4E28A

Structure of human thymidylate synthase in inactive conformation with a novel non-peptidic inhibitor
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
286
structure length
249
Chain Sequence
PPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKDLGPVYGFQWRHFYSGQGVDQLQRVIDTIKTNPDDRRIIMAWNPRDLPLMALPPHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate synthase
publication title Inhibitor of ovarian cancer cells growth by virtual screening: a new thiazole derivative targeting human thymidylate synthase.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 249
sequence length 286
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2012-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4e28A00
3GH0A 1BP0A 1EV8A 1FFLA 1TSYA 1TSDA 3UWLA 4E28A 1DNAA 1BSPA 3QGTA 1LCEA 3KJSA 3QG2A 1TLCA 4H0UA 4GD7A 3UM6A 1JTUA 1TSWA 1TVVA 2A9WA 1THYA 1TRGA 1JMIA 3EDWX 1B5EA 1BIDA 3HB8A 1VZAA 4ISKA 4EZ8A 2G8AA 1YPVA 2G8XA 1BP6A 2G86A 4KYAA 2FTNA 1TSZA 2RD8A 3GG5A 1BSFA 5H3AA 1TSXA 3BYXA 4FOXA 1JG0A 4TMSA 1SEJA 1SYNA 1LCBA 1QZFA 1TLSA 1BO8A 2TSCA 3B5BA 3B9HA 4UP1A 5BY6A 4IQBA 4O1XA 3KJRA 1TDAA 1AIQA 1AJMA 1B49A 3HBBA 3IK0A 1BDUA 1TVUA 1VZEA 1VZCA 4IQQA 1FWMA 3EAWX 3H9KA 1TSNA 3BHLA 4O1UA 4KNZA 1NJAA 1TDCA 2BBQA 3CLBA 4ISWA 4XSDA 3HJ3A 4EB4A 1J3IC 4DQ1A 3C0AA 1JUJA 1EVGA 1NJBA 3DGAC 3IJZA 1B5DA 2OIPA 3QJ7A 4DPDA 4O7UA 1DDUA 1VZBA 1EV5A 1NJDA 4IRRA 3BZ0A 1KZIA 1NCEA 1BKOA 1JUTA 1TDUA 2FTQA 4ECKA 1CI7A 1ZPRA 1TISA 1TVWA 4KY4A 1TJSA 1TSLA 2AAZA 3NRRA 4O1XD 1BQ2A 2KCEA 5H39A 2TDMA 3GH2X 1F28A 3INVA 1BPJA 4Q0DA 4F2VA 4Q0EA 3JSUA 1BJGA 4KPWA 3EJLA 1JMHA 3EGYX 1AN5A 3DL5A 1J3JC 2TDDA 1F4EA 4XSEA 3CL9A 3BGXA 3BFIA 3V8HA 3IRNA 3UWLB 3TMSA 1F4DA 3BHRA 4GEVA 3IRMA 2FTOX 3C06A 2RDAA 1BKPA 1JMFA 3BNZA 4GYHA 4DPHA 1QQQA 3IK1A 1HW4A 1HVYA 3IX6A 3IROA 4PSGA 1VZDA 5WRNA 1AXWA 1JMGA 1KCEA 1F4GA 3EBUA 3N5EA 1I00A 3DL6A 1TSMA 5H38A 4FOAA 5HS3A 2RD8B 1TSVA 1J3KC 4LRRA 1NJCA 4G6WX 4EILA 4EINA 3EHIX 4JEFA 4H0RA 1RTSA 1TYSA 2ONBA 4FOGA 1HZWA 1F4BA 2VETA 2VF0A 4E5OA 2H2QA 1TDBA 4FQSA 1KZJA 3K2HA 1BQ1A 3IHIA 1AOBA 1BO7A 3UM8A 3I3RA 1HW3A 3DG8C 3N5EB 4H1IA 5J7WA 4G2OX 5FCTA 1F4FA 2G89A 3ED7A 4KY8A 1LCAA 3KGBA 4FGTA 3N5GA 2TSRA 4XSCA 1NJEA 1B02A 3OB7A 3UM5A 2G8DA 1EVFA 4DP3A 1JTQA 1JU6A 3EF9A 1F4CA
