4EB4A

Crystal structure of mouse thymidylate synthase in ternary complex with dump and tomudex
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
307
structure length
300
Chain Sequence
MLVVGSELQSDAQRHGELQYLRQVEHILRCGFKKEDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVRIWDANGSRDFLDSLGFSARQEGDLGPVYGFQWRHFGAEYKDMDSDYSGQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVNGELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLKILRKVETIDDFKVEDFQIEGYNPHPTIKMEMAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase
publication title Crystal structure of mouse thymidylate synthase in tertiary complex with dUMP and raltitrexed reveals N-terminus architecture and two different active site conformations.
pubmed doi rcsb
source organism Mus musculus
total genus 99
structure length 300
sequence length 307
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2012-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4eb4A00
1VZAA 3DG8C 1F4EA 1DNAA 1KZJA 1BPJA 4ISWA 1J3KC 3EHIX 2ONBA 2FTOX 1BSPA 4FOGA 3QGTA 1HZWA 5H38A 2FTQA 5WRNA 1TDUA 1RTSA 2TSCA 3DGAC 4G2OX 4O1UA 1B5DA 1TSMA 1BKPA 1BKOA 3GH0A 2KCEA 1TDBA 3EDWX 4FOXA 3UM5A 3CL9A 1CI7A 1TVVA 1B5EA 4O1XD 1TYSA 3V8HA 4DP3A 1AJMA 3IRNA 5BY6A 2OIPA 1AN5A 4KNZA 4E28A 4IQBA 1SYNA 4XSCA 1TLCA 2G89A 1F4CA 4FQSA 4H0RA 1TVUA 1TSYA 5FCTA 4EILA 4IRRA 3UM8A 1VZEA 1TSDA 4H0UA 3TMSA 5J7WA 1JMHA 1TSNA 3C06A 3IJZA 1LCEA 3BFIA 1TSZA 3IRMA 1QQQA 3OB7A 1TSXA 3C0AA 3UWLA 1AIQA 3HB8A 1JMFA 1NJBA 1TLSA 4UP1A 2G86A 3UWLB 1NJDA 3K2HA 2BBQA 1BP0A 5HS3A 1BP6A 1JTQA 3EBUA 4G6WX 4DQ1A 3GH2X 3N5EB 1JMGA 1NJEA 3QG2A 4JEFA 1TSLA 1J3IC 4DPHA 1BIDA 1TRGA 3B9HA 3DL6A 3EAWX 3B5BA 3BNZA 3EJLA 3JSUA 4H1IA 1F28A 1JUTA 3HBBA 1TJSA 4PSGA 3UM6A 1BJGA 3I3RA 1I00A 1HVYA 3INVA 1AOBA 1TSWA 1EV8A 2RD8B 1AXWA 2TDMA 1NJAA 1DDUA 2G8XA 3IK0A 1LCBA 3BHRA 3N5EA 4F2VA 1NJCA 2H2QA 1B02A 1BSFA 3IX6A 3N5GA 4E5OA 2G8DA 1EV5A 3BYXA 1EVGA 1TDAA 2AAZA 4XSEA 1F4BA 1LCAA 1HW4A 1TISA 1VZCA 4Q0EA 1B49A 4TMSA 3IHIA 1BO7A 4O1XA 1KZIA 3HJ3A 3KGBA 3NRRA 1VZDA 2VETA 4LRRA 2TDDA 4KPWA 4Q0DA 4DPDA 2RD8A 3KJSA 3EGYX 5H3AA 3DL5A 1TVWA 3QJ7A 3KJRA 