4EZ8A

Crystal structure of mouse thymidylate sythase in ternary complex with n(4)-hydroxy-2'-deoxycytidine-5'-monophosphate and the cofactor product, dihydrofolate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
287
structure length
287
Chain Sequence
RHGELQYLRQVEHILRCGFKKEDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVRIWDANGSRDFLDSLGFSARQEGDLGPVYGFQWRHFGAEYKDMDSDYSGQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVNGELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLKILRKVETIDDFKVEDFQIEGYNPHPTIKMEMAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate synthase
publication title Crystal structures of complexes of mouse thymidylate synthase crystallized with N4-OH-dCMP alone or in the presence of N5,10-methylenetetrahydrofolate
rcsb
source organism Mus musculus
total genus 95
structure length 287
sequence length 287
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4ez8A00
2KCEA 1NJAA 3IK1A 2TDMA 4O1XD 1JMHA 1JTQA 4ISKA 3OB7A 2A9WA 4GD7A 1I00A 1TRGA 3BFIA 1B5DA 2VETA 4FOGA 1TVWA 3EF9A 1KCEA 4E5OA 1TISA 2AAZA 3H9KA 4KY8A 4DP3A 1JMFA 3ED7A 1NJEA 4DPHA 2BBQA 1BKPA 3CLBA 1HW3A 1TVUA 2G86A 3BGXA 3QJ7A 1VZDA 4PSGA 4EZ8A 1BQ2A 1EV5A 1TDCA 3HB8A 1YPVA 1J3KC 4FQSA 1F4BA 2G8DA 4KY4A 1TSDA 1J3JC 1EVFA 4FOAA 1TDBA 2H2QA 3DG8C 3EHIX 1B5EA 3EJLA 4GYHA 1AN5A 5J7WA 5HS3A 2G8AA 1KZIA 1JG0A 3IX6A 5H38A 1DDUA 1JUTA 1TSVA 5H3AA 1THYA 4EINA 2ONBA 3DL5A 4UP1A 5WRNA 1BSFA 1TYSA 1F4CA 1BP6A 1F4EA 1F4GA 1CI7A 1JTUA 3BHLA 1TVVA 3JSUA 1BDUA 3GH2X 4Q0DA 4XSDA 1BJGA 3HJ3A 3CL9A 4XSEA 1TJSA 3NRRA 4G2OX 1LCAA 3IRMA 3C06A 3N5EA 4DPDA 3N5GA 1AXWA 5H39A 3UM6A 1BIDA 3GH0A 3UM5A 3KJSA 4EB4A 1HW4A 2RD8A 2OIPA 1VZEA 3BYXA 4FOXA 3B9HA 1TSYA 1B49A 1HZWA 3N5EB 3K2HA 4FGTA 3UWLA 4ECKA 4G6WX 2TSCA 2RD8B 1JU6A 2TDDA 3QGTA 1TDAA 1VZCA 3EGYX 1QZFA 3INVA 1BO7A 4KPWA 4TMSA 4XSCA 3UWLB 1AOBA 1HVYA 3B5BA 1NJCA 3QG2A 1LCEA 1TLSA 1AJMA 1AIQA 2G89A 3DGAC 3I3RA 1NJDA 3EAWX 4IRRA 3BHRA 3IROA 1BP0A 1FWMA 4JEFA 1SEJA 1NJBA 2G8XA 1BSPA 1F28A 1FFLA 3GG5A 2FTNA 1J3IC 1NCEA 1F4FA 1VZBA 4E28A 2TSRA 4O7UA 2RDAA 4KNZA 3EBUA 1BPJA 3C0AA 5FCTA 4KYAA 3BNZA 