4E5OA

Crystal structure of mouse thymidylate synthase in complex with dump
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
287
structure length
287
Chain Sequence
RHGELQYLRQVEHILRCGFKKEDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVRIWDANGSRDFLDSLGFSARQEGDLGPVYGFQWRHFGAEYKDMDSDYSGQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVNGELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLKILRKVETIDDFKVEDFQIEGYNPHPTIKMEMAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase
publication title Mouse thymidylate synthase does not show the inactive conformation, observed for the human enzyme
doi rcsb
source organism Mus musculus
total genus 94
structure length 287
sequence length 287
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2012-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4e5oA00
4KPWA 2TDMA 1NJAA 3TMSA 1AJMA 4IQBA 1F4GA 1BO7A 1TDAA 4PSGA 1NJDA 1HZWA 1BJGA 1TLCA 1TSVA 1ZPRA 4XSDA 3BHLA 5H3AA 4O1XD 1CI7A 3BNZA 1TSZA 1F4BA 1NJBA 3BGXA 3EJLA 3EDWX 3EGYX 4KY4A 1AXWA 2G8AA 4KY8A 4EINA 1BKOA 1BQ2A 1VZEA 3QGTA 1BDUA 3UM5A 4DPDA 1RTSA 4DQ1A 2AAZA 1KCEA 3V8HA 1JG0A 1TSWA 1KZIA 1TSDA 3UM6A 1TVVA 3IRNA 4FOAA 2G8XA 1VZAA 3CL9A 3INVA 4FQSA 4EILA 4O1XA 1TSMA 3N5EA 3NRRA 4XSCA 4EB4A 1EV5A 3IK1A 2FTQA 1BPJA 4IQQA 4E28A 1KZJA 1TVUA 3GG5A 1TLSA 1JMHA 4H1IA 4GEVA 1FWMA 3IROA 1TSYA 1DDUA 2KCEA 2VETA 3UWLA 4KNZA 1JTQA 1YPVA 3IRMA 1JUTA 2RDAA 1NJCA 3KJRA 4IRRA 1B5EA 3UM8A 1F4EA 1TJSA 3C06A 3EAWX 2OIPA 3N5EB 1HW3A 1TYSA 1VZCA 4E5OA 1BIDA 1TDBA 1JMIA 4O7UA 2RD8B 3HB8A 1BSPA 1B02A 4FOXA 1BKPA 3UWLB 3BHRA 1VZDA 3C0AA 4ISWA 5HS3A 1F4CA 4FGTA 3K2HA 1AIQA 3GH0A 1VZBA 3QJ7A 1TSLA 3H9KA 1J3IC 3HJ3A 1EVFA 3EHIX 1JMGA 3IK0A 1AN5A 4Q0DA 1JUJA 1F4DA 1J3KC 1QQQA 3DG8C 5FCTA 1JTUA 4LRRA 3QG2A 2RD8A 1FFLA 3IX6A 4G2OX 4H0UA 1HW4A 1HVYA 1NJEA 3CLBA 4GD7A 4XSEA 3BFIA 1SEJA 5J7WA 1QZFA 4G6WX 3BYXA 1TVWA 1EV8A 2ONBA 4FOGA 1B5DA 2TSCA 3B9HA 2A9WA 5BY6A 3DGAC 1I00A 2FTNA 3GH2X 2BBQA 1TSNA 3BZ0A 4KYAA 1JMFA 1TRGA 2TSRA 1F4FA 3B5BA 3ED7A 1BQ1A 4DPHA 3KGBA 4O1UA 4Q0EA 1BP0A 1JU6A 1SYNA 2FTOX 3HBBA 3I3RA 3OB7A 1LCEA 3JSUA 4UP1A 1B49A 4JEFA 1BP6A 4ECKA 1NCEA 3IHIA 5H39A 1AOBA 1BO8A 4GYHA 3N5GA 5WRNA 1TISA 3DL6A 4H0RA 1DNAA 3EF9A 3DL5A 1EVGA 1LCBA 1TDUA 2TDDA 2G86A 4F2VA 2VF0A 1J3JC 5H38A 4DP3A 2G89A 4EZ8A 2H2QA 2G8DA 4TMSA 1F28A 1THYA 3IJZA 3KJSA 3EBUA 1TSXA 4ISKA 1TDCA 1BSFA 1LCAA
