4F2VA

Crystal structure of de novo designed serine hydrolase, northeast structural genomics consortium (nesg) target or165
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
261
structure length
261
Chain Sequence
KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHLLLWFLQGDTNIAYLHENNVTILDEWADENGDLGPVHGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMANAPSHAFFQFYVADGKLSCQLYARSEDVFLSLPFAIASGALLVHMMAQQCDLEVGDFVMTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords De novo designed serine hydrolase
publication title Design of activated serine-containing catalytic triads with atomic-level accuracy.
pubmed doi rcsb
source organism Artificial gene
total genus 72
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4f2vA00
2G8AA 4FQSA 4FOXA 4IQBA 5FCTA 3V8HA 1TSZA 4O1UA 4KY8A 3UWLA 1TSMA 1BO7A 3H9KA 4G2OX 4EINA 1TSWA 1TDAA 1TRGA 3N5EA 4DPHA 1BIDA 1EVGA 1LCAA 2H2QA 2TSCA 1KZJA 4JEFA 1FWMA 1KZIA 3EAWX 1TSLA 1DDUA 3OB7A 2G86A 4EILA 1JG0A 5WRNA 1J3IC 1JMIA 1NJDA 3EBUA 1TSDA 1QQQA 1BJGA 3B5BA 1LCBA 2TDMA 1JTQA 2G8DA 1AOBA 1TVWA 3GG5A 3KJSA 3UM6A 3UM5A 1EV5A 1J3JC 4GD7A 3DL6A 1TYSA 1BQ1A 3KJRA 3KGBA 1J3KC 3IRNA 1BQ2A 3JSUA 4FGTA 1TJSA 1B5DA 1TLCA 1THYA 1B02A 3GH0A 3BZ0A 3UM8A 1CI7A 1F4CA 5HS3A 3HB8A 2AAZA 1VZBA 3IJZA 1HZWA 3IK0A 4XSEA 3GH2X 4ECKA 3HBBA 1TDCA 4ISKA 1VZCA 2RDAA 3ED7A 4XSDA 4EB4A 1B49A 3BGXA 1JU6A 3EHIX 1F28A 1JUTA 1KCEA 3EF9A 4KYAA 1NJEA 4UP1A 1BDUA 3BHLA 1BSFA 2RD8A 3CLBA 4PSGA 1TVUA 4DPDA 3INVA 4XSCA 4EZ8A 5H38A 1DNAA 3UWLB 1NJAA 1TDUA 1EV8A 1TDBA 3I3RA 3QJ7A 1SEJA 4GEVA 1FFLA 1BKOA 2TDDA 1BO8A 3N5EB 1BSPA 1EVFA 3N5GA 4O1XD 1BP0A 1TSNA 2VF0A 4LRRA 1JUJA 2FTOX 3DGAC 1JMHA 3EJLA 1BKPA 1SYNA 2A9WA 1NJBA 4G6WX 4ISWA 5J7WA 1LCEA 4H1IA 3EGYX 1NJCA 3K2HA 4DQ1A 4KNZA 3IRMA 4IRRA 1F4BA 3BNZA 1HVYA 1JTUA 1VZEA 1TISA 4F2VA 1I00A 2VETA 5BY6A 3C06A 3EDWX 4KY4A 1VZDA 4H0RA 4E5OA 4FOGA 1B5EA 4H0UA 1AXWA 1HW4A 3IHIA 1VZAA 3DL5A 3IROA 3B9HA 4FOAA 4KPWA 2BBQA 2OIPA 1NCEA 1TVVA 2TSRA 3BHRA 1YPVA 4DP3A 3IK1A 1TSXA 1AN5A 2KCEA 3C0AA 4GYHA 1AJMA 1HW3A 3IX6A 4O1XA 4Q0EA 1RTSA 1TLSA 3HJ3A 4IQQA 2FTNA 2RD8B 1AIQA 1F4FA 4E28A 1F4GA 3BYXA 2FTQA 3NRRA 3DG8C 1TSYA 1BPJA 4O7UA 1JMFA 1ZPRA 4TMSA 5H39A 1JMGA 5H3AA 1F4EA 2ONBA 3QGTA 2G89A 3TMSA 1QZFA 2G8XA 1TSVA 3BFIA 1BP6A 4Q0DA 3CL9A 1F4DA 3QG2A