4LRRA 1TLCA 3KJRA 3IHIA 1RTSA 4EILA 1JMGA 1TSXA 3UM8A 4IQBA 3IRNA 1F4DA 1TSNA 4F2VA 4GEVA 1QQQA 1BO8A 1TSLA 1TSMA 1JUJA 5BY6A 3IK0A 3TMSA 1BKOA 3KGBA 1TDUA 3IJZA 2VF0A 4Q0EA 4ISWA 1DNAA 4H0RA 1SYNA 1EVGA 1KZJA 4H0UA 1TSZA 4O1XA 1ZPRA 1JMIA 1TSWA 3EDWX 4H1IA 3BZ0A 4O1UA 2FTOX 4DQ1A 1B02A 4IQQA 3V8HA 3HBBA 1LCBA 3DL6A 1BQ1A 1EV8A 2FTQA 1VZAA
chains in the Genus database with same CATH superfamily
2KCEA 1NJAA 3IK1A 2TDMA 4O1XD 1JMHA 1JTQA 4ISKA 3OB7A 2A9WA 4GD7A 1I00A 1TRGA 3BFIA 1B5DA 2VETA 4FOGA 1TVWA 3EF9A 1KCEA 4E5OA 1TISA 2AAZA 3H9KA 4KY8A 4DP3A 1JMFA 3ED7A 1NJEA 4DPHA 2BBQA 1BKPA 3CLBA 1HW3A 1TVUA 2G86A 3BGXA 3QJ7A 1VZDA 4PSGA 4EZ8A 1BQ2A 1EV5A 1TDCA 3HB8A 1YPVA 1J3KC 4FQSA 1F4BA 2G8DA 4KY4A 1TSDA 1J3JC 1EVFA 4FOAA 1TDBA 2H2QA 3DG8C 3EHIX 1B5EA 3EJLA 4GYHA 1AN5A 5J7WA 5HS3A 2G8AA 1KZIA 1JG0A 3IX6A 5H38A 1DDUA 1JUTA 1TSVA 5H3AA 1THYA 4EINA 2ONBA 3DL5A 4UP1A 5WRNA 1BSFA 1TYSA 1F4CA 1BP6A 1F4EA 1F4GA 1CI7A 1JTUA 3BHLA 1TVVA 3JSUA 1BDUA 3GH2X 4Q0DA 4XSDA 1BJGA 3HJ3A 3CL9A 4XSEA 1TJSA 3NRRA 4G2OX 1LCAA 3IRMA 3C06A 3N5EA 4DPDA 3N5GA 1AXWA 5H39A 3UM6A 1BIDA 3GH0A 3UM5A 3KJSA 4EB4A 1HW4A 2RD8A 2OIPA 1VZEA 3BYXA 4FOXA 3B9HA 1TSYA 1B49A 1HZWA 3N5EB 3K2HA 4FGTA 3UWLA 4ECKA 4G6WX 2TSCA 2RD8B 1JU6A 2TDDA 3QGTA 1TDAA 1VZCA 3EGYX 1QZFA 3INVA 1BO7A 4KPWA 4TMSA 4XSCA 3UWLB 1AOBA 1HVYA 3B5BA 1NJCA 3QG2A 1LCEA 1TLSA 1AJMA 1AIQA 2G89A 3DGAC 3I3RA 1NJDA 3EAWX 4IRRA 3BHRA 3IROA 1BP0A 1FWMA 4JEFA 1SEJA 1NJBA 2G8XA 1BSPA 1F28A 1FFLA 3GG5A 2FTNA 1J3IC 1NCEA 1F4FA 1VZBA 4E28A 2TSRA 4O7UA 2RDAA 4KNZA 3EBUA 1BPJA 3C0AA 5FCTA 4KYAA 3BNZA 4LRRA 1TLCA 3KJRA 3IHIA 1RTSA 4EILA 1JMGA 1TSXA 3UM8A 4IQBA 3IRNA 1F4DA 1TSNA 4F2VA 4GEVA 1QQQA 1BO8A 1TSLA 1TSMA 1JUJA 5BY6A 3IK0A 3TMSA 1BKOA 3KGBA 1TDUA 3IJZA 2VF0A 4Q0EA 4ISWA 1DNAA 4H0RA 1SYNA 1EVGA 1KZJA 4H0UA 1TSZA 4O1XA 1ZPRA 1JMIA 1TSWA 3EDWX 4H1IA 3BZ0A 4O1UA 2FTOX 4DQ1A 1B02A 4IQQA 3V8HA 3HBBA 1LCBA 3DL6A 1BQ1A 1EV8A 2FTQA 1VZAA
chains in the Genus database with same CATH topology
2KCEA 1NJAA 3IK1A 2TDMA 4O1XD 1JMHA 1JTQA 4ISKA 3OB7A 2A9WA 4GD7A 1I00A 1TRGA 3BFIA 1B5DA 2VETA 4FOGA 1TVWA 3EF9A 1KCEA 4E5OA 1TISA 2AAZA 3H9KA 4KY8A 4DP3A 1JMFA 3ED7A 1NJEA 4DPHA 2BBQA 1BKPA 3CLBA 1HW3A 1TVUA 2G86A 3BGXA 3QJ7A 1VZDA 4PSGA 4EZ8A 1BQ2A 1EV5A 1TDCA 3HB8A 1YPVA 1J3KC 4FQSA 1F4BA 2G8DA 4KY4A 1TSDA 1J3JC 1EVFA 4FOAA 1TDBA 2H2QA 3DG8C 3EHIX 1B5EA 3EJLA 4GYHA 1AN5A 5J7WA 5HS3A 2G8AA 1KZIA 1JG0A 3IX6A 5H38A 1DDUA 1JUTA 1TSVA 5H3AA 1THYA 4EINA 2ONBA 3DL5A 4UP1A 5WRNA 1BSFA 1TYSA 1F4CA 1BP6A 1F4EA 1F4GA 1CI7A 1JTUA 3BHLA 1TVVA 3JSUA 1BDUA 3GH2X 4Q0DA 4XSDA 1BJGA 3HJ3A 3CL9A 4XSEA 1TJSA 3NRRA 4G2OX 1LCAA 3IRMA 3C06A 3N5EA 4DPDA 3N5GA 1AXWA 5H39A 3UM6A 1BIDA 3GH0A 3UM5A 3KJSA 4EB4A 1HW4A 2RD8A 2OIPA 1VZEA 3BYXA 4FOXA 3B9HA 1TSYA 1B49A 1HZWA 3N5EB 3K2HA 4FGTA 3UWLA 4ECKA 4G6WX 2TSCA 2RD8B 1JU6A 2TDDA 3QGTA 1TDAA 1VZCA 3EGYX 1QZFA 3INVA 1BO7A 4KPWA 4TMSA 4XSCA 3UWLB 1AOBA 1HVYA 3B5BA 1NJCA 3QG2A 1LCEA 1TLSA 1AJMA 1AIQA 2G89A 3DGAC 3I3RA 1NJDA 3EAWX 4IRRA 3BHRA 3IROA 1BP0A 1FWMA 4JEFA 1SEJA 1NJBA 2G8XA 1BSPA 1F28A 1FFLA 3GG5A 2FTNA 1J3IC 1NCEA 1F4FA 1VZBA 4E28A 2TSRA 4O7UA 2RDAA 4KNZA 3EBUA 1BPJA 3C0AA 5FCTA 4KYAA 3BNZA 4LRRA 1TLCA 3KJRA 3IHIA 1RTSA 4EILA 1JMGA 1TSXA 3UM8A 4IQBA 3IRNA 1F4DA 1TSNA 4F2VA 4GEVA 1QQQA 1BO8A 1TSLA 1TSMA 1JUJA 5BY6A 3IK0A 3TMSA 1BKOA 3KGBA 1TDUA 3IJZA 2VF0A 4Q0EA 4ISWA 1DNAA 4H0RA 1SYNA 1EVGA 1KZJA 4H0UA 1TSZA 4O1XA 1ZPRA 1JMIA 1TSWA 3EDWX 4H1IA 3BZ0A 4O1UA 2FTOX 4DQ1A 1B02A 4IQQA 3V8HA 3HBBA 1LCBA 3DL6A 1BQ1A 1EV8A 2FTQA 1VZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCE A;  1NJA A;  3IK1 A;  2TDM A;  4O1X D;  1JMH A;  1JTQ A;  4ISK A;  3OB7 A;  2A9W A;  4GD7 A;  1I00 A;  1TRG A;  3BFI A;  1B5D A;  2VET A;  4FOG A;  1TVW A;  3EF9 A;  1KCE A;  4E5O A;  1TIS A;  2AAZ A;  3H9K A;  4KY8 A;  4DP3 A;  1JMF A;  3ED7 A;  1NJE A;  4DPH A;  2BBQ A;  1BKP A;  3CLB A;  1HW3 A;  1TVU A;  2G86 A;  3BGX A;  3QJ7 A;  1VZD A;  4PSG A;  4EZ8 A;  1BQ2 A;  1EV5 A;  1TDC A;  3HB8 A;  1YPV A;  1J3K C;  4FQS A;  1F4B A;  2G8D A;  4KY4 A;  1TSD A;  1J3J C;  1EVF A;  4FOA A;  1TDB A;  2H2Q A;  3DG8 C;  3EHI X;  1B5E A;  3EJL A;  4GYH A;  1AN5 A;  5J7W A;  5HS3 A;  2G8A A;  1KZI A;  1JG0 A;  3IX6 A;  5H38 A;  1DDU A;  1JUT A;  1TSV