chains in the Genus database with same CATH superfamily
4KPWA 2TDMA 1NJAA 3TMSA 1AJMA 4IQBA 1F4GA 1BO7A 1TDAA 4PSGA 1NJDA 1HZWA 1BJGA 1TLCA 1TSVA 1ZPRA 4XSDA 3BHLA 5H3AA 4O1XD 1CI7A 3BNZA 1TSZA 1F4BA 1NJBA 3BGXA 3EJLA 3EDWX 3EGYX 4KY4A 1AXWA 2G8AA 4KY8A 4EINA 1BKOA 1BQ2A 1VZEA 3QGTA 1BDUA 3UM5A 4DPDA 1RTSA 4DQ1A 2AAZA 1KCEA 3V8HA 1JG0A 1TSWA 1KZIA 1TSDA 3UM6A 1TVVA 3IRNA 4FOAA 2G8XA 1VZAA 3CL9A 3INVA 4FQSA 4EILA 4O1XA 1TSMA 3N5EA 3NRRA 4XSCA 4EB4A 1EV5A 3IK1A 2FTQA 1BPJA 4IQQA 4E28A 1KZJA 1TVUA 3GG5A 1TLSA 1JMHA 4H1IA 4GEVA 1FWMA 3IROA 1TSYA 1DDUA 2KCEA 2VETA 3UWLA 4KNZA 1JTQA 1YPVA 3IRMA 1JUTA 2RDAA 1NJCA 3KJRA 4IRRA 1B5EA 3UM8A 1F4EA 1TJSA 3C06A 3EAWX 2OIPA 3N5EB 1HW3A 1TYSA 1VZCA 4E5OA 1BIDA 1TDBA 1JMIA 4O7UA 2RD8B 3HB8A 1BSPA 1B02A 4FOXA 1BKPA 3UWLB 3BHRA 1VZDA 3C0AA 4ISWA 5HS3A 1F4CA 4FGTA 3K2HA 1AIQA 3GH0A 1VZBA 3QJ7A 1TSLA 3H9KA 1J3IC 3HJ3A 1EVFA 3EHIX 1JMGA 3IK0A 1AN5A 4Q0DA 1JUJA 1F4DA 1J3KC 1QQQA 3DG8C 5FCTA 1JTUA 4LRRA 3QG2A 2RD8A 1FFLA 3IX6A 4G2OX 4H0UA 1HW4A 1HVYA 1NJEA 3CLBA 4GD7A 4XSEA 3BFIA 1SEJA 5J7WA 1QZFA 4G6WX 3BYXA 1TVWA 1EV8A 2ONBA 4FOGA 1B5DA 2TSCA 3B9HA 2A9WA 5BY6A 3DGAC 1I00A 2FTNA 3GH2X 2BBQA 1TSNA 3BZ0A 4KYAA 1JMFA 1TRGA 2TSRA 1F4FA 3B5BA 3ED7A 1BQ1A 4DPHA 3KGBA 4O1UA 4Q0EA 1BP0A 1JU6A 1SYNA 2FTOX 3HBBA 3I3RA 3OB7A 1LCEA 3JSUA 4UP1A 1B49A 4JEFA 1BP6A 4ECKA 1NCEA 3IHIA 5H39A 1AOBA 1BO8A 4GYHA 3N5GA 5WRNA 1TISA 3DL6A 4H0RA 1DNAA 3EF9A 3DL5A 1EVGA 1LCBA 1TDUA 2TDDA 2G86A 4F2VA 2VF0A 1J3JC 5H38A 4DP3A 2G89A 4EZ8A 2H2QA 2G8DA 4TMSA 1F28A 1THYA 3IJZA 3KJSA 3EBUA 1TSXA 4ISKA 1TDCA 1BSFA 1LCAA
chains in the Genus database with same CATH topology
