3TMSA

Plastic adaptation toward mutations in proteins: structural comparison of thymidylate synthases
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
264
structure length
264
Chain Sequence
MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase (methyltransferase)
molecule keywords THYMIDYLATE SYNTHASE
publication title Plastic adaptation toward mutations in proteins: structural comparison of thymidylate synthases.
pubmed doi rcsb
source organism Escherichia coli
total genus 78
structure length 264
sequence length 264
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 1991-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 3tmsA00
1TVWA 1AXWA 1HZWA 5H39A 1TISA 1BJGA 1J3JC 1NJAA 3DGAC 4EB4A 3GH2X 5HS3A 1F4DA 3EF9A 4H0RA 4E28A 3B9HA 1F4FA 3DL5A 4H1IA 3QGTA 1FFLA 1TVUA 2TSRA 1JMGA 3N5GA 3BHRA 1NJCA 3EDWX 1JTUA 3INVA 3KGBA 3QG2A 4KYAA 2ONBA 3IK0A 1B5EA 1F4CA 3IK1A 4ECKA 3UWLB 4O1UA 3B5BA 1HVYA 1VZCA 3IJZA 1AN5A 3BFIA 4FOXA 1TDUA 2G8XA 3UM8A 1TSLA 3DL6A 4EINA 1EVGA 1BP0A 2TDDA 4PSGA 4FQSA 4XSEA 3UWLA 1F4EA 1BP6A 2FTQA 4O7UA 5H3AA 5WRNA 3KJRA 1AJMA 1B49A 2G86A 1BQ1A 1TDBA 3EHIX 1EVFA 3CLBA 3HB8A 4LRRA 4EZ8A 1JMFA 2VF0A 4G6WX 1TLCA 3EAWX 3TMSA 4FGTA 1KZIA 1QZFA 1TSXA 1BQ2A 3QJ7A 2FTOX 3KJSA 3C0AA 3ED7A 4IQQA 3DG8C 1BO8A 3EJLA 2TDMA 4ISWA 3N5EB 4XSCA 1TSVA 3UM5A 1SYNA 3GG5A 1F28A 4XSDA 3BGXA 4GYHA 5J7WA 3HBBA 1EV5A 4GD7A 1THYA 1LCEA 3H9KA 3IHIA 2TSCA 4KNZA 3BHLA 1DDUA 3K2HA 1TSWA 1KZJA 1TVVA 2AAZA 1JG0A 3IRMA 1QQQA 1DNAA 1ZPRA 2VETA 1TSMA 4KY4A 1B02A 1AIQA 1TJSA 5BY6A 1JUJA 4G2OX 5H38A 3JSUA 4GEVA 1FWMA 3GH0A 4DPDA 1BSPA 1KCEA 1YPVA 4EILA 1TRGA 2KCEA 2RDAA 1TLSA 4F2VA 4H0UA 3I3RA 2H2QA 4JEFA 1LCBA 1NJEA 1VZBA 1HW4A 1TSYA 4UP1A 1JMIA 2RD8B 1J3IC 1NCEA 3IRNA 4IQBA 3EBUA 1CI7A 3N5EA 1F4BA 1HW3A 1JMHA 1VZAA 2A9WA 1NJBA 1VZDA 1BKOA 4KY8A 4IRRA 1RTSA 4TMSA 1BKPA 3V8HA 1I00A 1BIDA 2RD8A 3BYXA 1J3KC 3EGYX 1TDAA 3IX6A 1SEJA 1BPJA 1TSDA 3NRRA 4FOGA 4O1XD 4DPHA 5FCTA 1TDCA 4Q0DA 3UM6A 1JU6A 4E5OA 4ISKA 2FTNA 1BO7A 4O1XA 3C06A 1JTQA 1LCAA 3IROA 1TYSA 2G8DA 3HJ3A 1EV8A 3CL9A 1NJDA 2BBQA 1F4GA 4DP3A 1BDUA 4DQ1A 1B5DA 2OIPA 3BZ0A 1VZEA 4KPWA 4Q0EA 1BSFA 1JUTA 2G8AA 3OB7A 1TSNA 1TSZA 2G89A 3BNZA 1AOBA 4FOAA