chains in the Genus database with same CATH superfamily
2G8AA 4FQSA 4FOXA 4IQBA 5FCTA 3V8HA 1TSZA 4O1UA 4KY8A 3UWLA 1TSMA 1BO7A 3H9KA 4G2OX 4EINA 1TSWA 1TDAA 1TRGA 3N5EA 4DPHA 1BIDA 1EVGA 1LCAA 2H2QA 2TSCA 1KZJA 4JEFA 1FWMA 1KZIA 3EAWX 1TSLA 1DDUA 3OB7A 2G86A 4EILA 1JG0A 5WRNA 1J3IC 1JMIA 1NJDA 3EBUA 1TSDA 1QQQA 1BJGA 3B5BA 1LCBA 2TDMA 1JTQA 2G8DA 1AOBA 1TVWA 3GG5A 3KJSA 3UM6A 3UM5A 1EV5A 1J3JC 4GD7A 3DL6A 1TYSA 1BQ1A 3KJRA 3KGBA 1J3KC 3IRNA 1BQ2A 3JSUA 4FGTA 1TJSA 1B5DA 1TLCA 1THYA 1B02A 3GH0A 3BZ0A 3UM8A 1CI7A 1F4CA 5HS3A 3HB8A 2AAZA 1VZBA 3IJZA 1HZWA 3IK0A 4XSEA 3GH2X 4ECKA 3HBBA 1TDCA 4ISKA 1VZCA 2RDAA 3ED7A 4XSDA 4EB4A 1B49A 3BGXA 1JU6A 3EHIX 1F28A 1JUTA 1KCEA 3EF9A 4KYAA 1NJEA 4UP1A 1BDUA 3BHLA 1BSFA 2RD8A 3CLBA 4PSGA 1TVUA 4DPDA 3INVA 4XSCA 4EZ8A 5H38A 1DNAA 3UWLB 1NJAA 1TDUA 1EV8A 1TDBA 3I3RA 3QJ7A 1SEJA 4GEVA 1FFLA 1BKOA 2TDDA 1BO8A 3N5EB 1BSPA 1EVFA 3N5GA 4O1XD 1BP0A 1TSNA 2VF0A 4LRRA 1JUJA 2FTOX 3DGAC 1JMHA 3EJLA 1BKPA 1SYNA 2A9WA 1NJBA 4G6WX 4ISWA 5J7WA 1LCEA 4H1IA 3EGYX 1NJCA 3K2HA 4DQ1A 4KNZA 3IRMA 4IRRA 1F4BA 3BNZA 1HVYA 1JTUA 1VZEA 1TISA 4F2VA 1I00A 2VETA 5BY6A 3C06A 3EDWX 4KY4A 1VZDA 4H0RA 4E5OA 4FOGA 1B5EA 4H0UA 1AXWA 1HW4A 3IHIA 1VZAA 3DL5A 3IROA 3B9HA 4FOAA 4KPWA 2BBQA 2OIPA 1NCEA 1TVVA 2TSRA 3BHRA 1YPVA 4DP3A 3IK1A 1TSXA 1AN5A 2KCEA 3C0AA 4GYHA 1AJMA 1HW3A 3IX6A 4O1XA 4Q0EA 1RTSA 1TLSA 3HJ3A 4IQQA 2FTNA 2RD8B 1AIQA 1F4FA 4E28A 1F4GA 3BYXA 2FTQA 3NRRA 3DG8C 1TSYA 1BPJA 4O7UA 1JMFA 1ZPRA 4TMSA 5H39A 1JMGA 5H3AA 1F4EA 2ONBA 3QGTA 2G89A 3TMSA 1QZFA 2G8XA 1TSVA 3BFIA 1BP6A 4Q0DA 3CL9A 1F4DA 3QG2A
chains in the Genus database with same CATH topology
