDDA 2KCEA 3BHRA 4EILA 2TDMA 3GH0A 4JEFA 3B5BA 4O1UA 4FOAA 1BJGA 1TSLA 4XSEA 4GD7A 4KYAA 4H0RA 4KY8A 4O1XD 3KGBA 4F2VA 1BKOA 1NJCA 1TVWA 4Q0EA 4GYHA 1TSZA 3UM8A 1B02A 1EV8A 4TMSA 4FQSA 1J3IC 3EJLA 3NRRA 1SYNA 3UWLA 3IK0A 4ECKA 4DPHA 1ZPRA 1BIDA 1TDBA 4ISKA 1QQQA 3GG5A 4ISWA 1VZDA 4E28A 1KZIA 1F4GA 4H1IA 3DG8C 1TJSA 4FGTA 1JTUA 3BNZA 1AJMA 1BP6A 1J3JC 1JMHA 1TDCA 1QZFA 1YPVA 2A9WA 2BBQA 3IROA 3IRNA 1BO8A 4Q0DA 4KPWA 1F4BA 3CLBA 2AAZA 5WRNA 5H3AA 1DNAA 3IJZA 3BZ0A 3B9HA 1LCEA 4DQ1A 3DGAC 1BSPA 3C06A 3QG2A 4O7UA 3K2HA 1KCEA 5J7WA 3INVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TSR A;  3JSU A;  3N5G A;  3OB7 A;  4UP1 A;  1JU6 A;  2ONB A;  1TSD A;  2H2Q A;  1KZJ A;  1TSV A;  1JUT A;  1VZE A;  2FTQ A;  3C0A A;  1EV5 A;  3IX6 A;  1BQ1 A;  1F28 A;  2G8A A;  1CI7 A;  1TYS A;  1TSW A;  1VZB A;  5HS3 A;  1BP0 A;  1TRG A;  1NJB A;  1RTS A;  1SEJ A;  1F4D A;  1EVG A;  4FOX A;  3QGT A;  4O1X A;  1HW3 A;  1LCA A;  2FTN A;  1TDU A;  2VF0 A;  3BGX A;  4PSG A;  3TMS A;  3EF9 A;  2VET A;  2FTO X;  2G8X A;  4LRR A;  1HZW A;  1VZA A;  1TSM A;  5FCT A;  1DDU A;  3V8H A;  1TLS A;  3HJ3 A;  4GEV A;  4EZ8 A;  4E5O A;  1JG0 A;  1F4C A;  1J3K C;  1NCE A;  3EDW X;  4IRR A;  4EB4 A;  3I3R A;  1TSY A;  1I00 A;  1TVU A;  3EAW X;  3UM5 A;  1LCB A;  4XSD A;  3BYX A;  1BKP A;  4IQQ A;  4G2O X;  4EIN A;  2RDA A;  1FWM A;  1JMG A;  3IRM A;  1JUJ A;  4KY4 A;  3DL5 A;  1TIS A;  3BHL A;  1B5D A;  1FFL A;  1TSX A;  3EHI X;  1HVY A;  4KNZ A;  2RD8 B;  3BFI A;  3EGY X;  1AOB A;  1TSN A;  1AN5 A;  3IHI A;  2G89 A;  5BY6 A;  1F4E A;  1B49 A;  1F4F A;  3CL9 A;  3EBU A;  4H0U A;  3UM6 A;  3DL6 A;  5H38 A;  1NJD A;  3ED7 A;  1BQ2 A;  2G86 A;  4XSC A;  4G6W X;  1TLC A;  3GH2 X;  1AXW A;  1BDU A;  1HW4 A;  3H9K A;  4FOG A;  1TDA A;  2TSC A;  1NJE A;  4DP3 A;  1THY A;  2OIP A;  4DPD A;  3IK1 A;  1VZC A;  1BPJ A;  1NJA A;  1TVV A;  3KJS A;  5H39 A;  1EVF A;  1AIQ A;  1JMF A;  3UWL B;  1JTQ A;  3HBB A;  3N5E A;  1BSF A;  2RD8 A;  1BO7 A;  4IQB A;  1JMI A;  3HB8 A;  3KJR A;  3QJ7 A;  1B5E A;  2G8D A;  3N5E B;  2TDD A;  2KCE A;  3BHR A;  4EIL A;  2TDM A;  3GH0 A;  4JEF A;  3B5B A;  4O1U A;  4FOA A;  1BJG A;  1TSL A;  4XSE A;  4GD7 A;  4KYA A;  4H0R A;  4KY8 A;  4O1X D;  3KGB A;  4F2V A;  1BKO A;  1NJC A;  1TVW A;  4Q0E A;  4GYH A;  1TSZ A;  3UM8 A;  1B02 A;  1EV8 A;  4TMS A;  4FQS A;  1J3I C;  3EJL A;  3NRR A;  1SYN A;  3UWL A;  3IK0 A;  4ECK A;  4DPH A;  1ZPR A;  1BID A;  1TDB A;  4ISK A;  1QQQ A;  3GG5 A;  4ISW A;  1VZD A;  4E28 A;  1KZI A;  1F4G A;  4H1I A;  3DG8 C;  1TJS A;  4FGT A;  1JTU A;  3BNZ A;  1AJM A;  1BP6 A;  1J3J C;  1JMH A;  1TDC A;  1QZF A;  1YPV A;  2A9W A;  2BBQ A;  3IRO A;  3IRN A;  1BO8 A;  4Q0D A;  4KPW A;  1F4B A;  3CLB A;  2AAZ A;  5WRN A;  5H3A A;  1DNA A;  3IJZ A;  3BZ0 A;  3B9H A;  1LCE A;  4DQ1 A;  3DGA C;  1BSP A;  3C06 A;  3QG2 A;  4O7U A;  3K2H A;  1KCE A;  5J7W A;  3INV A; 