chains in the Genus database with same CATH superfamily
1TVWA 1AXWA 1HZWA 5H39A 1TISA 1BJGA 1J3JC 1NJAA 3DGAC 4EB4A 3GH2X 5HS3A 1F4DA 3EF9A 4H0RA 4E28A 3B9HA 1F4FA 3DL5A 4H1IA 3QGTA 1FFLA 1TVUA 2TSRA 1JMGA 3N5GA 3BHRA 1NJCA 3EDWX 1JTUA 3INVA 3KGBA 3QG2A 4KYAA 2ONBA 3IK0A 1B5EA 1F4CA 3IK1A 4ECKA 3UWLB 4O1UA 3B5BA 1HVYA 1VZCA 3IJZA 1AN5A 3BFIA 4FOXA 1TDUA 2G8XA 3UM8A 1TSLA 3DL6A 4EINA 1EVGA 1BP0A 2TDDA 4PSGA 4FQSA 4XSEA 3UWLA 1F4EA 1BP6A 2FTQA 4O7UA 5H3AA 5WRNA 3KJRA 1AJMA 1B49A 2G86A 1BQ1A 1TDBA 3EHIX 1EVFA 3CLBA 3HB8A 4LRRA 4EZ8A 1JMFA 2VF0A 4G6WX 1TLCA 3EAWX 3TMSA 4FGTA 1KZIA 1QZFA 1TSXA 1BQ2A 3QJ7A 2FTOX 3KJSA 3C0AA 3ED7A 4IQQA 3DG8C 1BO8A 3EJLA 2TDMA 4ISWA 3N5EB 4XSCA 1TSVA 3UM5A 1SYNA 3GG5A 1F28A 4XSDA 3BGXA 4GYHA 5J7WA 3HBBA 1EV5A 4GD7A 1THYA 1LCEA 3H9KA 3IHIA 2TSCA 4KNZA 3BHLA 1DDUA 3K2HA 1TSWA 1KZJA 1TVVA 2AAZA 1JG0A 3IRMA 1QQQA 1DNAA 1ZPRA 2VETA 1TSMA 4KY4A 1B02A 1AIQA 1TJSA 5BY6A 1JUJA 4G2OX 5H38A 3JSUA 4GEVA 1FWMA 3GH0A 4DPDA 1BSPA 1KCEA 1YPVA 4EILA 1TRGA 2KCEA 2RDAA 1TLSA 4F2VA 4H0UA 3I3RA 2H2QA 4JEFA 1LCBA 1NJEA 1VZBA 1HW4A 1TSYA 4UP1A 1JMIA 2RD8B 1J3IC 1NCEA 3IRNA 4IQBA 3EBUA 1CI7A 3N5EA 1F4BA 1HW3A 1JMHA 1VZAA 2A9WA 1NJBA 1VZDA 1BKOA 4KY8A 4IRRA 1RTSA 4TMSA 1BKPA 3V8HA 1I00A 1BIDA 2RD8A 3BYXA 1J3KC 3EGYX 1TDAA 3IX6A 1SEJA 1BPJA 1TSDA 3NRRA 4FOGA 4O1XD 4DPHA 5FCTA 1TDCA 4Q0DA 3UM6A 1JU6A 4E5OA 4ISKA 2FTNA 1BO7A 4O1XA 3C06A 1JTQA 1LCAA 3IROA 1TYSA 2G8DA 3HJ3A 1EV8A 3CL9A 1NJDA 2BBQA 1F4GA 4DP3A 1BDUA 4DQ1A 1B5DA 2OIPA 3BZ0A 1VZEA 4KPWA 4Q0EA 1BSFA 1JUTA 2G8AA 3OB7A 1TSNA 1TSZA 2G89A 3BNZA 1AOBA 4FOAA
chains in the Genus database with same CATH topology