2G8AA 4FQSA 4FOXA 4IQBA 5FCTA 3V8HA 1TSZA 4O1UA 4KY8A 3UWLA 1TSMA 1BO7A 3H9KA 4G2OX 4EINA 1TSWA 1TDAA 1TRGA 3N5EA 4DPHA 1BIDA 1EVGA 1LCAA 2H2QA 2TSCA 1KZJA 4JEFA 1FWMA 1KZIA 3EAWX 1TSLA 1DDUA 3OB7A 2G86A 4EILA 1JG0A 5WRNA 1J3IC 1JMIA 1NJDA 3EBUA 1TSDA 1QQQA 1BJGA 3B5BA 1LCBA 2TDMA 1JTQA 2G8DA 1AOBA 1TVWA 3GG5A 3KJSA 3UM6A 3UM5A 1EV5A 1J3JC 4GD7A 3DL6A 1TYSA 1BQ1A 3KJRA 3KGBA 1J3KC 3IRNA 1BQ2A 3JSUA 4FGTA 1TJSA 1B5DA 1TLCA 1THYA 1B02A 3GH0A 3BZ0A 3UM8A 1CI7A 1F4CA 5HS3A 3HB8A 2AAZA 1VZBA 3IJZA 1HZWA 3IK0A 4XSEA 3GH2X 4ECKA 3HBBA 1TDCA 4ISKA 1VZCA 2RDAA 3ED7A 4XSDA 4EB4A 1B49A 3BGXA 1JU6A 3EHIX 1F28A 1JUTA 1KCEA 3EF9A 4KYAA 1NJEA 4UP1A 1BDUA 3BHLA 1BSFA 2RD8A 3CLBA 4PSGA 1TVUA 4DPDA 3INVA 4XSCA 4EZ8A 5H38A 1DNAA 3UWLB 1NJAA 1TDUA 1EV8A 1TDBA 3I3RA 3QJ7A 1SEJA 4GEVA 1FFLA 1BKOA 2TDDA 1BO8A 3N5EB 1BSPA 1EVFA 3N5GA 4O1XD 1BP0A 1TSNA 2VF0A 4LRRA 1JUJA 2FTOX 3DGAC 1JMHA 3EJLA 1BKPA 1SYNA 2A9WA 1NJBA 4G6WX 4ISWA 5J7WA 1LCEA 4H1IA 3EGYX 1NJCA 3K2HA 4DQ1A 4KNZA 3IRMA 4IRRA 1F4BA 3BNZA 1HVYA 1JTUA 1VZEA 1TISA 4F2VA 1I00A 2VETA 5BY6A 3C06A 3EDWX 4KY4A 1VZDA 4H0RA 4E5OA 4FOGA 1B5EA 4H0UA 1AXWA 1HW4A 3IHIA 1VZAA 3DL5A 3IROA 3B9HA 4FOAA 4KPWA 2BBQA 2OIPA 1NCEA 1TVVA 2TSRA 3BHRA 1YPVA 4DP3A 3IK1A 1TSXA 1AN5A 2KCEA 3C0AA 4GYHA 1AJMA 1HW3A 3IX6A 4O1XA 4Q0EA 1RTSA 1TLSA 3HJ3A 4IQQA 2FTNA 2RD8B 1AIQA 1F4FA 4E28A 1F4GA 3BYXA 2FTQA 3NRRA 3DG8C 1TSYA 1BPJA 4O7UA 1JMFA 1ZPRA 4TMSA 5H39A 1JMGA 5H3AA 1F4EA 2ONBA 3QGTA 2G89A 3TMSA 1QZFA 2G8XA 1TSVA 3BFIA 1BP6A 4Q0DA 3CL9A 1F4DA 3QG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G8A A;  4FQS A;  4FOX A;  4IQB A;  5FCT A;  3V8H A;  1TSZ A;  4O1U A;  4KY8 A;  3UWL A;  1TSM A;  1BO7 A;  3H9K A;  4G2O X;  4EIN A;  1TSW A;  1TDA A;  1TRG A;  3N5E A;  4DPH A;  1BID A;  1EVG A;  1LCA A;  2H2Q A;  2TSC A;  1KZJ A;  4JEF A;  1FWM A;  1KZI A;  3EAW X;  1TSL A;  1DDU A;  3OB7 A;  2G86 A;  4EIL A;  1JG0 A;  5WRN A;  1J3I C;  1JMI A;  1NJD A;  3EBU A;  1TSD A;  1QQQ A;  1BJG A;  3B5B A;  1LCB A;  2TDM A;  1JTQ A;  2G8D A;  1AOB A;  1TVW A;  3GG5 A;  3KJS A;  3UM6 A;  3UM5 A;  1EV5 A;  1J3J C;  4GD7 A;  3DL6 A;  1TYS A;  1BQ1 A;  3KJR A;  3KGB A;  1J3K C;  3IRN A;  1BQ2 A;  3JSU A;  4FGT A;  1TJS A;  1B5D A;  1TLC A;  1THY A;  1B02 A;  3GH0 A;  3BZ0 A;  3UM8 A;  1CI7 A;  1F4C A;  5HS3 A;  3HB8 A;  2AAZ A;  1VZB A;  3IJZ A;  1HZW A;  3IK0 A;  4XSE A;  3GH2 X;  4ECK A;  3HBB A;  1TDC A;  4ISK A;  1VZC A;  2RDA A;  3ED7 A;  4XSD A;  4EB4 A;  1B49 A;  3BGX A;  1JU6 A;  3EHI X;  1F28 A;  1JUT A;  1KCE A;  3EF9 A;  4KYA A;  1NJE A;  4UP1 A;  1BDU A;  3BHL A;  1BSF A;  2RD8 A;  3CLB A;  4PSG A;  1TVU A;  4DPD A;  3INV A;  4XSC A;  4EZ8 A;  5H38 A;  1DNA A;  3UWL B;  1NJA A;  1TDU A;  1EV8 A;  1TDB A;  3I3R A;  3QJ7 A;  1SEJ A;  4GEV A;  1FFL A;  1BKO A;  2TDD A;  1BO8 A;  3N5E B;  1BSP A;  1EVF A;  3N5G A;  4O1X D;  1BP0 A;  1TSN A;  2VF0 A;  4LRR A;  1JUJ A;  2FTO X;  3DGA C;  1JMH A;  3EJL A;  1BKP A;  1SYN A;  2A9W A;  1NJB A;  4G6W X;  4ISW A;  5J7W A;  1LCE A;  4H1I A;  3EGY X;  1NJC A;  3K2H A;  4DQ1 A;  4KNZ A;  3IRM A;  4IRR A;  1F4B A;  3BNZ A;  1HVY A;  1JTU A;  1VZE A;  1TIS A;  4F2V A;  1I00 A;  2VET A;  5BY6 A;  3C06 A;  3EDW X;  4KY4 A;  1VZD A;  4H0R A;  4E5O A;  4FOG A;  1B5E A;  4H0U A;  1AXW A;  1HW4 A;  3IHI A;  1VZA A;  3DL5 A;  3IRO A;  3B9H A;  4FOA A;  4KPW A;  2BBQ A;  2OIP A;  1NCE A;  1TVV A;  2TSR A;  3BHR A;  1YPV A;  4DP3 A;  3IK1 A;  1TSX A;  1AN5 A;  2KCE A;  3C0A A;  4GYH A;  1AJM A;  1HW3 A;  3IX6 A;  4O1X A;  4Q0E A;  1RTS A;  1TLS A;  3HJ3 A;  4IQQ A;  2FTN A;  2RD8 B;  1AIQ A;  1F4F A;  4E28 A;  1F4G A;  3BYX A;  2FTQ A;  3NRR A;  3DG8 C;  1TSY A;  1BPJ A;  4O7U A;  1JMF A;  1ZPR A;  4TMS A;  5H39 A;  1JMG A;  5H3A A;  1F4E A;  2ONB A;  3QGT A;  2G89 A;  3TMS A;  1QZF A;  2G8X A;  1TSV A;  3BFI A;  1BP6 A;  4Q0D A;  3CL9 A;  1F4D A;  3QG2 A; 
#chains in the Genus database with same CATH topology
 2G8A A;  4FQS A;  4FOX A;  4IQB A;  5FCT A;  3V8H A;  1TSZ A;  4O1U A;  4KY8 A;  3UWL A;  1TSM A;  1BO7 A;  3H9K A;  4G2O X;  4EIN A;  1TSW A;  1TDA A;  1TRG A;  3N5E A;  4DPH A;  1BID A;  1EVG A;  1LCA A;  2H2Q A;  2TSC A;  1KZJ A;  4JEF A;  1FWM A;  1KZI A;  3EAW X;  1TSL A;  1DDU A;  3OB7 A;  2G86 A;  4EIL A;  1JG0 A;  5WRN A;  1J3I C;  1JMI A;  1NJD A;  3EBU A;  1TSD A;  1QQQ A;  1BJG A;  3B5B A;  1LCB A;  2TDM A;  1JTQ A;  2G8D A;  1AOB A;  1TVW A;  3GG5 A;  3KJS A;  3UM6 A;  3UM5 