3UWLA

Crystal structure of enteroccocus faecalis thymidylate synthase (efts) in complex with 5-formyl tetrahydrofolate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
313
structure length
292
Chain Sequence
MEEAYLALGKKILEEGHFKEDRTGTGTYSLFGYQMRFDLAKGFPLLTTKRVPFGLIKSELLWFLKGDTNIRYLLERNNHIWDEWAFERYVKSADYQGEEHQKFCDAILNDAEFAEKYGELGNIYGAQWRHWETKDGSFIDQLANVIEMIKTNPDSRRLIVSAWNPEDVPSMALPPCHTMFQFYVNEGKLSCQLYQRSADVFLGVPFNIASYALLTHLIAHETGLEVGEFVHTLGDAHLYQNHVEQMQEQLSREVRSFPTLVLNPDKASVFDFDMEDIKVEGYDPHPTIKAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase
publication title The structure of Enterococcus faecalis thymidylate synthase provides clues about folate bacterial metabolism.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 92
structure length 292
sequence length 313
chains with identical sequence C
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 3uwlA00
3BHLA 1BJGA 3BFIA 3UM5A 1AOBA 4KY8A 2FTOX 1BQ1A 3GH0A 3C06A 2FTQA 4O7UA 1EV5A 1JUJA 1JTQA 3BHRA 3EHIX 3HBBA 4Q0EA 1BSFA 3DL5A 4DP3A 1F4GA 3IROA 1EVGA 3EBUA 3INVA 3N5EB 4FOXA 2TSRA 2TDMA 2VETA 3DL6A 4FOGA 3NRRA 1B5EA 4KY4A 4KNZA 1F4FA 3EGYX 1F4EA 1QZFA 1TVUA 1TJSA 1NJDA 4XSDA 3EJLA 1AXWA 4EZ8A 1THYA 2VF0A 1VZEA 3BZ0A 3IRMA 4E5OA 1BKPA 2TSCA 4F2VA 5FCTA 3IK1A 1CI7A 1FWMA 1BDUA 3B9HA 1JG0A 1F4DA 4H0RA 1TLSA 1KZJA 1SEJA 1I00A 1BSPA 1JU6A 2RDAA 3UM8A 1AN5A 1TRGA 1TSNA 1AJMA 4DQ1A 5BY6A 2TDDA 1HZWA 1B49A 1VZDA 3I3RA 1QQQA 2AAZA 2G86A 3IX6A 3CLBA 1TDUA 3QJ7A 4FQSA 4H1IA 3IK0A 4PSGA 4LRRA 4EB4A 1LCAA 1TDAA 2G8DA 4IQQA 1TISA 1KCEA 1JTUA 1ZPRA 1VZAA 1BPJA 1JMIA 1NJAA 1B5DA 3KJRA 1TSYA 1F4CA 4EILA 1J3KC 1KZIA 4EINA 1LCEA 4IQBA 4FGTA 3BGXA 1TYSA 1TSZA 4JEFA 1SYNA 4GEVA 3UWLA 4XSCA 3K2HA 2RD8B 3BNZA 1EVFA 5J7WA 1TLCA 3H9KA 1NJCA 3UM6A 1J3IC 1J3JC 1TSDA 4TMSA 3EDWX 1DDUA 2G8XA 3GH2X 5H3AA 1BO7A 4O1UA 1TSXA 3DGAC 2KCEA 1VZBA 1TSWA 1TDBA 3B5BA 3EAWX 3QGTA 3EF9A 4GYHA 2G89A 4O1XD 1EV8A 2RD8A 1TDCA 1TSVA 4FOAA 1LCBA 4G2OX 4UP1A 1F28A 1TSMA 1TVWA 3HB8A 4GD7A 4Q0DA 3GG5A 1TSLA 4XSEA 3UWLB 4KPWA 1HW3A 4DPDA 1JMHA 1JUTA 1JMFA 2BBQA 1BQ2A 3HJ3A 3OB7A 1BP0A 1BP6A 1JMGA 1BIDA 