chains in the Genus database with same CATH superfamily
3GH0A 1BP0A 1EV8A 1FFLA 1TSYA 1TSDA 3UWLA 4E28A 1DNAA 1BSPA 3QGTA 1LCEA 3KJSA 3QG2A 1TLCA 4H0UA 4GD7A 3UM6A 1JTUA 1TSWA 1TVVA 2A9WA 1THYA 1TRGA 1JMIA 3EDWX 1B5EA 1BIDA 3HB8A 1VZAA 4ISKA 4EZ8A 2G8AA 1YPVA 2G8XA 1BP6A 2G86A 4KYAA 2FTNA 1TSZA 2RD8A 3GG5A 1BSFA 5H3AA 1TSXA 3BYXA 4FOXA 1JG0A 4TMSA 1SEJA 1SYNA 1LCBA 1QZFA 1TLSA 1BO8A 2TSCA 3B5BA 3B9HA 4UP1A 5BY6A 4IQBA 4O1XA 3KJRA 1TDAA 1AIQA 1AJMA 1B49A 3HBBA 3IK0A 1BDUA 1TVUA 1VZEA 1VZCA 4IQQA 1FWMA 3EAWX 3H9KA 1TSNA 3BHLA 4O1UA 4KNZA 1NJAA 1TDCA 2BBQA 3CLBA 4ISWA 4XSDA 3HJ3A 4EB4A 1J3IC 4DQ1A 3C0AA 1JUJA 1EVGA 1NJBA 3DGAC 3IJZA 1B5DA 2OIPA 3QJ7A 4DPDA 4O7UA 1DDUA 1VZBA 1EV5A 1NJDA 4IRRA 3BZ0A 1KZIA 1NCEA 1BKOA 1JUTA 1TDUA 2FTQA 4ECKA 1CI7A 1ZPRA 1TISA 1TVWA 4KY4A 1TJSA 1TSLA 2AAZA 3NRRA 4O1XD 1BQ2A 2KCEA 5H39A 2TDMA 3GH2X 1F28A 3INVA 1BPJA 4Q0DA 4F2VA 4Q0EA 3JSUA 1BJGA 4KPWA 3EJLA 1JMHA 3EGYX 1AN5A 3DL5A 1J3JC 2TDDA 1F4EA 4XSEA 3CL9A 3BGXA 3BFIA 3V8HA 3IRNA 3UWLB 3TMSA 1F4DA 3BHRA 4GEVA 3IRMA 2FTOX 3C06A 2RDAA 1BKPA 1JMFA 3BNZA 4GYHA 4DPHA 1QQQA 3IK1A 1HW4A 1HVYA 3IX6A 3IROA 4PSGA 1VZDA 5WRNA 1AXWA 1JMGA 1KCEA 1F4GA 3EBUA 3N5EA 1I00A 3DL6A 1TSMA 5H38A 4FOAA 5HS3A 2RD8B 1TSVA 1J3KC 4LRRA 1NJCA 4G6WX 4EILA 4EINA 3EHIX 4JEFA 4H0RA 1RTSA 1TYSA 2ONBA 4FOGA 1HZWA 1F4BA 2VETA 2VF0A 4E5OA 2H2QA 1TDBA 4FQSA 1KZJA 3K2HA 1BQ1A 3IHIA 1AOBA 1BO7A 3UM8A 3I3RA 1HW3A 3DG8C 3N5EB 4H1IA 5J7WA 4G2OX 5FCTA 1F4FA 2G89A 3ED7A 4KY8A 1LCAA 3KGBA 4FGTA 3N5GA 2TSRA 4XSCA 1NJEA 1B02A 3OB7A 3UM5A 2G8DA 1EVFA 4DP3A 1JTQA 1JU6A 3EF9A 1F4CA
chains in the Genus database with same CATH topology
3GH0A 1BP0A 1EV8A 1FFLA 1TSYA 1TSDA 3UWLA 4E28A 1DNAA 1BSPA 3QGTA 1LCEA 3KJSA 3QG2A 1TLCA 4H0UA 4GD7A 3UM6A 1JTUA 1TSWA 1TVVA 2A9WA 1THYA 1TRGA 1JMIA 3EDWX 1B5EA 1BIDA 3HB8A 1VZAA 4ISKA 4EZ8A 2G8AA 1YPVA 2G8XA 1BP6A 2G86A 4KYAA 2FTNA 1TSZA 2RD8A 3GG5A 1BSFA 5H3AA 1TSXA 3BYXA 4FOXA 1JG0A 4TMSA 1SEJA 1SYNA 1LCBA 1QZFA 1TLSA 1BO8A 2TSCA 3B5BA 3B9HA 4UP1A 5BY6A 4IQBA 4O1XA 3KJRA 1TDAA 1AIQA 1AJMA 1B49A 3HBBA 3IK0A 1BDUA 1TVUA 1VZEA 1VZCA 4IQQA 1FWMA 3EAWX 3H9KA 1TSNA 3BHLA 4O1UA 4KNZA 1NJAA 1TDCA 2BBQA 3CLBA 4ISWA 4XSDA 3HJ3A 4EB4A 1J3IC 4DQ1A 3C0AA 1JUJA 1EVGA 1NJBA 3DGAC 3IJZA 1B5DA 2OIPA 3QJ7A 4DPDA 4O7UA 1DDUA 1VZBA 1EV5A 1NJDA 4IRRA 3BZ0A 1KZIA 1NCEA 1BKOA 1JUTA 1TDUA 2FTQA 4ECKA 1CI7A 1ZPRA 1TISA 1TVWA 4KY4A 1TJSA 1TSLA 2AAZA 3NRRA 4O1XD 1BQ2A 2KCEA 5H39A 2TDMA 3GH2X 1F28A 3INVA 1BPJA 4Q0DA 4F2VA 4Q0EA 3JSUA 1BJGA 4KPWA 3EJLA 1JMHA 3EGYX 1AN5A 3DL5A 1J3JC 2TDDA 1F4EA 4XSEA 3CL9A 3BGXA 3BFIA 3V8HA 3IRNA 3UWLB 3TMSA 1F4DA 3BHRA 4GEVA 3IRMA 2FTOX 3C06A 2RDAA 1BKPA 1JMFA 3BNZA 4GYHA 4DPHA 1QQQA 3IK1A 1HW4A 1HVYA 3IX6A 3IROA 4PSGA 1VZDA 5WRNA 1AXWA 1JMGA 1KCEA 1F4GA 3EBUA 3N5EA 1I00A 3DL6A 1TSMA 5H38A 4FOAA 5HS3A 2RD8B 1TSVA 1J3KC 4LRRA 1NJCA 4G6WX 4EILA 4EINA 3EHIX 4JEFA 4H0RA 1RTSA 1TYSA 2ONBA 4FOGA 1HZWA 1F4BA 2VETA 2VF0A 4E5OA 2H2QA 1TDBA 4FQSA 1KZJA 3K2HA 1BQ1A 3IHIA 1AOBA 1BO7A 3UM8A 3I3RA 1HW3A 3DG8C 3N5EB 4H1IA 5J7WA 4G2OX 5FCTA 1F4FA 2G89A 3ED7A 4KY8A 1LCAA 3KGBA 4FGTA 3N5GA 2TSRA 4XSCA 1NJEA 1B02A 3OB7A 3UM5A 2G8DA 1EVFA 4DP3A 1JTQA 1JU6A 3EF9A 1F4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GH0 A;  1BP0 A;  1EV8 A;  1FFL A;  1TSY A;  1TSD A;  3UWL A;  4E28 A;  1DNA A;  1BSP A;  3QGT A;  1LCE A;  3KJS A;  3QG2 A;  1TLC A;  4H0U A;  4GD7 A;  3UM6 A;  1JTU A;  1TSW A;  1TVV A;  2A9W A;  1THY A;  1TRG A;  1JMI A;  3EDW X;  1B5E A;  1BID A;  3HB8 A;  1VZA A;  4ISK A;  4EZ8 A;  2G8A A;  1YPV A;  2G8X A;  1BP6 A;  2G86 A;  4KYA A;  2FTN A;  1TSZ A;  2RD8 A;  3GG5 A;  1BSF A;  5H3A A;  1TSX A;  3BYX A;  4FOX A;  1JG0 A;  4TMS A;  1SEJ A;  1SYN A;  1LCB A;  1QZF A;  1TLS A;  1BO8 A;  2TSC A;  3B5B A;  3B9H A;  4UP1 A;  5BY6 A;  4IQB A;  4O1X A;  3KJR A;  1TDA A;  1AIQ A;  1AJM A;  1B49 A;  3HBB A;  3IK0 A;  1BDU A;  1TVU A;  1VZE A;  1VZC A;  4IQQ A;  1FWM A;  3EAW X;  3H9K A;  1TSN A;  3BHL A;  4O1U A;  4KNZ A;  1NJA A;  1TDC A;  2BBQ A;  3CLB A;  4ISW A;  4XSD A;  3HJ3 A;  4EB4 A;  1J3I C;  4DQ1 A;  3C0A A;  1JUJ A;  1EVG A;  1NJB A;  3DGA C;  3IJZ A;  1B5D A;  2OIP A;  3QJ7 A;  4DPD A;  4O7U A;  1DDU A;  1VZB A;  1EV5 A;  1NJD A;  4IRR A;  3BZ0 A;  1KZI A;  1NCE A;  1BKO A;  1JUT A;  1TDU A;  2FTQ A;  4ECK A;  1CI7 A;  1ZPR A;  1TIS A;  1TVW A;  4KY4 A;  1TJS A;  1TSL A;  2AAZ A;  3NRR A;  4O1X D;  1BQ2 A;  2KCE A;  5H39 A;  2TDM A;  3GH2 X;  1F28 A;  3INV A;  1BPJ A;  4Q0D A;  4F2V A;  4Q0E A;  3JSU A;  1BJG A;  4KPW A;  3EJL A;  1JMH A;  3EGY X;  1AN5 A;  3DL5 A;  1J3J C;  2TDD A;  1F4E A;  4XSE A;  3CL9 A;  3BGX A;  3BFI A;  3V8H A;  3IRN A;  3UWL B;  3TMS A;  1F4D A;  3BHR A;  4GEV A;  3IRM A;  2FTO X;  3C06 A;  2RDA A;  1BKP A;  1JMF A;  3BNZ A;  4GYH A;  4DPH A;  1QQQ A;  3IK1 A;  1HW4 A;  1HVY A;  3IX6 A;  3IRO A;  4PSG A;  1VZD A;  5WRN A;  1AXW A;  1JMG A;  1KCE A;  1F4G A;  3EBU A;  3N5E A;  1I00 A;  3DL6 A;  1TSM A;  5H38 A;  4FOA A;  5HS3 A;  2RD8 B;  1TSV A;  1J3K C;  4LRR A;  1NJC A;  4G6W X;  4EIL A;  4EIN A;  3EHI X;  4JEF A;  4H0R A;  1RTS A;  1TYS A;  2ONB A;  4FOG A;  1HZW A;  1F4B A;  2VET A;  2VF0 A;  4E5O A;  2H2Q A;  1TDB A;  4FQS A;  1KZJ A;  3K2H A;  1BQ1 A;  3IHI A;  1AOB A;  1BO7 A;  3UM8 A;  3I3R A;  1HW3 A;  3DG8 C;  3N5E B;  4H1I A;  5J7W A;  4G2O X;  5FCT A;  1F4F A;  2G89 A;  3ED7 A;  4KY8 A;  1LCA A;  3KGB A;  4FGT A;  3N5G A;  2TSR A;  4XSC A;  1NJE A;  1B02 A;  3OB7 A;  3UM5 A;  2G8D A;  1EVF A;  4DP3 A;  1JTQ A;  1JU6 A;  3EF9 A;  1F4C A; 
#chains in the Genus database with same CATH topology
 3GH0 A;  1BP0 A;  1EV8 A;  1FFL A;  1TSY A;  1TSD A;  3UWL A;  4E28 A;  1DNA A;  1BSP A;  3QGT A;  1LCE A;  3KJS A;  3QG2 A;  1TLC A;  4H0U A;  4GD7 A;  3UM6 A;  1JTU A;  1TSW A;  1TVV A;  2A9W A;  1THY A;  1TRG A;  1JMI A;  3EDW X;  1B5E A;  1BID A;  3HB8 A;  1VZA A;  4ISK A;  4EZ8 A;  2G8A A;  1YPV A;  2G8X A;  1BP6 A;  2G86 A;  4KYA A;  2FTN A;  1TSZ A;  2RD8 A;  3GG5 A;  1BSF A;  5H3A A;  1TSX A;  3BYX A;  4FOX A;  1JG0 A;  4TMS A;  1SEJ A;  1SYN A;  1LCB A;  1QZF A;  1TLS A;  1BO8 A;  2TSC