A;  1EV5 A;  1J3J C;  4GD7 A;  3DL6 A;  1TYS A;  1BQ1 A;  3KJR A;  3KGB A;  1J3K C;  3IRN A;  1BQ2 A;  3JSU A;  4FGT A;  1TJS A;  1B5D A;  1TLC A;  1THY A;  1B02 A;  3GH0 A;  3BZ0 A;  3UM8 A;  1CI7 A;  1F4C A;  5HS3 A;  3HB8 A;  2AAZ A;  1VZB A;  3IJZ A;  1HZW A;  3IK0 A;  4XSE A;  3GH2 X;  4ECK A;  3HBB A;  1TDC A;  4ISK A;  1VZC A;  2RDA A;  3ED7 A;  4XSD A;  4EB4 A;  1B49 A;  3BGX A;  1JU6 A;  3EHI X;  1F28 A;  1JUT A;  1KCE A;  3EF9 A;  4KYA A;  1NJE A;  4UP1 A;  1BDU A;  3BHL A;  1BSF A;  2RD8 A;  3CLB A;  4PSG A;  1TVU A;  4DPD A;  3INV A;  4XSC A;  4EZ8 A;  5H38 A;  1DNA A;  3UWL B;  1NJA A;  1TDU A;  1EV8 A;  1TDB A;  3I3R A;  3QJ7 A;  1SEJ A;  4GEV A;  1FFL A;  1BKO A;  2TDD A;  1BO8 A;  3N5E B;  1BSP A;  1EVF A;  3N5G A;  4O1X D;  1BP0 A;  1TSN A;  2VF0 A;  4LRR A;  1JUJ A;  2FTO X;  3DGA C;  1JMH A;  3EJL A;  1BKP A;  1SYN A;  2A9W A;  1NJB A;  4G6W X;  4ISW A;  5J7W A;  1LCE A;  4H1I A;  3EGY X;  1NJC A;  3K2H A;  4DQ1 A;  4KNZ A;  3IRM A;  4IRR A;  1F4B A;  3BNZ A;  1HVY A;  1JTU A;  1VZE A;  1TIS A;  4F2V A;  1I00 A;  2VET A;  5BY6 A;  3C06 A;  3EDW X;  4KY4 A;  1VZD A;  4H0R A;  4E5O A;  4FOG A;  1B5E A;  4H0U A;  1AXW A;  1HW4 A;  3IHI A;  1VZA A;  3DL5 A;  3IRO A;  3B9H A;  4FOA A;  4KPW A;  2BBQ A;  2OIP A;  1NCE A;  1TVV A;  2TSR A;  3BHR A;  1YPV A;  4DP3 A;  3IK1 A;  1TSX A;  1AN5 A;  2KCE A;  3C0A A;  4GYH A;  1AJM A;  1HW3 A;  3IX6 A;  4O1X A;  4Q0E A;  1RTS A;  1TLS A;  3HJ3 A;  4IQQ A;  2FTN A;  2RD8 B;  1AIQ A;  1F4F A;  4E28 A;  1F4G A;  3BYX A;  2FTQ A;  3NRR A;  3DG8 C;  1TSY A;  1BPJ A;  4O7U A;  1JMF A;  1ZPR A;  4TMS A;  5H39 A;  1JMG A;  5H3A A;  1F4E A;  2ONB A;  3QGT A;  2G89 A;  3TMS A;  1QZF A;  2G8X A;  1TSV A;  3BFI A;  1BP6 A;  4Q0D A;  3CL9 A;  1F4D A;  3QG2 A; 
#chains in the Genus database with same CATH homology