3ED7A 4DPHA 5HS3A 5H38A 5H39A 3N5GA 1NCEA 5WRNA 3KGBA 3CL9A 4ISWA 4G6WX 3JSUA 4H0UA 3C0AA 2A9WA 3IRNA 2G8AA 4KYAA 3DG8C 4E28A 1VZCA 2OIPA 4ECKA 3V8HA 1HVYA 3QG2A 3IHIA 3IJZA 1BO8A 2FTNA 1BKOA 4O1XA 4IRRA 1HW4A 1NJBA 4ISKA 3TMSA 1DNAA 1TVVA 1NJEA 1B02A 1YPVA 3KJSA 3BYXA 1AIQA 1FFLA 3N5EA 2H2QA 1F4BA 2ONBA 1RTSA
chains in the Genus database with same CATH superfamily
3BHLA 1BJGA 3BFIA 3UM5A 1AOBA 4KY8A 2FTOX 1BQ1A 3GH0A 3C06A 2FTQA 4O7UA 1EV5A 1JUJA 1JTQA 3BHRA 3EHIX 3HBBA 4Q0EA 1BSFA 3DL5A 4DP3A 1F4GA 3IROA 1EVGA 3EBUA 3INVA 3N5EB 4FOXA 2TSRA 2TDMA 2VETA 3DL6A 4FOGA 3NRRA 1B5EA 4KY4A 4KNZA 1F4FA 3EGYX 1F4EA 1QZFA 1TVUA 1TJSA 1NJDA 4XSDA 3EJLA 1AXWA 4EZ8A 1THYA 2VF0A 1VZEA 3BZ0A 3IRMA 4E5OA 1BKPA 2TSCA 4F2VA 5FCTA 3IK1A 1CI7A 1FWMA 1BDUA 3B9HA 1JG0A 1F4DA 4H0RA 1TLSA 1KZJA 1SEJA 1I00A 1BSPA 1JU6A 2RDAA 3UM8A 1AN5A 1TRGA 1TSNA 1AJMA 4DQ1A 5BY6A 2TDDA 1HZWA 1B49A 1VZDA 3I3RA 1QQQA 2AAZA 2G86A 3IX6A 3CLBA 1TDUA 3QJ7A 4FQSA 4H1IA 3IK0A 4PSGA 4LRRA 4EB4A 1LCAA 1TDAA 2G8DA 4IQQA 1TISA 1KCEA 1JTUA 1ZPRA 1VZAA 1BPJA 1JMIA 1NJAA 1B5DA 3KJRA 1TSYA 1F4CA 4EILA 1J3KC 1KZIA 4EINA 1LCEA 4IQBA 4FGTA 3BGXA 1TYSA 1TSZA 4JEFA 1SYNA 4GEVA 3UWLA 4XSCA 3K2HA 2RD8B 3BNZA 1EVFA 5J7WA 1TLCA 3H9KA 1NJCA 3UM6A 1J3IC 1J3JC 1TSDA 4TMSA 3EDWX 1DDUA 2G8XA 3GH2X 5H3AA 1BO7A 4O1UA 1TSXA 3DGAC 2KCEA 1VZBA 1TSWA 1TDBA 3B5BA 3EAWX 3QGTA 3EF9A 4GYHA 2G89A 4O1XD 1EV8A 2RD8A 1TDCA 1TSVA 4FOAA 1LCBA 4G2OX 4UP1A 1F28A 1TSMA 1TVWA 3HB8A 4GD7A 4Q0DA 3GG5A 1TSLA 4XSEA 3UWLB 4KPWA 1HW3A 4DPDA 1JMHA 1JUTA 1JMFA 2BBQA 1BQ2A 3HJ3A 3OB7A 1BP0A 1BP6A 1JMGA 1BIDA 3ED7A 4DPHA 5HS3A 5H38A 5H39A 3N5GA 1NCEA 5WRNA 3KGBA 3CL9A 4ISWA 4G6WX 3JSUA 4H0UA 3C0AA 2A9WA 3IRNA 2G8AA 4KYAA 3DG8C 4E28A 1VZCA 2OIPA 4ECKA 3V8HA 1HVYA 3QG2A 3IHIA 3IJZA 1BO8A 2FTNA 1BKOA 4O1XA 4IRRA 1HW4A 1NJBA 4ISKA 3TMSA 1DNAA 1TVVA 1NJEA 1B02A 1YPVA 3KJSA 3BYXA 1AIQA 1FFLA 3N5EA 2H2QA 1F4BA 2ONBA 1RTSA
chains in the Genus database with same CATH topology