A;  3B5B A;  3B9H A;  4UP1 A;  5BY6 A;  4IQB A;  4O1X A;  3KJR A;  1TDA A;  1AIQ A;  1AJM A;  1B49 A;  3HBB A;  3IK0 A;  1BDU A;  1TVU A;  1VZE A;  1VZC A;  4IQQ A;  1FWM A;  3EAW X;  3H9K A;  1TSN A;  3BHL A;  4O1U A;  4KNZ A;  1NJA A;  1TDC A;  2BBQ A;  3CLB A;  4ISW A;  4XSD A;  3HJ3 A;  4EB4 A;  1J3I C;  4DQ1 A;  3C0A A;  1JUJ A;  1EVG A;  1NJB A;  3DGA C;  3IJZ A;  1B5D A;  2OIP A;  3QJ7 A;  4DPD A;  4O7U A;  1DDU A;  1VZB A;  1EV5 A;  1NJD A;  4IRR A;  3BZ0 A;  1KZI A;  1NCE A;  1BKO A;  1JUT A;  1TDU A;  2FTQ A;  4ECK A;  1CI7 A;  1ZPR A;  1TIS A;  1TVW A;  4KY4 A;  1TJS A;  1TSL A;  2AAZ A;  3NRR A;  4O1X D;  1BQ2 A;  2KCE A;  5H39 A;  2TDM A;  3GH2 X;  1F28 A;  3INV A;  1BPJ A;  4Q0D A;  4F2V A;  4Q0E A;  3JSU A;  1BJG A;  4KPW A;  3EJL A;  1JMH A;  3EGY X;  1AN5 A;  3DL5 A;  1J3J C;  2TDD A;  1F4E A;  4XSE A;  3CL9 A;  3BGX A;  3BFI A;  3V8H A;  3IRN A;  3UWL B;  3TMS A;  1F4D A;  3BHR A;  4GEV A;  3IRM A;  2FTO X;  3C06 A;  2RDA A;  1BKP A;  1JMF A;  3BNZ A;  4GYH A;  4DPH A;  1QQQ A;  3IK1 A;  1HW4 A;  1HVY A;  3IX6 A;  3IRO A;  4PSG A;  1VZD A;  5WRN A;  1AXW A;  1JMG A;  1KCE A;  1F4G A;  3EBU A;  3N5E A;  1I00 A;  3DL6 A;  1TSM A;  5H38 A;  4FOA A;  5HS3 A;  2RD8 B;  1TSV A;  1J3K C;  4LRR A;  1NJC A;  4G6W X;  4EIL A;  4EIN A;  3EHI X;  4JEF A;  4H0R A;  1RTS A;  1TYS A;  2ONB A;  4FOG A;  1HZW A;  1F4B A;  2VET A;  2VF0 A;  4E5O A;  2H2Q A;  1TDB A;  4FQS A;  1KZJ A;  3K2H A;  1BQ1 A;  3IHI A;  1AOB A;  1BO7 A;  3UM8 A;  3I3R A;  1HW3 A;  3DG8 C;  3N5E B;  4H1I A;  5J7W A;  4G2O X;  5FCT A;  1F4F A;  2G89 A;  3ED7 A;  4KY8 A;  1LCA A;  3KGB A;  4FGT A;  3N5G A;  2TSR A;  4XSC A;  1NJE A;  1B02 A;  3OB7 A;  3UM5 A;  2G8D A;  1EVF A;  4DP3 A;  1JTQ A;  1JU6 A;  3EF9 A;  1F4C A; 
#chains in the Genus database with same CATH homology