 2G8A A;  4FQS A;  4FOX A;  4IQB A;  5FCT A;  3V8H A;  1TSZ A;  4O1U A;  4KY8 A;  3UWL A;  1TSM A;  1BO7 A;  3H9K A;  4G2O X;  4EIN A;  1TSW A;  1TDA A;  1TRG A;  3N5E A;  4DPH A;  1BID A;  1EVG A;  1LCA A;  2H2Q A;  2TSC A;  1KZJ A;  4JEF A;  1FWM A;  1KZI A;  3EAW X;  1TSL A;  1DDU A;  3OB7 A;  2G86 A;  4EIL A;  1JG0 A;  5WRN A;  1J3I C;  1JMI A;  1NJD A;  3EBU A;  1TSD A;  1QQQ A;  1BJG A;  3B5B A;  1LCB A;  2TDM A;  1JTQ A;  2G8D A;  1AOB A;  1TVW A;  3GG5 A;  3KJS A;  3UM6 A;  3UM5 A;  1EV5 A;  1J3J C;  4GD7 A;  3DL6 A;  1TYS A;  1BQ1 A;  3KJR A;  3KGB A;  1J3K C;  3IRN A;  1BQ2 A;  3JSU A;  4FGT A;  1TJS A;  1B5D A;  1TLC A;  1THY A;  1B02 A;  3GH0 A;  3BZ0 A;  3UM8 A;  1CI7 A;  1F4C A;  5HS3 A;  3HB8 A;  2AAZ A;  1VZB A;  3IJZ A;  1HZW A;  3IK0 A;  4XSE A;  3GH2 X;  4ECK A;  3HBB A;  1TDC A;  4ISK A;  1VZC A;  2RDA A;  3ED7 A;  4XSD A;  4EB4 A;  1B49 A;  3BGX A;  1JU6 A;  3EHI X;  1F28 A;  1JUT A;  1KCE A;  3EF9 A;  4KYA A;  1NJE A;  4UP1 A;  1BDU A;  3BHL A;  1BSF A;  2RD8 A;  3CLB A;  4PSG A;  1TVU A;  4DPD A;  3INV A;  4XSC A;  4EZ8 A;  5H38 A;  1DNA A;  3UWL B;  1NJA A;  1TDU A;  1EV8 A;  1TDB A;  3I3R A;  3QJ7 A;  1SEJ A;  4GEV A;  1FFL A;  1BKO A;  2TDD A;  1BO8 A;  3N5E B;  1BSP A;  1EVF A;  3N5G A;  4O1X D;  1BP0 A;  1TSN A;  2VF0 A;  4LRR A;  1JUJ A;  2FTO X;  3DGA C;  1JMH A;  3EJL A;  1BKP A;  1SYN A;  2A9W A;  1NJB A;  4G6W X;  4ISW A;  5J7W A;  1LCE A;  4H1I A;  3EGY X;  1NJC A;  3K2H A;  4DQ1 A;  4KNZ A;  3IRM A;  4IRR A;  1F4B A;  3BNZ A;  1HVY A;  1JTU A;  1VZE A;  1TIS A;  4F2V A;  1I00 A;  2VET A;  5BY6 A;  3C06 A;  3EDW X;  4KY4 A;  1VZD A;  4H0R A;  4E5O A;  4FOG A;  1B5E A;  4H0U A;  1AXW A;  1HW4 A;  3IHI A;  1VZA A;  3DL5 A;  3IRO A;  3B9H A;  4FOA A;  4KPW A;  2BBQ A;  2OIP A;  1NCE A;  1TVV A;  2TSR A;  3BHR A;  1YPV A;  4DP3 A;  3IK1 A;  1TSX A;  1AN5 A;  2KCE A;  3C0A A;  4GYH A;  1AJM A;  1HW3 A;  3IX6 A;  4O1X A;  4Q0E A;  1RTS A;  1TLS A;  3HJ3 A;  4IQQ A;  2FTN A;  2RD8 B;  1AIQ A;  1F4F A;  4E28 A;  1F4G A;  3BYX A;  2FTQ A;  3NRR A;  3DG8 C;  1TSY A;  1BPJ A;  4O7U A;  1JMF A;  1ZPR A;  4TMS A;  5H39 A;  1JMG A;  5H3A A;  1F4E A;  2ONB A;  3QGT A;  2G89 A;  3TMS A;  1QZF A;  2G8X A;  1TSV A;  3BFI A;  1BP6 A;  4Q0D A;  3CL9 A;  1F4D A;  3QG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...