#chains in the Genus database with same CATH topology
 2TSR A;  3JSU A;  3N5G A;  3OB7 A;  4UP1 A;  1JU6 A;  2ONB A;  1TSD A;  2H2Q A;  1KZJ A;  1TSV A;  1JUT A;  1VZE A;  2FTQ A;  3C0A A;  1EV5 A;  3IX6 A;  1BQ1 A;  1F28 A;  2G8A A;  1CI7 A;  1TYS A;  1TSW A;  1VZB A;  5HS3 A;  1BP0 A;  1TRG A;  1NJB A;  1RTS A;  1SEJ A;  1F4D A;  1EVG A;  4FOX A;  3QGT A;  4O1X A;  1HW3 A;  1LCA A;  2FTN A;  1TDU A;  2VF0 A;  3BGX A;  4PSG A;  3TMS A;  3EF9 A;  2VET A;  2FTO X;  2G8X A;  4LRR A;  1HZW A;  1VZA A;  1TSM A;  5FCT A;  1DDU A;  3V8H A;  1TLS A;  3HJ3 A;  4GEV A;  4EZ8 A;  4E5O A;  1JG0 A;  1F4C A;  1J3K C;  1NCE A;  3EDW X;  4IRR A;  4EB4 A;  3I3R A;  1TSY A;  1I00 A;  1TVU A;  3EAW X;  3UM5 A;  1LCB A;  4XSD A;  3BYX A;  1BKP A;  4IQQ A;  4G2O X;  4EIN A;  2RDA A;  1FWM A;  1JMG A;  3IRM A;  1JUJ A;  4KY4 A;  3DL5 A;  1TIS A;  3BHL A;  1B5D A;  1FFL A;  1TSX A;  3EHI X;  1HVY A;  4KNZ A;  2RD8 B;  3BFI A;  3EGY X;  1AOB A;  1TSN A;  1AN5 A;  3IHI A;  2G89 A;  5BY6 A;  1F4E A;  1B49 A;  1F4F A;  3CL9 A;  3EBU A;  4H0U A;  3UM6 A;  3DL6 A;  5H38 A;  1NJD A;  3ED7 A;  1BQ2 A;  2G86 A;  4XSC A;  4G6W X;  1TLC A;  3GH2 X;  1AXW A;  1BDU A;  1HW4 A;  3H9K A;  4FOG A;  1TDA A;  2TSC A;  1NJE A;  4DP3 A;  1THY A;  2OIP A;  4DPD A;  3IK1 A;  1VZC A;  1BPJ A;  1NJA A;  1TVV A;  3KJS A;  5H39 A;  1EVF A;  1AIQ A;  1JMF A;  3UWL B;  1JTQ A;  3HBB A;  3N5E A;  1BSF A;  2RD8 A;  1BO7 A;  4IQB A;  1JMI A;  3HB8 A;  3KJR A;  3QJ7 A;  1B5E A;  2G8D A;  3N5E B;  2TDD A;  2KCE A;  3BHR A;  4EIL A;  2TDM A;  3GH0 A;  4JEF A;  3B5B A;  4O1U A;  4FOA A;  1BJG A;  1TSL A;  4XSE A;  4GD7 A;  4KYA A;  4H0R A;  4KY8 A;  4O1X D;  3KGB A;  4F2V A;  1BKO A;  1NJC A;  1TVW A;  4Q0E A;  4GYH A;  1TSZ A;  3UM8 A;  1B02 A;  1EV8 A;  4TMS A;  4FQS A;  1J3I C;  3EJL A;  3NRR A;  1SYN A;  3UWL A;  3IK0 A;  4ECK A;  4DPH A;  1ZPR A;  1BID A;  1TDB A;  4ISK A;  1QQQ A;  3GG5 A;  4ISW A;  1VZD A;  4E28 A;  1KZI A;  1F4G A;  4H1I A;  3DG8 C;  1TJS A;  4FGT A;  1JTU A;  3BNZ A;  1AJM A;  1BP6 A;  1J3J C;  1JMH A;  1TDC A;  1QZF A;  1YPV A;  2A9W A;  2BBQ A;  3IRO A;  3IRN A;  1BO8 A;  4Q0D A;  4KPW A;  1F4B A;  3CLB A;  2AAZ A;  5WRN A;  5H3A A;  1DNA A;  3IJZ A;  3BZ0 A;  3B9H A;  1LCE A;  4DQ1 A;  3DGA C;  1BSP A;  3C06 A;  3QG2 A;  4O7U A;  3K2H A;  1KCE A;  5J7W A;  3INV A; 