3BHLA 1BJGA 3BFIA 3UM5A 1AOBA 4KY8A 2FTOX 1BQ1A 3GH0A 3C06A 2FTQA 4O7UA 1EV5A 1JUJA 1JTQA 3BHRA 3EHIX 3HBBA 4Q0EA 1BSFA 3DL5A 4DP3A 1F4GA 3IROA 1EVGA 3EBUA 3INVA 3N5EB 4FOXA 2TSRA 2TDMA 2VETA 3DL6A 4FOGA 3NRRA 1B5EA 4KY4A 4KNZA 1F4FA 3EGYX 1F4EA 1QZFA 1TVUA 1TJSA 1NJDA 4XSDA 3EJLA 1AXWA 4EZ8A 1THYA 2VF0A 1VZEA 3BZ0A 3IRMA 4E5OA 1BKPA 2TSCA 4F2VA 5FCTA 3IK1A 1CI7A 1FWMA 1BDUA 3B9HA 1JG0A 1F4DA 4H0RA 1TLSA 1KZJA 1SEJA 1I00A 1BSPA 1JU6A 2RDAA 3UM8A 1AN5A 1TRGA 1TSNA 1AJMA 4DQ1A 5BY6A 2TDDA 1HZWA 1B49A 1VZDA 3I3RA 1QQQA 2AAZA 2G86A 3IX6A 3CLBA 1TDUA 3QJ7A 4FQSA 4H1IA 3IK0A 4PSGA 4LRRA 4EB4A 1LCAA 1TDAA 2G8DA 4IQQA 1TISA 1KCEA 1JTUA 1ZPRA 1VZAA 1BPJA 1JMIA 1NJAA 1B5DA 3KJRA 1TSYA 1F4CA 4EILA 1J3KC 1KZIA 4EINA 1LCEA 4IQBA 4FGTA 3BGXA 1TYSA 1TSZA 4JEFA 1SYNA 4GEVA 3UWLA 4XSCA 3K2HA 2RD8B 3BNZA 1EVFA 5J7WA 1TLCA 3H9KA 1NJCA 3UM6A 1J3IC 1J3JC 1TSDA 4TMSA 3EDWX 1DDUA 2G8XA 3GH2X 5H3AA 1BO7A 4O1UA 1TSXA 3DGAC 2KCEA 1VZBA 1TSWA 1TDBA 3B5BA 3EAWX 3QGTA 3EF9A 4GYHA 2G89A 4O1XD 1EV8A 2RD8A 1TDCA 1TSVA 4FOAA 1LCBA 4G2OX 4UP1A 1F28A 1TSMA 1TVWA 3HB8A 4GD7A 4Q0DA 3GG5A 1TSLA 4XSEA 3UWLB 4KPWA 1HW3A 4DPDA 1JMHA 1JUTA 1JMFA 2BBQA 1BQ2A 3HJ3A 3OB7A 1BP0A 1BP6A 1JMGA 1BIDA 3ED7A 4DPHA 5HS3A 5H38A 5H39A 3N5GA 1NCEA 5WRNA 3KGBA 3CL9A 4ISWA 4G6WX 3JSUA 4H0UA 3C0AA 2A9WA 3IRNA 2G8AA 4KYAA 3DG8C 4E28A 1VZCA 2OIPA 4ECKA 3V8HA 1HVYA 3QG2A 3IHIA 3IJZA 1BO8A 2FTNA 1BKOA 4O1XA 4IRRA 1HW4A 1NJBA 4ISKA 3TMSA 1DNAA 1TVVA 1NJEA 1B02A 1YPVA 3KJSA 3BYXA 1AIQA 1FFLA 3N5EA 2H2QA 1F4BA 2ONBA 1RTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BHL A;  1BJG A;  3BFI A;  3UM5 A;  1AOB A;  4KY8 A;  2FTO X;  1BQ1 A;  3GH0 A;  3C06 A;  2FTQ A;  4O7U A;  1EV5 A;  1JUJ A;  1JTQ A;  3BHR A;  3EHI X;  3HBB A;  4Q0E A;  1BSF A;  3DL5 A;  4DP3 A;  1F4G A;  3IRO A;  1EVG A;  3EBU A;  3INV A;  3N5E B;  4FOX A;  2TSR A;  2TDM A;  2VET A;  3DL6 A;  4FOG A;  3NRR A;  1B5E A;  4KY4 A;  4KNZ A;  1F4F A;  3EGY X;  1F4E A;  1QZF A;  1TVU A;  1TJS A;  1NJD A;  4XSD A;  3EJL A;  1AXW A;  4EZ8 A;  1THY A;  2VF0 A;  1VZE A;  3BZ0 A;  3IRM A;  4E5O A;  1BKP A;  2TSC A;  4F2V A;  5FCT A;  3IK1 A;  1CI7 A;  1FWM A;  1BDU A;  3B9H A;  1JG0 A;  1F4D A;  4H0R A;  1TLS A;  1KZJ A;  1SEJ A;  1I00 A;  1BSP A;  1JU6 A;  2RDA A;  3UM8 