4KPWA 2TDMA 1NJAA 3TMSA 1AJMA 4IQBA 1F4GA 1BO7A 1TDAA 4PSGA 1NJDA 1HZWA 1BJGA 1TLCA 1TSVA 1ZPRA 4XSDA 3BHLA 5H3AA 4O1XD 1CI7A 3BNZA 1TSZA 1F4BA 1NJBA 3BGXA 3EJLA 3EDWX 3EGYX 4KY4A 1AXWA 2G8AA 4KY8A 4EINA 1BKOA 1BQ2A 1VZEA 3QGTA 1BDUA 3UM5A 4DPDA 1RTSA 4DQ1A 2AAZA 1KCEA 3V8HA 1JG0A 1TSWA 1KZIA 1TSDA 3UM6A 1TVVA 3IRNA 4FOAA 2G8XA 1VZAA 3CL9A 3INVA 4FQSA 4EILA 4O1XA 1TSMA 3N5EA 3NRRA 4XSCA 4EB4A 1EV5A 3IK1A 2FTQA 1BPJA 4IQQA 4E28A 1KZJA 1TVUA 3GG5A 1TLSA 1JMHA 4H1IA 4GEVA 1FWMA 3IROA 1TSYA 1DDUA 2KCEA 2VETA 3UWLA 4KNZA 1JTQA 1YPVA 3IRMA 1JUTA 2RDAA 1NJCA 3KJRA 4IRRA 1B5EA 3UM8A 1F4EA 1TJSA 3C06A 3EAWX 2OIPA 3N5EB 1HW3A 1TYSA 1VZCA 4E5OA 1BIDA 1TDBA 1JMIA 4O7UA 2RD8B 3HB8A 1BSPA 1B02A 4FOXA 1BKPA 3UWLB 3BHRA 1VZDA 3C0AA 4ISWA 5HS3A 1F4CA 4FGTA 3K2HA 1AIQA 3GH0A 1VZBA 3QJ7A 1TSLA 3H9KA 1J3IC 3HJ3A 1EVFA 3EHIX 1JMGA 3IK0A 1AN5A 4Q0DA 1JUJA 1F4DA 1J3KC 1QQQA 3DG8C 5FCTA 1JTUA 4LRRA 3QG2A 2RD8A 1FFLA 3IX6A 4G2OX 4H0UA 1HW4A 1HVYA 1NJEA 3CLBA 4GD7A 4XSEA 3BFIA 1SEJA 5J7WA 1QZFA 4G6WX 3BYXA 1TVWA 1EV8A 2ONBA 4FOGA 1B5DA 2TSCA 3B9HA 2A9WA 5BY6A 3DGAC 1I00A 2FTNA 3GH2X 2BBQA 1TSNA 3BZ0A 4KYAA 1JMFA 1TRGA 2TSRA 1F4FA 3B5BA 3ED7A 1BQ1A 4DPHA 3KGBA 4O1UA 4Q0EA 1BP0A 1JU6A 1SYNA 2FTOX 3HBBA 3I3RA 3OB7A 1LCEA 3JSUA 4UP1A 1B49A 4JEFA 1BP6A 4ECKA 1NCEA 3IHIA 5H39A 1AOBA 1BO8A 4GYHA 3N5GA 5WRNA 1TISA 3DL6A 4H0RA 1DNAA 3EF9A 3DL5A 1EVGA 1LCBA 1TDUA 2TDDA 2G86A 4F2VA 2VF0A 1J3JC 5H38A 4DP3A 2G89A 4EZ8A 2H2QA 2G8DA 4TMSA 1F28A 1THYA 3IJZA 3KJSA 3EBUA 1TSXA 4ISKA 1TDCA 1BSFA 1LCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KPW A;  2TDM A;  1NJA A;  3TMS A;  1AJM A;  4IQB A;  1F4G A;  1BO7 A;  1TDA A;  4PSG A;  1NJD A;  1HZW A;  1BJG A;  1TLC A;  1TSV A;  1ZPR A;  4XSD A;  3BHL A;  5H3A A;  4O1X D;  1CI7 A;  3BNZ A;  1TSZ A;  1F4B A;  1NJB A;  3BGX A;  3EJL A;  3EDW X;  3EGY X;  4KY4 A;  1AXW A;  2G8A A;  4KY8 A;  4EIN A;  1BKO A;  1BQ2 A;  1VZE A;  3QGT A;  1BDU A;  3UM5 A;  4DPD A;  1RTS A;  4DQ1 A;  2AAZ A;  1KCE A;  3V8H A;  1JG0 A;  1TSW A;  1KZI A;  1TSD A;  3UM6 A;  1TVV A;  3IRN A;  4FOA A;  2G8X A;  1VZA A;  3CL9 A;  3INV A;  4FQS A;  4EIL A;  4O1X A;  1TSM A;  3N5E A;  3NRR A;  4XSC A;  4EB4 A;  1EV5 A;  3IK1 A;  2FTQ A;  1BPJ A;  4IQQ A;  4E28 A;  1KZJ A;  1TVU A;  3GG5 A;  1TLS A;  1JMH A;  4H1I