1TVWA 1AXWA 1HZWA 5H39A 1TISA 1BJGA 1J3JC 1NJAA 3DGAC 4EB4A 3GH2X 5HS3A 1F4DA 3EF9A 4H0RA 4E28A 3B9HA 1F4FA 3DL5A 4H1IA 3QGTA 1FFLA 1TVUA 2TSRA 1JMGA 3N5GA 3BHRA 1NJCA 3EDWX 1JTUA 3INVA 3KGBA 3QG2A 4KYAA 2ONBA 3IK0A 1B5EA 1F4CA 3IK1A 4ECKA 3UWLB 4O1UA 3B5BA 1HVYA 1VZCA 3IJZA 1AN5A 3BFIA 4FOXA 1TDUA 2G8XA 3UM8A 1TSLA 3DL6A 4EINA 1EVGA 1BP0A 2TDDA 4PSGA 4FQSA 4XSEA 3UWLA 1F4EA 1BP6A 2FTQA 4O7UA 5H3AA 5WRNA 3KJRA 1AJMA 1B49A 2G86A 1BQ1A 1TDBA 3EHIX 1EVFA 3CLBA 3HB8A 4LRRA 4EZ8A 1JMFA 2VF0A 4G6WX 1TLCA 3EAWX 3TMSA 4FGTA 1KZIA 1QZFA 1TSXA 1BQ2A 3QJ7A 2FTOX 3KJSA 3C0AA 3ED7A 4IQQA 3DG8C 1BO8A 3EJLA 2TDMA 4ISWA 3N5EB 4XSCA 1TSVA 3UM5A 1SYNA 3GG5A 1F28A 4XSDA 3BGXA 4GYHA 5J7WA 3HBBA 1EV5A 4GD7A 1THYA 1LCEA 3H9KA 3IHIA 2TSCA 4KNZA 3BHLA 1DDUA 3K2HA 1TSWA 1KZJA 1TVVA 2AAZA 1JG0A 3IRMA 1QQQA 1DNAA 1ZPRA 2VETA 1TSMA 4KY4A 1B02A 1AIQA 1TJSA 5BY6A 1JUJA 4G2OX 5H38A 3JSUA 4GEVA 1FWMA 3GH0A 4DPDA 1BSPA 1KCEA 1YPVA 4EILA 1TRGA 2KCEA 2RDAA 1TLSA 4F2VA 4H0UA 3I3RA 2H2QA 4JEFA 1LCBA 1NJEA 1VZBA 1HW4A 1TSYA 4UP1A 1JMIA 2RD8B 1J3IC 1NCEA 3IRNA 4IQBA 3EBUA 1CI7A 3N5EA 1F4BA 1HW3A 1JMHA 1VZAA 2A9WA 1NJBA 1VZDA 1BKOA 4KY8A 4IRRA 1RTSA 4TMSA 1BKPA 3V8HA 1I00A 1BIDA 2RD8A 3BYXA 1J3KC 3EGYX 1TDAA 3IX6A 1SEJA 1BPJA 1TSDA 3NRRA 4FOGA 4O1XD 4DPHA 5FCTA 1TDCA 4Q0DA 3UM6A 1JU6A 4E5OA 4ISKA 2FTNA 1BO7A 4O1XA 3C06A 1JTQA 1LCAA 3IROA 1TYSA 2G8DA 3HJ3A 1EV8A 3CL9A 1NJDA 2BBQA 1F4GA 4DP3A 1BDUA 4DQ1A 1B5DA 2OIPA 3BZ0A 1VZEA 4KPWA 4Q0EA 1BSFA 1JUTA 2G8AA 3OB7A 1TSNA 1TSZA 2G89A 3BNZA 1AOBA 4FOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TVW A;  1AXW A;  1HZW A;  5H39 A;  1TIS A;  1BJG A;  1J3J C;  1NJA A;  3DGA C;  4EB4 A;  3GH2 X;  5HS3 A;  1F4D A;  3EF9 A;  4H0R A;  4E28 A;  3B9H A;  1F4F A;  3DL5 A;  4H1I A;  3QGT A;  1FFL A;  1TVU A;  2TSR A;  1JMG A;  3N5G A;  3BHR A;  1NJC A;  3EDW X;  1JTU A;  3INV A;  3KGB A;  3QG2 A;  4KYA A;  2ONB A;  3IK0 A;  1B5E A;  1F4C A;  3IK1 A;  4ECK A;  3UWL B;  4O1U A;  3B5B A;  1HVY A;  1VZC A;  3IJZ A;  1AN5 A;  3BFI A;  4FOX A;  1TDU A;  2G8X A;  3UM8 A;  1TSL A;  3DL6 A;  4EIN A;  1EVG A;  1BP0 A;  2TDD A;  4PSG A;  4FQS A;  4XSE A;  3UWL A;  1F4E A;  1BP6 A;  2FTQ A;  4O7U A;  5H3A A;  5WRN A;  3KJR A;  1AJM A;  1B49 A;  2G86 A;  1BQ1 A;  1TDB A;  3EHI X;  1EVF A;  3CLB A;  3HB8 A;  4LRR A;  4EZ8 A;  1JMF A;  2VF0 A;  4G6W X;  1TLC A;  3EAW X;  3TMS A;  4FGT A;  