A;  1AN5 A;  1TRG A;  1TSN A;  1AJM A;  4DQ1 A;  5BY6 A;  2TDD A;  1HZW A;  1B49 A;  1VZD A;  3I3R A;  1QQQ A;  2AAZ A;  2G86 A;  3IX6 A;  3CLB A;  1TDU A;  3QJ7 A;  4FQS A;  4H1I A;  3IK0 A;  4PSG A;  4LRR A;  4EB4 A;  1LCA A;  1TDA A;  2G8D A;  4IQQ A;  1TIS A;  1KCE A;  1JTU A;  1ZPR A;  1VZA A;  1BPJ A;  1JMI A;  1NJA A;  1B5D A;  3KJR A;  1TSY A;  1F4C A;  4EIL A;  1J3K C;  1KZI A;  4EIN A;  1LCE A;  4IQB A;  4FGT A;  3BGX A;  1TYS A;  1TSZ A;  4JEF A;  1SYN A;  4GEV A;  3UWL A;  4XSC A;  3K2H A;  2RD8 B;  3BNZ A;  1EVF A;  5J7W A;  1TLC A;  3H9K A;  1NJC A;  3UM6 A;  1J3I C;  1J3J C;  1TSD A;  4TMS A;  3EDW X;  1DDU A;  2G8X A;  3GH2 X;  5H3A A;  1BO7 A;  4O1U A;  1TSX A;  3DGA C;  2KCE A;  1VZB A;  1TSW A;  1TDB A;  3B5B A;  3EAW X;  3QGT A;  3EF9 A;  4GYH A;  2G89 A;  4O1X D;  1EV8 A;  2RD8 A;  1TDC A;  1TSV A;  4FOA A;  1LCB A;  4G2O X;  4UP1 A;  1F28 A;  1TSM A;  1TVW A;  3HB8 A;  4GD7 A;  4Q0D A;  3GG5 A;  1TSL A;  4XSE A;  3UWL B;  4KPW A;  1HW3 A;  4DPD A;  1JMH A;  1JUT A;  1JMF A;  2BBQ A;  1BQ2 A;  3HJ3 A;  3OB7 A;  1BP0 A;  1BP6 A;  1JMG A;  1BID A;  3ED7 A;  4DPH A;  5HS3 A;  5H38 A;  5H39 A;  3N5G A;  1NCE A;  5WRN A;  3KGB A;  3CL9 A;  4ISW A;  4G6W X;  3JSU A;  4H0U A;  3C0A A;  2A9W A;  3IRN A;  2G8A A;  4KYA A;  3DG8 C;  4E28 A;  1VZC A;  2OIP A;  4ECK A;  3V8H A;  1HVY A;  3QG2 A;  3IHI A;  3IJZ A;  1BO8 A;  2FTN A;  1BKO A;  4O1X A;  4IRR A;  1HW4 A;  1NJB A;  4ISK A;  3TMS A;  1DNA A;  1TVV A;  1NJE A;  1B02 A;  1YPV A;  3KJS A;  3BYX A;  1AIQ A;  1FFL A;  3N5E A;  2H2Q A;  1F4B A;  2ONB A;  1RTS A; 
#chains in the Genus database with same CATH topology
 3BHL A;  1BJG A;  3BFI A;  3UM5 A;  1AOB A;  4KY8 A;  2FTO X;  1BQ1 A;  3GH0 A;  3C06 A;  2FTQ A;  4O7U A;  1EV5 A;  1JUJ A;  1JTQ A;  3BHR A;  3EHI X;  3HBB A;  4Q0E A;  1BSF A;  3DL5 A;  4DP3 A;  1F4G A;  3IRO A;  1EVG A;  3EBU A;  3INV A;  3N5E B;  4FOX A;  2TSR A;  2TDM A;  2VET A;  3DL6 A;  4FOG A;  3NRR A;  1B5E A;  4KY4 A;  4KNZ A;  1F4F A;  3EGY X;  1F4E A;  1QZF A;  1TVU A;  1TJS A;  1NJD A;  4XSD A;  3EJL A;  1AXW A;  4EZ8 A;  1THY