A;  4GEV A;  1FWM A;  3IRO A;  1TSY A;  1DDU A;  2KCE A;  2VET A;  3UWL A;  4KNZ A;  1JTQ A;  1YPV A;  3IRM A;  1JUT A;  2RDA A;  1NJC A;  3KJR A;  4IRR A;  1B5E A;  3UM8 A;  1F4E A;  1TJS A;  3C06 A;  3EAW X;  2OIP A;  3N5E B;  1HW3 A;  1TYS A;  1VZC A;  4E5O A;  1BID A;  1TDB A;  1JMI A;  4O7U A;  2RD8 B;  3HB8 A;  1BSP A;  1B02 A;  4FOX A;  1BKP A;  3UWL B;  3BHR A;  1VZD A;  3C0A A;  4ISW A;  5HS3 A;  1F4C A;  4FGT A;  3K2H A;  1AIQ A;  3GH0 A;  1VZB A;  3QJ7 A;  1TSL A;  3H9K A;  1J3I C;  3HJ3 A;  1EVF A;  3EHI X;  1JMG A;  3IK0 A;  1AN5 A;  4Q0D A;  1JUJ A;  1F4D A;  1J3K C;  1QQQ A;  3DG8 C;  5FCT A;  1JTU A;  4LRR A;  3QG2 A;  2RD8 A;  1FFL A;  3IX6 A;  4G2O X;  4H0U A;  1HW4 A;  1HVY A;  1NJE A;  3CLB A;  4GD7 A;  4XSE A;  3BFI A;  1SEJ A;  5J7W A;  1QZF A;  4G6W X;  3BYX A;  1TVW A;  1EV8 A;  2ONB A;  4FOG A;  1B5D A;  2TSC A;  3B9H A;  2A9W A;  5BY6 A;  3DGA C;  1I00 A;  2FTN A;  3GH2 X;  2BBQ A;  1TSN A;  3BZ0 A;  4KYA A;  1JMF A;  1TRG A;  2TSR A;  1F4F A;  3B5B A;  3ED7 A;  1BQ1 A;  4DPH A;  3KGB A;  4O1U A;  4Q0E A;  1BP0 A;  1JU6 A;  1SYN A;  2FTO X;  3HBB A;  3I3R A;  3OB7 A;  1LCE A;  3JSU A;  4UP1 A;  1B49 A;  4JEF A;  1BP6 A;  4ECK A;  1NCE A;  3IHI A;  5H39 A;  1AOB A;  1BO8 A;  4GYH A;  3N5G A;  5WRN A;  1TIS A;  3DL6 A;  4H0R A;  1DNA A;  3EF9 A;  3DL5 A;  1EVG A;  1LCB A;  1TDU A;  2TDD A;  2G86 A;  4F2V A;  2VF0 A;  1J3J C;  5H38 A;  4DP3 A;  2G89 A;  4EZ8 A;  2H2Q A;  2G8D A;  4TMS A;  1F28 A;  1THY A;  3IJZ A;  3KJS A;  3EBU A;  1TSX A;  4ISK A;  1TDC A;  1BSF A;  1LCA A; 
#chains in the Genus database with same CATH topology
 4KPW A;  2TDM A;  1NJA A;  3TMS A;  1AJM A;  4IQB A;  1F4G A;  1BO7 A;  1TDA A;  4PSG A;  1NJD A;  1HZW A;  1BJG A;  1TLC A;  1TSV A;  1ZPR A;  4XSD A;  3BHL A;  5H3A A;  4O1X D;  1CI7 A;  3BNZ A;  1TSZ A;  1F4B A;  1NJB A;  3BGX A;  3EJL A;  3EDW X;  3EGY X;  4KY4 A;  1AXW A;  2G8A A;  4KY8 A;  4EIN A;  1BKO A;  1BQ2 A;  1VZE A;  3QGT A;  1BDU A;  3UM5 A;  4DPD A;  1RTS A;  4DQ1 A;  2AAZ A;  1KCE A;  3V8H A;  1JG0 A;  1TSW A;  1KZI A;  1TSD A;  3UM6 A;  1TVV