4GYHA 1ZPRA 1FFLA 1TSVA 1HW3A 3IROA 4IQQA 4EB4A 3ED7A 1BQ2A 1F4GA 1EVFA 1JTUA 2RDAA 4KY4A 4ECKA 3GG5A 1YPVA 4GD7A 4O7UA 1KCEA 2G8AA 4GEVA 3BGXA 2TSRA 1F4FA 3CLBA 3IK1A 1BDUA 1FWMA 3EF9A 4EZ8A 1JMIA 1SEJA 1BO8A 4FGTA 4FOAA 1QZFA 4EINA 3BHLA 1VZBA 4KY8A 4XSDA 1F4DA 1THYA 1BQ1A 1NCEA 1JU6A 1JG0A 2FTNA 1J3JC 1TDCA 4KYAA 2A9WA 4ISKA 3H9KA 5H39A 2VF0A 3BZ0A 1JUJA
chains in the Genus database with same CATH superfamily
1VZAA 3DG8C 1F4EA 1DNAA 1KZJA 1BPJA 4ISWA 1J3KC 3EHIX 2ONBA 2FTOX 1BSPA 4FOGA 3QGTA 1HZWA 5H38A 2FTQA 5WRNA 1TDUA 1RTSA 2TSCA 3DGAC 4G2OX 4O1UA 1B5DA 1TSMA 1BKPA 1BKOA 3GH0A 2KCEA 1TDBA 3EDWX 4FOXA 3UM5A 3CL9A 1CI7A 1TVVA 1B5EA 4O1XD 1TYSA 3V8HA 4DP3A 1AJMA 3IRNA 5BY6A 2OIPA 1AN5A 4KNZA 4E28A 4IQBA 1SYNA 4XSCA 1TLCA 2G89A 1F4CA 4FQSA 4H0RA 1TVUA 1TSYA 5FCTA 4EILA 4IRRA 3UM8A 1VZEA 1TSDA 4H0UA 3TMSA 5J7WA 1JMHA 1TSNA 3C06A 3IJZA 1LCEA 3BFIA 1TSZA 3IRMA 1QQQA 3OB7A 1TSXA 3C0AA 3UWLA 1AIQA 3HB8A 1JMFA 1NJBA 1TLSA 4UP1A 2G86A 3UWLB 1NJDA 3K2HA 2BBQA 1BP0A 5HS3A 1BP6A 1JTQA 3EBUA 4G6WX 4DQ1A 3GH2X 3N5EB 1JMGA 1NJEA 3QG2A 4JEFA 1TSLA 1J3IC 4DPHA 1BIDA 1TRGA 3B9HA 3DL6A 3EAWX 3B5BA 3BNZA 3EJLA 3JSUA 4H1IA 1F28A 1JUTA 3HBBA 1TJSA 4PSGA 3UM6A 1BJGA 3I3RA 1I00A 1HVYA 3INVA 1AOBA 1TSWA 1EV8A 2RD8B 1AXWA 2TDMA 1NJAA 1DDUA 2G8XA 3IK0A 1LCBA 3BHRA 3N5EA 4F2VA 1NJCA 2H2QA 1B02A 1BSFA 3IX6A 3N5GA 4E5OA 2G8DA 1EV5A 3BYXA 1EVGA 1TDAA 2AAZA 4XSEA 1F4BA 1LCAA 1HW4A 1TISA 1VZCA 4Q0EA 1B49A 4TMSA 3IHIA 1BO7A 4O1XA 1KZIA 3HJ3A 3KGBA 3NRRA 1VZDA 2VETA 4LRRA 2TDDA 4KPWA 4Q0DA 4DPDA 2RD8A 3KJSA 3EGYX 5H3AA 3DL5A 1TVWA 3QJ7A 3KJRA 4GYHA 1ZPRA 1FFLA 1TSVA 1HW3A 3IROA 4IQQA 4EB4A 3ED7A 1BQ2A 1F4GA 1EVFA 1JTUA 2RDAA 4KY4A 4ECKA 3GG5A 1YPVA 4GD7A 4O7UA 1KCEA 2G8AA 4GEVA 3BGXA 2TSRA 1F4FA 3CLBA 3IK1A 1BDUA 1FWMA 3EF9A 4EZ8A 1JMIA 1SEJA 1BO8A 4FGTA 4FOAA 1QZFA 4EINA 3BHLA 1VZBA 4KY8A 4XSDA 1F4DA 1THYA 1BQ1A 1NCEA 1JU6A 1JG0A 2FTNA 1J3JC 1TDCA 4KYAA 2A9WA 4ISKA 3H9KA 5H39A 2VF0A 3BZ0A 1JUJA
chains in the Genus database with same CATH topology