A;  5H3A A;  1THY A;  4EIN A;  2ONB A;  3DL5 A;  4UP1 A;  5WRN A;  1BSF A;  1TYS A;  1F4C A;  1BP6 A;  1F4E A;  1F4G A;  1CI7 A;  1JTU A;  3BHL A;  1TVV A;  3JSU A;  1BDU A;  3GH2 X;  4Q0D A;  4XSD A;  1BJG A;  3HJ3 A;  3CL9 A;  4XSE A;  1TJS A;  3NRR A;  4G2O X;  1LCA A;  3IRM A;  3C06 A;  3N5E A;  4DPD A;  3N5G A;  1AXW A;  5H39 A;  3UM6 A;  1BID A;  3GH0 A;  3UM5 A;  3KJS A;  4EB4 A;  1HW4 A;  2RD8 A;  2OIP A;  1VZE A;  3BYX A;  4FOX A;  3B9H A;  1TSY A;  1B49 A;  1HZW A;  3N5E B;  3K2H A;  4FGT A;  3UWL A;  4ECK A;  4G6W X;  2TSC A;  2RD8 B;  1JU6 A;  2TDD A;  3QGT A;  1TDA A;  1VZC A;  3EGY X;  1QZF A;  3INV A;  1BO7 A;  4KPW A;  4TMS A;  4XSC A;  3UWL B;  1AOB A;  1HVY A;  3B5B A;  1NJC A;  3QG2 A;  1LCE A;  1TLS A;  1AJM A;  1AIQ A;  2G89 A;  3DGA C;  3I3R A;  1NJD A;  3EAW X;  4IRR A;  3BHR A;  3IRO A;  1BP0 A;  1FWM A;  4JEF A;  1SEJ A;  1NJB A;  2G8X A;  1BSP A;  1F28 A;  1FFL A;  3GG5 A;  2FTN A;  1J3I C;  1NCE A;  1F4F A;  1VZB A;  4E28 A;  2TSR A;  4O7U A;  2RDA A;  4KNZ A;  3EBU A;  1BPJ A;  3C0A A;  5FCT A;  4KYA A;  3BNZ A;  4LRR A;  1TLC A;  3KJR A;  3IHI A;  1RTS A;  4EIL A;  1JMG A;  1TSX A;  3UM8 A;  4IQB A;  3IRN A;  1F4D A;  1TSN A;  4F2V A;  4GEV A;  1QQQ A;  1BO8 A;  1TSL A;  1TSM A;  1JUJ A;  5BY6 A;  3IK0 A;  3TMS A;  1BKO A;  3KGB A;  1TDU A;  3IJZ A;  2VF0 A;  4Q0E A;  4ISW A;  1DNA A;  4H0R A;  1SYN A;  1EVG A;  1KZJ A;  4H0U A;  1TSZ A;  4O1X A;  1ZPR A;  1JMI A;  1TSW A;  3EDW X;  4H1I A;  3BZ0 A;  4O1U A;  2FTO X;  4DQ1 A;  1B02 A;  4IQQ A;  3V8H A;  3HBB A;  1LCB A;  3DL6 A;  1BQ1 A;  1EV8 A;  2FTQ A;  1VZA A; 
#chains in the Genus database with same CATH topology
 2KCE A;  1NJA A;  3IK1 A;  2TDM A;  4O1X D;  1JMH A;  1JTQ A;  4ISK A;  3OB7 A;  2A9W A;  4GD7 A;  1I00 A;  1TRG A;  3BFI A;  1B5D A;  2VET A;  4FOG A;  1TVW A;  3EF9 A;  1KCE A;  4E5O A;  1TIS A;  2AAZ A;  3H9K A;  4KY8 A;  4DP3 A;  1JMF A;  3ED7 A;  1NJE A;  4DPH A;  2BBQ A;  1BKP A;  3CLB A;  1HW3 A;  1TVU A;  2G86 A;  3BGX A;  3QJ7 A;  1VZD A;  4PSG A;  4EZ8 A;  1BQ2 A;  1EV5 A;  1TDC A;  3HB8 A;  1YPV A;  1J3K C;  4FQS A;  1F4B