A;  3IRN A;  4FOA A;  2G8X A;  1VZA A;  3CL9 A;  3INV A;  4FQS A;  4EIL A;  4O1X A;  1TSM A;  3N5E A;  3NRR A;  4XSC A;  4EB4 A;  1EV5 A;  3IK1 A;  2FTQ A;  1BPJ A;  4IQQ A;  4E28 A;  1KZJ A;  1TVU A;  3GG5 A;  1TLS A;  1JMH A;  4H1I A;  4GEV A;  1FWM A;  3IRO A;  1TSY A;  1DDU A;  2KCE A;  2VET A;  3UWL A;  4KNZ A;  1JTQ A;  1YPV A;  3IRM A;  1JUT A;  2RDA A;  1NJC A;  3KJR A;  4IRR A;  1B5E A;  3UM8 A;  1F4E A;  1TJS A;  3C06 A;  3EAW X;  2OIP A;  3N5E B;  1HW3 A;  1TYS A;  1VZC A;  4E5O A;  1BID A;  1TDB A;  1JMI A;  4O7U A;  2RD8 B;  3HB8 A;  1BSP A;  1B02 A;  4FOX A;  1BKP A;  3UWL B;  3BHR A;  1VZD A;  3C0A A;  4ISW A;  5HS3 A;  1F4C A;  4FGT A;  3K2H A;  1AIQ A;  3GH0 A;  1VZB A;  3QJ7 A;  1TSL A;  3H9K A;  1J3I C;  3HJ3 A;  1EVF A;  3EHI X;  1JMG A;  3IK0 A;  1AN5 A;  4Q0D A;  1JUJ A;  1F4D A;  1J3K C;  1QQQ A;  3DG8 C;  5FCT A;  1JTU A;  4LRR A;  3QG2 A;  2RD8 A;  1FFL A;  3IX6 A;  4G2O X;  4H0U A;  1HW4 A;  1HVY A;  1NJE A;  3CLB A;  4GD7 A;  4XSE A;  3BFI A;  1SEJ A;  5J7W A;  1QZF A;  4G6W X;  3BYX A;  1TVW A;  1EV8 A;  2ONB A;  4FOG A;  1B5D A;  2TSC A;  3B9H A;  2A9W A;  5BY6 A;  3DGA C;  1I00 A;  2FTN A;  3GH2 X;  2BBQ A;  1TSN A;  3BZ0 A;  4KYA A;  1JMF A;  1TRG A;  2TSR A;  1F4F A;  3B5B A;  3ED7 A;  1BQ1 A;  4DPH A;  3KGB A;  4O1U A;  4Q0E A;  1BP0 A;  1JU6 A;  1SYN A;  2FTO X;  3HBB A;  3I3R A;  3OB7 A;  1LCE A;  3JSU A;  4UP1 A;  1B49 A;  4JEF A;  1BP6 A;  4ECK A;  1NCE A;  3IHI A;  5H39 A;  1AOB A;  1BO8 A;  4GYH A;  3N5G A;  5WRN A;  1TIS A;  3DL6 A;  4H0R A;  1DNA A;  3EF9 A;  3DL5 A;  1EVG A;  1LCB A;  1TDU A;  2TDD A;  2G86 A;  4F2V A;  2VF0 A;  1J3J C;  5H38 A;  4DP3 A;  2G89 A;  4EZ8 A;  2H2Q A;  2G8D A;  4TMS A;  1F28 A;  1THY A;  3IJZ A;  3KJS A;  3EBU A;  1TSX A;  4ISK A;  1TDC A;  1BSF A;  1LCA A; 
#chains in the Genus database with same CATH homology