A;  2VF0 A;  1VZE A;  3BZ0 A;  3IRM A;  4E5O A;  1BKP A;  2TSC A;  4F2V A;  5FCT A;  3IK1 A;  1CI7 A;  1FWM A;  1BDU A;  3B9H A;  1JG0 A;  1F4D A;  4H0R A;  1TLS A;  1KZJ A;  1SEJ A;  1I00 A;  1BSP A;  1JU6 A;  2RDA A;  3UM8 A;  1AN5 A;  1TRG A;  1TSN A;  1AJM A;  4DQ1 A;  5BY6 A;  2TDD A;  1HZW A;  1B49 A;  1VZD A;  3I3R A;  1QQQ A;  2AAZ A;  2G86 A;  3IX6 A;  3CLB A;  1TDU A;  3QJ7 A;  4FQS A;  4H1I A;  3IK0 A;  4PSG A;  4LRR A;  4EB4 A;  1LCA A;  1TDA A;  2G8D A;  4IQQ A;  1TIS A;  1KCE A;  1JTU A;  1ZPR A;  1VZA A;  1BPJ A;  1JMI A;  1NJA A;  1B5D A;  3KJR A;  1TSY A;  1F4C A;  4EIL A;  1J3K C;  1KZI A;  4EIN A;  1LCE A;  4IQB A;  4FGT A;  3BGX A;  1TYS A;  1TSZ A;  4JEF A;  1SYN A;  4GEV A;  3UWL A;  4XSC A;  3K2H A;  2RD8 B;  3BNZ A;  1EVF A;  5J7W A;  1TLC A;  3H9K A;  1NJC A;  3UM6 A;  1J3I C;  1J3J C;  1TSD A;  4TMS A;  3EDW X;  1DDU A;  2G8X A;  3GH2 X;  5H3A A;  1BO7 A;  4O1U A;  1TSX A;  3DGA C;  2KCE A;  1VZB A;  1TSW A;  1TDB A;  3B5B A;  3EAW X;  3QGT A;  3EF9 A;  4GYH A;  2G89 A;  4O1X D;  1EV8 A;  2RD8 A;  1TDC A;  1TSV A;  4FOA A;  1LCB A;  4G2O X;  4UP1 A;  1F28 A;  1TSM A;  1TVW A;  3HB8 A;  4GD7 A;  4Q0D A;  3GG5 A;  1TSL A;  4XSE A;  3UWL B;  4KPW A;  1HW3 A;  4DPD A;  1JMH A;  1JUT A;  1JMF A;  2BBQ A;  1BQ2 A;  3HJ3 A;  3OB7 A;  1BP0 A;  1BP6 A;  1JMG A;  1BID A;  3ED7 A;  4DPH A;  5HS3 A;  5H38 A;  5H39 A;  3N5G A;  1NCE A;  5WRN A;  3KGB A;  3CL9 A;  4ISW A;  4G6W X;  3JSU A;  4H0U A;  3C0A A;  2A9W A;  3IRN A;  2G8A A;  4KYA A;  3DG8 C;  4E28 A;  1VZC A;  2OIP A;  4ECK A;  3V8H A;  1HVY A;  3QG2 A;  3IHI A;  3IJZ A;  1BO8 A;  2FTN A;  1BKO A;  4O1X A;  4IRR A;  1HW4 A;  1NJB A;  4ISK A;  3TMS A;  1DNA A;  1TVV A;  1NJE A;  1B02 A;  1YPV A;  3KJS A;  3BYX A;  1AIQ A;  1FFL A;  3N5E A;  2H2Q A;  1F4B A;  2ONB A;  1RTS A; 
#chains in the Genus database with same CATH homology