A;  2G8D A;  4KY4 A;  1TSD A;  1J3J C;  1EVF A;  4FOA A;  1TDB A;  2H2Q A;  3DG8 C;  3EHI X;  1B5E A;  3EJL A;  4GYH A;  1AN5 A;  5J7W A;  5HS3 A;  2G8A A;  1KZI A;  1JG0 A;  3IX6 A;  5H38 A;  1DDU A;  1JUT A;  1TSV A;  5H3A A;  1THY A;  4EIN A;  2ONB A;  3DL5 A;  4UP1 A;  5WRN A;  1BSF A;  1TYS A;  1F4C A;  1BP6 A;  1F4E A;  1F4G A;  1CI7 A;  1JTU A;  3BHL A;  1TVV A;  3JSU A;  1BDU A;  3GH2 X;  4Q0D A;  4XSD A;  1BJG A;  3HJ3 A;  3CL9 A;  4XSE A;  1TJS A;  3NRR A;  4G2O X;  1LCA A;  3IRM A;  3C06 A;  3N5E A;  4DPD A;  3N5G A;  1AXW A;  5H39 A;  3UM6 A;  1BID A;  3GH0 A;  3UM5 A;  3KJS A;  4EB4 A;  1HW4 A;  2RD8 A;  2OIP A;  1VZE A;  3BYX A;  4FOX A;  3B9H A;  1TSY A;  1B49 A;  1HZW A;  3N5E B;  3K2H A;  4FGT A;  3UWL A;  4ECK A;  4G6W X;  2TSC A;  2RD8 B;  1JU6 A;  2TDD A;  3QGT A;  1TDA A;  1VZC A;  3EGY X;  1QZF A;  3INV A;  1BO7 A;  4KPW A;  4TMS A;  4XSC A;  3UWL B;  1AOB A;  1HVY A;  3B5B A;  1NJC A;  3QG2 A;  1LCE A;  1TLS A;  1AJM A;  1AIQ A;  2G89 A;  3DGA C;  3I3R A;  1NJD A;  3EAW X;  4IRR A;  3BHR A;  3IRO A;  1BP0 A;  1FWM A;  4JEF A;  1SEJ A;  1NJB A;  2G8X A;  1BSP A;  1F28 A;  1FFL A;  3GG5 A;  2FTN A;  1J3I C;  1NCE A;  1F4F A;  1VZB A;  4E28 A;  2TSR A;  4O7U A;  2RDA A;  4KNZ A;  3EBU A;  1BPJ A;  3C0A A;  5FCT A;  4KYA A;  3BNZ A;  4LRR A;  1TLC A;  3KJR A;  3IHI A;  1RTS A;  4EIL A;  1JMG A;  1TSX A;  3UM8 A;  4IQB A;  3IRN A;  1F4D A;  1TSN A;  4F2V A;  4GEV A;  1QQQ A;  1BO8 A;  1TSL A;  1TSM A;  1JUJ A;  5BY6 A;  3IK0 A;  3TMS A;  1BKO A;  3KGB A;  1TDU A;  3IJZ A;  2VF0 A;  4Q0E A;  4ISW A;  1DNA A;  4H0R A;  1SYN A;  1EVG A;  1KZJ A;  4H0U A;  1TSZ A;  4O1X A;  1ZPR A;  1JMI A;  1TSW A;  3EDW X;  4H1I A;  3BZ0 A;  4O1U A;  2FTO X;  4DQ1 A;  1B02 A;  4IQQ A;  3V8H A;  3HBB A;  1LCB A;  3DL6 A;  1BQ1 A;  1EV8 A;  2FTQ A;  1VZA A; 
#chains in the Genus database with same CATH homology