1KZI A;  1QZF A;  1TSX A;  1BQ2 A;  3QJ7 A;  2FTO X;  3KJS A;  3C0A A;  3ED7 A;  4IQQ A;  3DG8 C;  1BO8 A;  3EJL A;  2TDM A;  4ISW A;  3N5E B;  4XSC A;  1TSV A;  3UM5 A;  1SYN A;  3GG5 A;  1F28 A;  4XSD A;  3BGX A;  4GYH A;  5J7W A;  3HBB A;  1EV5 A;  4GD7 A;  1THY A;  1LCE A;  3H9K A;  3IHI A;  2TSC A;  4KNZ A;  3BHL A;  1DDU A;  3K2H A;  1TSW A;  1KZJ A;  1TVV A;  2AAZ A;  1JG0 A;  3IRM A;  1QQQ A;  1DNA A;  1ZPR A;  2VET A;  1TSM A;  4KY4 A;  1B02 A;  1AIQ A;  1TJS A;  5BY6 A;  1JUJ A;  4G2O X;  5H38 A;  3JSU A;  4GEV A;  1FWM A;  3GH0 A;  4DPD A;  1BSP A;  1KCE A;  1YPV A;  4EIL A;  1TRG A;  2KCE A;  2RDA A;  1TLS A;  4F2V A;  4H0U A;  3I3R A;  2H2Q A;  4JEF A;  1LCB A;  1NJE A;  1VZB A;  1HW4 A;  1TSY A;  4UP1 A;  1JMI A;  2RD8 B;  1J3I C;  1NCE A;  3IRN A;  4IQB A;  3EBU A;  1CI7 A;  3N5E A;  1F4B A;  1HW3 A;  1JMH A;  1VZA A;  2A9W A;  1NJB A;  1VZD A;  1BKO A;  4KY8 A;  4IRR A;  1RTS A;  4TMS A;  1BKP A;  3V8H A;  1I00 A;  1BID A;  2RD8 A;  3BYX A;  1J3K C;  3EGY X;  1TDA A;  3IX6 A;  1SEJ A;  1BPJ A;  1TSD A;  3NRR A;  4FOG A;  4O1X D;  4DPH A;  5FCT A;  1TDC A;  4Q0D A;  3UM6 A;  1JU6 A;  4E5O A;  4ISK A;  2FTN A;  1BO7 A;  4O1X A;  3C06 A;  1JTQ A;  1LCA A;  3IRO A;  1TYS A;  2G8D A;  3HJ3 A;  1EV8 A;  3CL9 A;  1NJD A;  2BBQ A;  1F4G A;  4DP3 A;  1BDU A;  4DQ1 A;  1B5D A;  2OIP A;  3BZ0 A;  1VZE A;  4KPW A;  4Q0E A;  1BSF A;  1JUT A;  2G8A A;  3OB7 A;  1TSN A;  1TSZ A;  2G89 A;  3BNZ A;  1AOB A;  4FOA A; 
#chains in the Genus database with same CATH topology
 1TVW A;  1AXW A;  1HZW A;  5H39 A;  1TIS A;  1BJG A;  1J3J C;  1NJA A;  3DGA C;  4EB4 A;  3GH2 X;  5HS3 A;  1F4D A;  3EF9 A;  4H0R A;  4E28 A;  3B9H A;  1F4F A;  3DL5 A;  4H1I A;  3QGT A;  1FFL A;  1TVU A;  2TSR A;  1JMG A;  3N5G A;  3BHR A;  1NJC A;  3EDW X;  1JTU A;  3INV A;  3KGB A;  3QG2 A;  4KYA A;  2ONB A;  3IK0 A;  1B5E A;  1F4C A;  3IK1 A;  4ECK A;  3UWL B;  4O1U A;  3B5B A;  1HVY A;  1VZC A;  3IJZ A;  1AN5 A;  3BFI A;  4FOX A;  1TDU A;  2G8X A;  3UM8 A;  1TSL A;  3DL6 A;  4EIN A;  1EVG A;  1BP0 A;  2TDD A;  