 4KPW A;  2TDM A;  1NJA A;  3TMS A;  1AJM A;  4IQB A;  1F4G A;  1BO7 A;  1TDA A;  4PSG A;  1NJD A;  1HZW A;  1BJG A;  1TLC A;  1TSV A;  1ZPR A;  4XSD A;  3BHL A;  5H3A A;  4O1X D;  1CI7 A;  3BNZ A;  1TSZ A;  1F4B A;  1NJB A;  3BGX A;  3EJL A;  3EDW X;  3EGY X;  4KY4 A;  1AXW A;  2G8A A;  4KY8 A;  4EIN A;  1BKO A;  1BQ2 A;  1VZE A;  3QGT A;  1BDU A;  3UM5 A;  4DPD A;  1RTS A;  4DQ1 A;  2AAZ A;  1KCE A;  3V8H A;  1JG0 A;  1TSW A;  1KZI A;  1TSD A;  3UM6 A;  1TVV A;  3IRN A;  4FOA A;  2G8X A;  1VZA A;  3CL9 A;  3INV A;  4FQS A;  4EIL A;  4O1X A;  1TSM A;  3N5E A;  3NRR A;  4XSC A;  4EB4 A;  1EV5 A;  3IK1 A;  2FTQ A;  1BPJ A;  4IQQ A;  4E28 A;  1KZJ A;  1TVU A;  3GG5 A;  1TLS A;  1JMH A;  4H1I A;  4GEV A;  1FWM A;  3IRO A;  1TSY A;  1DDU A;  2KCE A;  2VET A;  3UWL A;  4KNZ A;  1JTQ A;  1YPV A;  3IRM A;  1JUT A;  2RDA A;  1NJC A;  3KJR A;  4IRR A;  1B5E A;  3UM8 A;  1F4E A;  1TJS A;  3C06 A;  3EAW X;  2OIP A;  3N5E B;  1HW3 A;  1TYS A;  1VZC A;  4E5O A;  1BID A;  1TDB A;  1JMI A;  4O7U A;  2RD8 B;  3HB8 A;  1BSP A;  1B02 A;  4FOX A;  1BKP A;  3UWL B;  3BHR A;  1VZD A;  3C0A A;  4ISW A;  5HS3 A;  1F4C A;  4FGT A;  3K2H A;  1AIQ A;  3GH0 A;  1VZB A;  3QJ7 A;  1TSL A;  3H9K A;  1J3I C;  3HJ3 A;  1EVF A;  3EHI X;  1JMG A;  3IK0 A;  1AN5 A;  4Q0D A;  1JUJ A;  1F4D A;  1J3K C;  1QQQ A;  3DG8 C;  5FCT A;  1JTU A;  4LRR A;  3QG2 A;  2RD8 A;  1FFL A;  3IX6 A;  4G2O X;  4H0U A;  1HW4 A;  1HVY A;  1NJE A;  3CLB A;  4GD7 A;  4XSE A;  3BFI A;  1SEJ A;  5J7W A;  1QZF A;  4G6W X;  3BYX A;  1TVW A;  1EV8 A;  2ONB A;  4FOG A;  1B5D A;  2TSC A;  3B9H A;  2A9W A;  5BY6 A;  3DGA C;  1I00 A;  2FTN A;  3GH2 X;  2BBQ A;  1TSN A;  3BZ0 A;  4KYA A;  1JMF A;  1TRG A;  2TSR A;  1F4F A;  3B5B A;  3ED7 A;  1BQ1 A;  4DPH A;  3KGB A;  4O1U A;  4Q0E A;  1BP0 A;  1JU6 A;  1SYN A;  2FTO X;  3HBB A;  3I3R A;  3OB7 A;  1LCE A;  3JSU A;  4UP1 A;  1B49 A;  4JEF A;  1BP6 A;  4ECK A;  1NCE A;  3IHI A;  5H39 A;  1AOB A;  1BO8 A;  4GYH A;  3N5G A;  5WRN A;  1TIS A;  3DL6 A;  4H0R A;  1DNA A;  3EF9 A;  3DL5 A;  1EVG A;  1LCB A;  1TDU A;  2TDD A;  2G86 A;  4F2V A;  2VF0 A;  1J3J C;  5H38 A;  4DP3 A;  2G89 A;  4EZ8 A;  2H2Q A;  2G8D A;  4TMS A;  1F28 A;  1THY A;  3IJZ A;  3KJS A;  3EBU A;  1TSX A;  4ISK A;  1TDC A;  1BSF A;  1LCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...