 3GH0 A;  1BP0 A;  1EV8 A;  1FFL A;  1TSY A;  1TSD A;  3UWL A;  4E28 A;  1DNA A;  1BSP A;  3QGT A;  1LCE A;  3KJS A;  3QG2 A;  1TLC A;  4H0U A;  4GD7 A;  3UM6 A;  1JTU A;  1TSW A;  1TVV A;  2A9W A;  1THY A;  1TRG A;  1JMI A;  3EDW X;  1B5E A;  1BID A;  3HB8 A;  1VZA A;  4ISK A;  4EZ8 A;  2G8A A;  1YPV A;  2G8X A;  1BP6 A;  2G86 A;  4KYA A;  2FTN A;  1TSZ A;  2RD8 A;  3GG5 A;  1BSF A;  5H3A A;  1TSX A;  3BYX A;  4FOX A;  1JG0 A;  4TMS A;  1SEJ A;  1SYN A;  1LCB A;  1QZF A;  1TLS A;  1BO8 A;  2TSC A;  3B5B A;  3B9H A;  4UP1 A;  5BY6 A;  4IQB A;  4O1X A;  3KJR A;  1TDA A;  1AIQ A;  1AJM A;  1B49 A;  3HBB A;  3IK0 A;  1BDU A;  1TVU A;  1VZE A;  1VZC A;  4IQQ A;  1FWM A;  3EAW X;  3H9K A;  1TSN A;  3BHL A;  4O1U A;  4KNZ A;  1NJA A;  1TDC A;  2BBQ A;  3CLB A;  4ISW A;  4XSD A;  3HJ3 A;  4EB4 A;  1J3I C;  4DQ1 A;  3C0A A;  1JUJ A;  1EVG A;  1NJB A;  3DGA C;  3IJZ A;  1B5D A;  2OIP A;  3QJ7 A;  4DPD A;  4O7U A;  1DDU A;  1VZB A;  1EV5 A;  1NJD A;  4IRR A;  3BZ0 A;  1KZI A;  1NCE A;  1BKO A;  1JUT A;  1TDU A;  2FTQ A;  4ECK A;  1CI7 A;  1ZPR A;  1TIS A;  1TVW A;  4KY4 A;  1TJS A;  1TSL A;  2AAZ A;  3NRR A;  4O1X D;  1BQ2 A;  2KCE A;  5H39 A;  2TDM A;  3GH2 X;  1F28 A;  3INV A;  1BPJ A;  4Q0D A;  4F2V A;  4Q0E A;  3JSU A;  1BJG A;  4KPW A;  3EJL A;  1JMH A;  3EGY X;  1AN5 A;  3DL5 A;  1J3J C;  2TDD A;  1F4E A;  4XSE A;  3CL9 A;  3BGX A;  3BFI A;  3V8H A;  3IRN A;  3UWL B;  3TMS A;  1F4D A;  3BHR A;  4GEV A;  3IRM A;  2FTO X;  3C06 A;  2RDA A;  1BKP A;  1JMF A;  3BNZ A;  4GYH A;  4DPH A;  1QQQ A;  3IK1 A;  1HW4 A;  1HVY A;  3IX6 A;  3IRO A;  4PSG A;  1VZD A;  5WRN A;  1AXW A;  1JMG A;  1KCE A;  1F4G A;  3EBU A;  3N5E A;  1I00 A;  3DL6 A;  1TSM A;  5H38 A;  4FOA A;  5HS3 A;  2RD8 B;  1TSV A;  1J3K C;  4LRR A;  1NJC A;  4G6W X;  4EIL A;  4EIN A;  3EHI X;  4JEF A;  4H0R A;  1RTS A;  1TYS A;  2ONB A;  4FOG A;  1HZW A;  1F4B A;  2VET A;  2VF0 A;  4E5O A;  2H2Q A;  1TDB A;  4FQS A;  1KZJ A;  3K2H A;  1BQ1 A;  3IHI A;  1AOB A;  1BO7 A;  3UM8 A;  3I3R A;  1HW3 A;  3DG8 C;  3N5E B;  4H1I A;  5J7W A;  4G2O X;  5FCT A;  1F4F A;  2G89 A;  3ED7 A;  4KY8 A;  1LCA A;  3KGB A;  4FGT A;  3N5G A;  2TSR A;  4XSC A;  1NJE A;  1B02 A;  3OB7 A;  3UM5 A;  2G8D A;  1EVF A;  4DP3 A;  1JTQ A;  1JU6 A;  3EF9 A;  1F4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...