4PSG A;  4FQS A;  4XSE A;  3UWL A;  1F4E A;  1BP6 A;  2FTQ A;  4O7U A;  5H3A A;  5WRN A;  3KJR A;  1AJM A;  1B49 A;  2G86 A;  1BQ1 A;  1TDB A;  3EHI X;  1EVF A;  3CLB A;  3HB8 A;  4LRR A;  4EZ8 A;  1JMF A;  2VF0 A;  4G6W X;  1TLC A;  3EAW X;  3TMS A;  4FGT A;  1KZI A;  1QZF A;  1TSX A;  1BQ2 A;  3QJ7 A;  2FTO X;  3KJS A;  3C0A A;  3ED7 A;  4IQQ A;  3DG8 C;  1BO8 A;  3EJL A;  2TDM A;  4ISW A;  3N5E B;  4XSC A;  1TSV A;  3UM5 A;  1SYN A;  3GG5 A;  1F28 A;  4XSD A;  3BGX A;  4GYH A;  5J7W A;  3HBB A;  1EV5 A;  4GD7 A;  1THY A;  1LCE A;  3H9K A;  3IHI A;  2TSC A;  4KNZ A;  3BHL A;  1DDU A;  3K2H A;  1TSW A;  1KZJ A;  1TVV A;  2AAZ A;  1JG0 A;  3IRM A;  1QQQ A;  1DNA A;  1ZPR A;  2VET A;  1TSM A;  4KY4 A;  1B02 A;  1AIQ A;  1TJS A;  5BY6 A;  1JUJ A;  4G2O X;  5H38 A;  3JSU A;  4GEV A;  1FWM A;  3GH0 A;  4DPD A;  1BSP A;  1KCE A;  1YPV A;  4EIL A;  1TRG A;  2KCE A;  2RDA A;  1TLS A;  4F2V A;  4H0U A;  3I3R A;  2H2Q A;  4JEF A;  1LCB A;  1NJE A;  1VZB A;  1HW4 A;  1TSY A;  4UP1 A;  1JMI A;  2RD8 B;  1J3I C;  1NCE A;  3IRN A;  4IQB A;  3EBU A;  1CI7 A;  3N5E A;  1F4B A;  1HW3 A;  1JMH A;  1VZA A;  2A9W A;  1NJB A;  1VZD A;  1BKO A;  4KY8 A;  4IRR A;  1RTS A;  4TMS A;  1BKP A;  3V8H A;  1I00 A;  1BID A;  2RD8 A;  3BYX A;  1J3K C;  3EGY X;  1TDA A;  3IX6 A;  1SEJ A;  1BPJ A;  1TSD A;  3NRR A;  4FOG A;  4O1X D;  4DPH A;  5FCT A;  1TDC A;  4Q0D A;  3UM6 A;  1JU6 A;  4E5O A;  4ISK A;  2FTN A;  1BO7 A;  4O1X A;  3C06 A;  1JTQ A;  1LCA A;  3IRO A;  1TYS A;  2G8D A;  3HJ3 A;  1EV8 A;  3CL9 A;  1NJD A;  2BBQ A;  1F4G A;  4DP3 A;  1BDU A;  4DQ1 A;  1B5D A;  2OIP A;  3BZ0 A;  1VZE A;  4KPW A;  4Q0E A;  1BSF A;  1JUT A;  2G8A A;  3OB7 A;  1TSN A;  1TSZ A;  2G89 A;  3BNZ A;  1AOB A;  4FOA A; 
#chains in the Genus database with same CATH homology