 2KCE A;  1NJA A;  3IK1 A;  2TDM A;  4O1X D;  1JMH A;  1JTQ A;  4ISK A;  3OB7 A;  2A9W A;  4GD7 A;  1I00 A;  1TRG A;  3BFI A;  1B5D A;  2VET A;  4FOG A;  1TVW A;  3EF9 A;  1KCE A;  4E5O A;  1TIS A;  2AAZ A;  3H9K A;  4KY8 A;  4DP3 A;  1JMF A;  3ED7 A;  1NJE A;  4DPH A;  2BBQ A;  1BKP A;  3CLB A;  1HW3 A;  1TVU A;  2G86 A;  3BGX A;  3QJ7 A;  1VZD A;  4PSG A;  4EZ8 A;  1BQ2 A;  1EV5 A;  1TDC A;  3HB8 A;  1YPV A;  1J3K C;  4FQS A;  1F4B A;  2G8D A;  4KY4 A;  1TSD A;  1J3J C;  1EVF A;  4FOA A;  1TDB A;  2H2Q A;  3DG8 C;  3EHI X;  1B5E A;  3EJL A;  4GYH A;  1AN5 A;  5J7W A;  5HS3 A;  2G8A A;  1KZI A;  1JG0 A;  3IX6 A;  5H38 A;  1DDU A;  1JUT A;  1TSV A;  5H3A A;  1THY A;  4EIN A;  2ONB A;  3DL5 A;  4UP1 A;  5WRN A;  1BSF A;  1TYS A;  1F4C A;  1BP6 A;  1F4E A;  1F4G A;  1CI7 A;  1JTU A;  3BHL A;  1TVV A;  3JSU A;  1BDU A;  3GH2 X;  4Q0D A;  4XSD A;  1BJG A;  3HJ3 A;  3CL9 A;  4XSE A;  1TJS A;  3NRR A;  4G2O X;  1LCA A;  3IRM A;  3C06 A;  3N5E A;  4DPD A;  3N5G A;  1AXW A;  5H39 A;  3UM6 A;  1BID A;  3GH0 A;  3UM5 A;  3KJS A;  4EB4 A;  1HW4 A;  2RD8 A;  2OIP A;  1VZE A;  3BYX A;  4FOX A;  3B9H A;  1TSY A;  1B49 A;  1HZW A;  3N5E B;  3K2H A;  4FGT A;  3UWL A;  4ECK A;  4G6W X;  2TSC A;  2RD8 B;  1JU6 A;  2TDD A;  3QGT A;  1TDA A;  1VZC A;  3EGY X;  1QZF A;  3INV A;  1BO7 A;  4KPW A;  4TMS A;  4XSC A;  3UWL B;  1AOB A;  1HVY A;  3B5B A;  1NJC A;  3QG2 A;  1LCE A;  1TLS A;  1AJM A;  1AIQ A;  2G89 A;  3DGA C;  3I3R A;  1NJD A;  3EAW X;  4IRR A;  3BHR A;  3IRO A;  1BP0 A;  1FWM A;  4JEF A;  1SEJ A;  1NJB A;  2G8X A;  1BSP A;  1F28 A;  1FFL A;  3GG5 A;  2FTN A;  1J3I C;  1NCE A;  1F4F A;  1VZB A;  4E28 A;  2TSR A;  4O7U A;  2RDA A;  4KNZ A;  3EBU A;  1BPJ A;  3C0A A;  5FCT A;  4KYA A;  3BNZ A;  4LRR A;  1TLC A;  3KJR A;  3IHI A;  1RTS A;  4EIL A;  1JMG A;  1TSX A;  3UM8 A;  4IQB A;  3IRN A;  1F4D A;  1TSN A;  4F2V A;  4GEV A;  1QQQ A;  1BO8 A;  1TSL A;  1TSM A;  1JUJ A;  5BY6 A;  3IK0 A;  3TMS A;  1BKO A;  3KGB A;  1TDU A;  3IJZ A;  2VF0 A;  4Q0E A;  4ISW A;  1DNA A;  4H0R A;  1SYN A;  1EVG A;  1KZJ A;  4H0U A;  1TSZ A;  4O1X A;  1ZPR A;  1JMI A;  1TSW A;  3EDW X;  4H1I A;  3BZ0 A;  4O1U A;  2FTO X;  4DQ1 A;  1B02 A;  4IQQ A;  3V8H A;  3HBB A;  1LCB A;  3DL6 A;  1BQ1 A;  1EV8 A;  2FTQ A;  1VZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...