#chains in the Genus database with same CATH homology
 2TSR A;  3JSU A;  3N5G A;  3OB7 A;  4UP1 A;  1JU6 A;  2ONB A;  1TSD A;  2H2Q A;  1KZJ A;  1TSV A;  1JUT A;  1VZE A;  2FTQ A;  3C0A A;  1EV5 A;  3IX6 A;  1BQ1 A;  1F28 A;  2G8A A;  1CI7 A;  1TYS A;  1TSW A;  1VZB A;  5HS3 A;  1BP0 A;  1TRG A;  1NJB A;  1RTS A;  1SEJ A;  1F4D A;  1EVG A;  4FOX A;  3QGT A;  4O1X A;  1HW3 A;  1LCA A;  2FTN A;  1TDU A;  2VF0 A;  3BGX A;  4PSG A;  3TMS A;  3EF9 A;  2VET A;  2FTO X;  2G8X A;  4LRR A;  1HZW A;  1VZA A;  1TSM A;  5FCT A;  1DDU A;  3V8H A;  1TLS A;  3HJ3 A;  4GEV A;  4EZ8 A;  4E5O A;  1JG0 A;  1F4C A;  1J3K C;  1NCE A;  3EDW X;  4IRR A;  4EB4 A;  3I3R A;  1TSY A;  1I00 A;  1TVU A;  3EAW X;  3UM5 A;  1LCB A;  4XSD A;  3BYX A;  1BKP A;  4IQQ A;  4G2O X;  4EIN A;  2RDA A;  1FWM A;  1JMG A;  3IRM A;  1JUJ A;  4KY4 A;  3DL5 A;  1TIS A;  3BHL A;  1B5D A;  1FFL A;  1TSX A;  3EHI X;  1HVY A;  4KNZ A;  2RD8 B;  3BFI A;  3EGY X;  1AOB A;  1TSN A;  1AN5 A;  3IHI A;  2G89 A;  5BY6 A;  1F4E A;  1B49 A;  1F4F A;  3CL9 A;  3EBU A;  4H0U A;  3UM6 A;  3DL6 A;  5H38 A;  1NJD A;  3ED7 A;  1BQ2 A;  2G86 A;  4XSC A;  4G6W X;  1TLC A;  3GH2 X;  1AXW A;  1BDU A;  1HW4 A;  3H9K A;  4FOG A;  1TDA A;  2TSC A;  1NJE A;  4DP3 A;  1THY A;  2OIP A;  4DPD A;  3IK1 A;  1VZC A;  1BPJ A;  1NJA A;  1TVV A;  3KJS A;  5H39 A;  1EVF A;  1AIQ A;  1JMF A;  3UWL B;  1JTQ A;  3HBB A;  3N5E A;  1BSF A;  2RD8 A;  1BO7 A;  4IQB A;  1JMI A;  3HB8 A;  3KJR A;  3QJ7 A;  1B5E A;  2G8D A;  3N5E B;  2TDD A;  2KCE A;  3BHR A;  4EIL A;  2TDM A;  3GH0 A;  4JEF A;  3B5B A;  4O1U A;  4FOA A;  1BJG A;  1TSL A;  4XSE A;  4GD7 A;  4KYA A;  4H0R A;  4KY8 A;  4O1X D;  3KGB A;  4F2V A;  1BKO A;  1NJC A;  1TVW A;  4Q0E A;  4GYH A;  1TSZ A;  3UM8 A;  1B02 A;  1EV8 A;  4TMS A;  4FQS A;  1J3I C;  3EJL A;  3NRR A;  1SYN A;  3UWL A;  3IK0 A;  4ECK A;  4DPH A;  1ZPR A;  1BID A;  1TDB A;  4ISK A;  1QQQ A;  3GG5 A;  4ISW A;  1VZD A;  4E28 A;  1KZI A;  1F4G A;  4H1I A;  3DG8 C;  1TJS A;  4FGT A;  1JTU A;  3BNZ A;  1AJM A;  1BP6 A;  1J3J C;  1JMH A;  1TDC A;  1QZF A;  1YPV A;  2A9W A;  2BBQ A;  3IRO A;  3IRN A;  1BO8 A;  4Q0D A;  4KPW A;  1F4B A;  3CLB A;  2AAZ A;  5WRN A;  5H3A A;  1DNA A;  3IJZ A;  3BZ0 A;  3B9H A;  1LCE A;  4DQ1 A;  3DGA C;  1BSP A;  3C06 A;  3QG2 A;  4O7U A;  3K2H A;  1KCE A;  5J7W A;  3INV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...