 1TVW A;  1AXW A;  1HZW A;  5H39 A;  1TIS A;  1BJG A;  1J3J C;  1NJA A;  3DGA C;  4EB4 A;  3GH2 X;  5HS3 A;  1F4D A;  3EF9 A;  4H0R A;  4E28 A;  3B9H A;  1F4F A;  3DL5 A;  4H1I A;  3QGT A;  1FFL A;  1TVU A;  2TSR A;  1JMG A;  3N5G A;  3BHR A;  1NJC A;  3EDW X;  1JTU A;  3INV A;  3KGB A;  3QG2 A;  4KYA A;  2ONB A;  3IK0 A;  1B5E A;  1F4C A;  3IK1 A;  4ECK A;  3UWL B;  4O1U A;  3B5B A;  1HVY A;  1VZC A;  3IJZ A;  1AN5 A;  3BFI A;  4FOX A;  1TDU A;  2G8X A;  3UM8 A;  1TSL A;  3DL6 A;  4EIN A;  1EVG A;  1BP0 A;  2TDD A;  4PSG A;  4FQS A;  4XSE A;  3UWL A;  1F4E A;  1BP6 A;  2FTQ A;  4O7U A;  5H3A A;  5WRN A;  3KJR A;  1AJM A;  1B49 A;  2G86 A;  1BQ1 A;  1TDB A;  3EHI X;  1EVF A;  3CLB A;  3HB8 A;  4LRR A;  4EZ8 A;  1JMF A;  2VF0 A;  4G6W X;  1TLC A;  3EAW X;  3TMS A;  4FGT A;  1KZI A;  1QZF A;  1TSX A;  1BQ2 A;  3QJ7 A;  2FTO X;  3KJS A;  3C0A A;  3ED7 A;  4IQQ A;  3DG8 C;  1BO8 A;  3EJL A;  2TDM A;  4ISW A;  3N5E B;  4XSC A;  1TSV A;  3UM5 A;  1SYN A;  3GG5 A;  1F28 A;  4XSD A;  3BGX A;  4GYH A;  5J7W A;  3HBB A;  1EV5 A;  4GD7 A;  1THY A;  1LCE A;  3H9K A;  3IHI A;  2TSC A;  4KNZ A;  3BHL A;  1DDU A;  3K2H A;  1TSW A;  1KZJ A;  1TVV A;  2AAZ A;  1JG0 A;  3IRM A;  1QQQ A;  1DNA A;  1ZPR A;  2VET A;  1TSM A;  4KY4 A;  1B02 A;  1AIQ A;  1TJS A;  5BY6 A;  1JUJ A;  4G2O X;  5H38 A;  3JSU A;  4GEV A;  1FWM A;  3GH0 A;  4DPD A;  1BSP A;  1KCE A;  1YPV A;  4EIL A;  1TRG A;  2KCE A;  2RDA A;  1TLS A;  4F2V A;  4H0U A;  3I3R A;  2H2Q A;  4JEF A;  1LCB A;  1NJE A;  1VZB A;  1HW4 A;  1TSY A;  4UP1 A;  1JMI A;  2RD8 B;  1J3I C;  1NCE A;  3IRN A;  4IQB A;  3EBU A;  1CI7 A;  3N5E A;  1F4B A;  1HW3 A;  1JMH A;  1VZA A;  2A9W A;  1NJB A;  1VZD A;  1BKO A;  4KY8 A;  4IRR A;  1RTS A;  4TMS A;  1BKP A;  3V8H A;  1I00 A;  1BID A;  2RD8 A;  3BYX A;  1J3K C;  3EGY X;  1TDA A;  3IX6 A;  1SEJ A;  1BPJ A;  1TSD A;  3NRR A;  4FOG A;  4O1X D;  4DPH A;  5FCT A;  1TDC A;  4Q0D A;  3UM6 A;  1JU6 A;  4E5O A;  4ISK A;  2FTN A;  1BO7 A;  4O1X A;  3C06 A;  1JTQ A;  1LCA A;  3IRO A;  1TYS A;  2G8D A;  3HJ3 A;  1EV8 A;  3CL9 A;  1NJD A;  2BBQ A;  1F4G A;  4DP3 A;  1BDU A;  4DQ1 A;  1B5D A;  2OIP A;  3BZ0 A;  1VZE A;  4KPW A;  4Q0E A;  1BSF A;  1JUT A;  2G8A A;  3OB7 A;  1TSN A;  1TSZ A;  2G89 A;  3BNZ A;  1AOB A;  4FOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...