1VZAA 3DG8C 1F4EA 1DNAA 1KZJA 1BPJA 4ISWA 1J3KC 3EHIX 2ONBA 2FTOX 1BSPA 4FOGA 3QGTA 1HZWA 5H38A 2FTQA 5WRNA 1TDUA 1RTSA 2TSCA 3DGAC 4G2OX 4O1UA 1B5DA 1TSMA 1BKPA 1BKOA 3GH0A 2KCEA 1TDBA 3EDWX 4FOXA 3UM5A 3CL9A 1CI7A 1TVVA 1B5EA 4O1XD 1TYSA 3V8HA 4DP3A 1AJMA 3IRNA 5BY6A 2OIPA 1AN5A 4KNZA 4E28A 4IQBA 1SYNA 4XSCA 1TLCA 2G89A 1F4CA 4FQSA 4H0RA 1TVUA 1TSYA 5FCTA 4EILA 4IRRA 3UM8A 1VZEA 1TSDA 4H0UA 3TMSA 5J7WA 1JMHA 1TSNA 3C06A 3IJZA 1LCEA 3BFIA 1TSZA 3IRMA 1QQQA 3OB7A 1TSXA 3C0AA 3UWLA 1AIQA 3HB8A 1JMFA 1NJBA 1TLSA 4UP1A 2G86A 3UWLB 1NJDA 3K2HA 2BBQA 1BP0A 5HS3A 1BP6A 1JTQA 3EBUA 4G6WX 4DQ1A 3GH2X 3N5EB 1JMGA 1NJEA 3QG2A 4JEFA 1TSLA 1J3IC 4DPHA 1BIDA 1TRGA 3B9HA 3DL6A 3EAWX 3B5BA 3BNZA 3EJLA 3JSUA 4H1IA 1F28A 1JUTA 3HBBA 1TJSA 4PSGA 3UM6A 1BJGA 3I3RA 1I00A 1HVYA 3INVA 1AOBA 1TSWA 1EV8A 2RD8B 1AXWA 2TDMA 1NJAA 1DDUA 2G8XA 3IK0A 1LCBA 3BHRA 3N5EA 4F2VA 1NJCA 2H2QA 1B02A 1BSFA 3IX6A 3N5GA 4E5OA 2G8DA 1EV5A 3BYXA 1EVGA 1TDAA 2AAZA 4XSEA 1F4BA 1LCAA 1HW4A 1TISA 1VZCA 4Q0EA 1B49A 4TMSA 3IHIA 1BO7A 4O1XA 1KZIA 3HJ3A 3KGBA 3NRRA 1VZDA 2VETA 4LRRA 2TDDA 4KPWA 4Q0DA 4DPDA 2RD8A 3KJSA 3EGYX 5H3AA 3DL5A 1TVWA 3QJ7A 3KJRA 4GYHA 1ZPRA 1FFLA 1TSVA 1HW3A 3IROA 4IQQA 4EB4A 3ED7A 1BQ2A 1F4GA 1EVFA 1JTUA 2RDAA 4KY4A 4ECKA 3GG5A 1YPVA 4GD7A 4O7UA 1KCEA 2G8AA 4GEVA 3BGXA 2TSRA 1F4FA 3CLBA 3IK1A 1BDUA 1FWMA 3EF9A 4EZ8A 1JMIA 1SEJA 1BO8A 4FGTA 4FOAA 1QZFA 4EINA 3BHLA 1VZBA 4KY8A 4XSDA 1F4DA 1THYA 1BQ1A 1NCEA 1JU6A 1JG0A 2FTNA 1J3JC 1TDCA 4KYAA 2A9WA 4ISKA 3H9KA 5H39A 2VF0A 3BZ0A 1JUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZA A;  3DG8 C;  1F4E A;  1DNA A;  1KZJ A;  1BPJ A;  4ISW A;  1J3K C;  3EHI X;  2ONB A;  2FTO X;  1BSP A;  4FOG A;  3QGT A;  1HZW A;  5H38 A;  2FTQ A;  5WRN A;  1TDU A;  1RTS A;  2TSC A;  3DGA C;  4G2O X;  4O1U A;  1B5D A;  1TSM A;  1BKP A;  1BKO A;  3GH0 A;  2KCE A;  1TDB A;  3EDW X;  4FOX A;  3UM5 A;  3CL9 A;  1CI7 A;  1TVV A;  1B5E A;  4O1X D;  1TYS A;  3V8H A;  4DP3 A;  1AJM A;  3IRN A;  5BY6 A;  2OIP A;  1AN5 A;  4KNZ A;  4E28 A;  4IQB A;  1SYN A;  4XSC A;  1TLC A;  2G89 A;  1F4C A;  4FQS A;  4H0R A;  1TVU A;  1TSY A;  5FCT A;  4EIL A;  4IRR A;  3UM8 A;  1VZE A;  1TSD A;  4H0U A;  3TMS A;  5J7W A;  1JMH A;  1TSN A;  3C06 A;  3IJZ A;  1LCE A;  3BFI A;  1TSZ A;  3IRM A;  1QQQ A;  3OB7 A;  1TSX A;  3C0A A;  3UWL A;  1AIQ A;  3HB8 A;  1JMF A;  1NJB A;  1TLS A;  4UP1 A;  2G86 A;  3UWL B;  1NJD A;  3K2H A;  2BBQ A;  1BP0 A;  5HS3 A;  1BP6 A;  1JTQ A;  3EBU A;  4G6W X;  4DQ1 A;  3GH2 X;  3N5E B;  1JMG A;  1NJE A;  3QG2 A;  4JEF A;  1TSL A;  1J3I C;  4DPH A;  1BID A;  1TRG A;  3B9H A;  3DL6 A;  3EAW X;  3B5B A;  3BNZ A;  3EJL A;  3JSU A;  4H1I A;  1F28 A;  1JUT A;  3HBB A;  1TJS A;  4PSG A;  3UM6 A;  1BJG A;  3I3R A;  1I00 A;  1HVY A;  3INV A;  1AOB A;  1TSW A;  1EV8 A;  2RD8 B;  1AXW A;  2TDM A;  1NJA A;  1DDU A;  2G8X A;  3IK0 A;  1LCB A;  3BHR A;  3N5E A;  4F2V A;  1NJC A;  2H2Q A;  1B02 A;  1BSF A;  3IX6 A;  3N5G A;  4E5O A;  2G8D A;  1EV5 A;  3BYX A;  1EVG A;  1TDA A;  2AAZ A;  4XSE A;  1F4B A;  1LCA A;  1HW4 A;  1TIS A;  1VZC A;  4Q0E A;  1B49 A;  4TMS A;  3IHI A;  1BO7 A;  4O1X A;  1KZI A;  3HJ3 A;  3KGB A;  3NRR A;  1VZD A;  2VET A;  4LRR A;  2TDD A;  4KPW A;  4Q0D A;  4DPD A;  2RD8 A;  3KJS A;  3EGY X;  5H3A A;  3DL5 A;  1TVW A;  3QJ7 A;  3KJR A;  4GYH A;  1ZPR A;  1FFL A;  1TSV A;  1HW3 A;  3IRO A;  4IQQ A;  4EB4 A;  3ED7 A;  1BQ2 A;  1F4G A;  1EVF A;  1JTU A;  2RDA A;  4KY4 A;  4ECK A;  3GG5 A;  1YPV A;  4GD7 A;  4O7U A;  1KCE A;  2G8A A;  4GEV A;  3BGX A;  2TSR A;  1F4F A;  3CLB A;  3IK1 A;  1BDU A;  1FWM A;  3EF9 A;  4EZ8 A;  1JMI A;  1SEJ A;  1BO8 A;  4FGT A;  4FOA A;  1QZF A;  4EIN A;  3BHL A;  1VZB A;  4KY8 A;  4XSD A;  1F4D A;  1THY A;  1BQ1 A;  1NCE A;  1JU6 A;  1JG0 A;  2FTN A;  1J3J C;  1TDC A;  4KYA A;  2A9W A;  4ISK A;  3H9K A;  5H39 A;  2VF0 A;  3BZ0 A;  1JUJ A; 
#chains in the Genus database with same CATH topology
 1VZA A;  3DG8 C;  1F4E A;  1DNA A;  1KZJ A;  1BPJ A;  4ISW A;  1J3K C;  3EHI X;  2ONB A;  2FTO X;  1BSP A;  4FOG A;  3QGT A;  1HZW A;  5H38 A;  2FTQ A;  5WRN A;  1TDU A;  1RTS A;  2TSC A;  3DGA C;  4G2O X;  4O1U A;  1B5D A;  1TSM A;  1BKP A;  1BKO A;  3GH0 A;  2KCE A;  1TDB A;  3EDW X;  4FOX A;  3UM5 A;  3CL9 A;  1CI7 A;  1TVV A;  1B5E A;  4O1X D;  1TYS A;  3V8H A;  4DP3 A;  1AJM A;  3IRN A;  5BY6 A;  2OIP A;  1AN5 A;  4KNZ A;  4E28 A;  4IQB A;  1SYN A;  4XSC A;  1TLC A;  2G89 A;  1F4C A;  4FQS A;  4H0R A;  1TVU A;  1TSY A;  5FCT A;  4EIL A;  4IRR A;  3UM8 A;  1VZE A;  1TSD A;  4H0U A;  3TMS A;  5J7W A;  1JMH A;  1TSN A;  3C06 A;  3IJZ A;  1LCE A;  3BFI A;  1TSZ A;  3IRM A;  1QQQ A;  3OB7 A;  1TSX A;  3C0A A;  3UWL A;  1AIQ A;  3HB8 A;  1JMF A;  1NJB A;  1TLS A;  4UP1 A;  2G86 A;  3UWL B;  1NJD A;  3K2H A;  2BBQ A;  1BP0 A;  5HS3 A;  1BP6 A;  1JTQ A;  3EBU A;  4G6W X;  4DQ1 A;  3GH2 X;  3N5E B;  1JMG A;  1NJE A;  3QG2 A;  4JEF A;  1TSL A;  1J3I C;  4DPH A;  1BID A;  1TRG A;  3B9H A;  3DL6 A;  3EAW X;  3B5B A;  3BNZ A;  3EJL A;  3JSU A;  4H1I A;  1F28 A;  1JUT A;  3HBB A;  1TJS A;  4PSG A;  3UM6 A;  1BJG A;  3I3R A;  1I00 A;  1HVY A;  3INV A;  1AOB A;  1TSW A;  1EV8 A;  2RD8 B;  1AXW A;  2TDM A;  1NJA A;  1DDU A;  2G8X A;  3IK0 A;  1LCB A;  3BHR A;  3N5E A;  4F2V A;  1NJC A;  2H2Q A;  1B02 A;  1BSF A;  3IX6 A;  3N5G A;  4E5O A;  2G8D A;  1EV5 A;  3BYX A;  1EVG A;  1TDA A;  2AAZ A;  4XSE A;  1F4B A;  1LCA A;  1HW4 A;  1TIS A;  1VZC A;  4Q0E A;  1B49 A;  4TMS A;  3IHI A;  1BO7 A;  4O1X A;  1KZI A;  3HJ3 A;  3KGB A;  3NRR A;  1VZD A;  2VET A;  4LRR A;  2TDD A;  4KPW A;  4Q0D A;  4DPD A;  2RD8 A;  3KJS A;  3EGY X;  5H3A A;  3DL5 A;  1TVW A;  3QJ7 A;  3KJR A;  4GYH A;  1ZPR A;  1FFL A;  1TSV A;  1HW3 A;  3IRO A;  4IQQ A;  4EB4 A;  3ED7 A;  1BQ2 A;  1F4G A;  1EVF A;  1JTU A;  2RDA A;  4KY4 A;  4ECK A;  3GG5 A;  1YPV A;  4GD7 A;  4O7U A;  1KCE A;  2G8A A;  4GEV A;  3BGX A;  2TSR A;  1F4F A;  3CLB A;  3IK1 A;  1BDU A;  1FWM A;  3EF9 A;  4EZ8 A;  1JMI A;  1SEJ A;  1BO8 A;  4FGT A;  4FOA A;  1QZF A;  4EIN A;  3BHL A;  1VZB A;  4KY8 A;  4XSD A;  1F4D A;  1THY A;  1BQ1 A;  1NCE A;  1JU6 A;  1JG0 A;  2FTN A;  1J3J C;  1TDC A;  4KYA A;  2A9W A;  4ISK A;  3H9K A;  5H39 A;  2VF0 A;  3BZ0 A;  1JUJ A; 
#chains in the Genus database with same CATH homology