 3BHL A;  1BJG A;  3BFI A;  3UM5 A;  1AOB A;  4KY8 A;  2FTO X;  1BQ1 A;  3GH0 A;  3C06 A;  2FTQ A;  4O7U A;  1EV5 A;  1JUJ A;  1JTQ A;  3BHR A;  3EHI X;  3HBB A;  4Q0E A;  1BSF A;  3DL5 A;  4DP3 A;  1F4G A;  3IRO A;  1EVG A;  3EBU A;  3INV A;  3N5E B;  4FOX A;  2TSR A;  2TDM A;  2VET A;  3DL6 A;  4FOG A;  3NRR A;  1B5E A;  4KY4 A;  4KNZ A;  1F4F A;  3EGY X;  1F4E A;  1QZF A;  1TVU A;  1TJS A;  1NJD A;  4XSD A;  3EJL A;  1AXW A;  4EZ8 A;  1THY A;  2VF0 A;  1VZE A;  3BZ0 A;  3IRM A;  4E5O A;  1BKP A;  2TSC A;  4F2V A;  5FCT A;  3IK1 A;  1CI7 A;  1FWM A;  1BDU A;  3B9H A;  1JG0 A;  1F4D A;  4H0R A;  1TLS A;  1KZJ A;  1SEJ A;  1I00 A;  1BSP A;  1JU6 A;  2RDA A;  3UM8 A;  1AN5 A;  1TRG A;  1TSN A;  1AJM A;  4DQ1 A;  5BY6 A;  2TDD A;  1HZW A;  1B49 A;  1VZD A;  3I3R A;  1QQQ A;  2AAZ A;  2G86 A;  3IX6 A;  3CLB A;  1TDU A;  3QJ7 A;  4FQS A;  4H1I A;  3IK0 A;  4PSG A;  4LRR A;  4EB4 A;  1LCA A;  1TDA A;  2G8D A;  4IQQ A;  1TIS A;  1KCE A;  1JTU A;  1ZPR A;  1VZA A;  1BPJ A;  1JMI A;  1NJA A;  1B5D A;  3KJR A;  1TSY A;  1F4C A;  4EIL A;  1J3K C;  1KZI A;  4EIN A;  1LCE A;  4IQB A;  4FGT A;  3BGX A;  1TYS A;  1TSZ A;  4JEF A;  1SYN A;  4GEV A;  3UWL A;  4XSC A;  3K2H A;  2RD8 B;  3BNZ A;  1EVF A;  5J7W A;  1TLC A;  3H9K A;  1NJC A;  3UM6 A;  1J3I C;  1J3J C;  1TSD A;  4TMS A;  3EDW X;  1DDU A;  2G8X A;  3GH2 X;  5H3A A;  1BO7 A;  4O1U A;  1TSX A;  3DGA C;  2KCE A;  1VZB A;  1TSW A;  1TDB A;  3B5B A;  3EAW X;  3QGT A;  3EF9 A;  4GYH A;  2G89 A;  4O1X D;  1EV8 A;  2RD8 A;  1TDC A;  1TSV A;  4FOA A;  1LCB A;  4G2O X;  4UP1 A;  1F28 A;  1TSM A;  1TVW A;  3HB8 A;  4GD7 A;  4Q0D A;  3GG5 A;  1TSL A;  4XSE A;  3UWL B;  4KPW A;  1HW3 A;  4DPD A;  1JMH A;  1JUT A;  1JMF A;  2BBQ A;  1BQ2 A;  3HJ3 A;  3OB7 A;  1BP0 A;  1BP6 A;  1JMG A;  1BID A;  3ED7 A;  4DPH A;  5HS3 A;  5H38 A;  5H39 A;  3N5G A;  1NCE A;  5WRN A;  3KGB A;  3CL9 A;  4ISW A;  4G6W X;  3JSU A;  4H0U A;  3C0A A;  2A9W A;  3IRN A;  2G8A A;  4KYA A;  3DG8 C;  4E28 A;  1VZC A;  2OIP A;  4ECK A;  3V8H A;  1HVY A;  3QG2 A;  3IHI A;  3IJZ A;  1BO8 A;  2FTN A;  1BKO A;  4O1X A;  4IRR A;  1HW4 A;  1NJB A;  4ISK A;  3TMS A;  1DNA A;  1TVV A;  1NJE A;  1B02 A;  1YPV A;  3KJS A;  3BYX A;  1AIQ A;  1FFL A;  3N5E A;  2H2Q A;  1F4B A;  2ONB A;  1RTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...