 1VZA A;  3DG8 C;  1F4E A;  1DNA A;  1KZJ A;  1BPJ A;  4ISW A;  1J3K C;  3EHI X;  2ONB A;  2FTO X;  1BSP A;  4FOG A;  3QGT A;  1HZW A;  5H38 A;  2FTQ A;  5WRN A;  1TDU A;  1RTS A;  2TSC A;  3DGA C;  4G2O X;  4O1U A;  1B5D A;  1TSM A;  1BKP A;  1BKO A;  3GH0 A;  2KCE A;  1TDB A;  3EDW X;  4FOX A;  3UM5 A;  3CL9 A;  1CI7 A;  1TVV A;  1B5E A;  4O1X D;  1TYS A;  3V8H A;  4DP3 A;  1AJM A;  3IRN A;  5BY6 A;  2OIP A;  1AN5 A;  4KNZ A;  4E28 A;  4IQB A;  1SYN A;  4XSC A;  1TLC A;  2G89 A;  1F4C A;  4FQS A;  4H0R A;  1TVU A;  1TSY A;  5FCT A;  4EIL A;  4IRR A;  3UM8 A;  1VZE A;  1TSD A;  4H0U A;  3TMS A;  5J7W A;  1JMH A;  1TSN A;  3C06 A;  3IJZ A;  1LCE A;  3BFI A;  1TSZ A;  3IRM A;  1QQQ A;  3OB7 A;  1TSX A;  3C0A A;  3UWL A;  1AIQ A;  3HB8 A;  1JMF A;  1NJB A;  1TLS A;  4UP1 A;  2G86 A;  3UWL B;  1NJD A;  3K2H A;  2BBQ A;  1BP0 A;  5HS3 A;  1BP6 A;  1JTQ A;  3EBU A;  4G6W X;  4DQ1 A;  3GH2 X;  3N5E B;  1JMG A;  1NJE A;  3QG2 A;  4JEF A;  1TSL A;  1J3I C;  4DPH A;  1BID A;  1TRG A;  3B9H A;  3DL6 A;  3EAW X;  3B5B A;  3BNZ A;  3EJL A;  3JSU A;  4H1I A;  1F28 A;  1JUT A;  3HBB A;  1TJS A;  4PSG A;  3UM6 A;  1BJG A;  3I3R A;  1I00 A;  1HVY A;  3INV A;  1AOB A;  1TSW A;  1EV8 A;  2RD8 B;  1AXW A;  2TDM A;  1NJA A;  1DDU A;  2G8X A;  3IK0 A;  1LCB A;  3BHR A;  3N5E A;  4F2V A;  1NJC A;  2H2Q A;  1B02 A;  1BSF A;  3IX6 A;  3N5G A;  4E5O A;  2G8D A;  1EV5 A;  3BYX A;  1EVG A;  1TDA A;  2AAZ A;  4XSE A;  1F4B A;  1LCA A;  1HW4 A;  1TIS A;  1VZC A;  4Q0E A;  1B49 A;  4TMS A;  3IHI A;  1BO7 A;  4O1X A;  1KZI A;  3HJ3 A;  3KGB A;  3NRR A;  1VZD A;  2VET A;  4LRR A;  2TDD A;  4KPW A;  4Q0D A;  4DPD A;  2RD8 A;  3KJS A;  3EGY X;  5H3A A;  3DL5 A;  1TVW A;  3QJ7 A;  3KJR A;  4GYH A;  1ZPR A;  1FFL A;  1TSV A;  1HW3 A;  3IRO A;  4IQQ A;  4EB4 A;  3ED7 A;  1BQ2 A;  1F4G A;  1EVF A;  1JTU A;  2RDA A;  4KY4 A;  4ECK A;  3GG5 A;  1YPV A;  4GD7 A;  4O7U A;  1KCE A;  2G8A A;  4GEV A;  3BGX A;  2TSR A;  1F4F A;  3CLB A;  3IK1 A;  1BDU A;  1FWM A;  3EF9 A;  4EZ8 A;  1JMI A;  1SEJ A;  1BO8 A;  4FGT A;  4FOA A;  1QZF A;  4EIN A;  3BHL A;  1VZB A;  4KY8 A;  4XSD A;  1F4D A;  1THY A;  1BQ1 A;  1NCE A;  1JU6 A;  1JG0 A;  2FTN A;  1J3J C;  1TDC A;  4KYA A;  2A9W A;  4ISK A;  3H9K A;  5H39 A;  2VF0 A;  3BZ0 A;  1JUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...