4IQQA

Crystal structure of c.elegans thymidylate synthase in complex with dump and tomudex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
289
structure length
289
Chain Sequence
QVHLNQDEYKYLKQVEQILREGTRRDDRTGTGTISIFGMQSKYCLRNGTIPLLTTKRVYWKGVLEELLWFISGSTDGKLLMEKNVKIWEKNGDRAFLDNLGFTSREEGDLGPVYGFQWRHFGAKYVDCHTDYSGQGVDQLAEVIRQIKEQPDSRRIIMSAWNPSDLGQMVLPPCHTMCQFYVDNGELSCQLYQRSGDMGLGVPFNLASYGLLTHMIAKVCGLKPGTLVHTLGDAHVYSNHVDALKIQLDREPYAFPKIRFTRDVASIDDFTSDMIALDDYKCHPKIPMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate synthase
publication title Crystal Structure of C.elegans Thymidylate Synthase in Complex with dUMP and Tomudex
rcsb
source organism Caenorhabditis elegans
total genus 86
structure length 289
sequence length 289
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2013-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4iqqA00
3K2HA 4E5OA 3B5BA 2VETA 3BHLA 3IJZA 1JMHA 4ECKA 1TSZA 3BYXA 1AXWA 3DL5A 3NRRA 4DQ1A 1HZWA 1SYNA 1JTUA 4FOAA 4XSEA 3BNZA 4IQQA 4O1XD 1TVWA 1DNAA 1HW4A 4JEFA 3BZ0A 1TJSA 2G8AA 3UM5A 1F4DA 4IQBA 1J3IC 3JSUA 1BDUA 4KY8A 1TSYA 4EILA 3DGAC 1B5EA 1TRGA 4FOGA 4LRRA 2TSCA 2RD8A 3IHIA 4E28A 1BIDA 4IRRA 1SEJA 2KCEA 1F4BA 4KY4A 1TSDA 1I00A 4DPDA 1JTQA 1NJAA 4FOXA 1J3JC 3IROA 4G2OX 1HVYA 4TMSA 3HBBA 1KCEA 1HW3A 4FGTA 1AN5A 1BKOA 3HB8A 3IRMA 3EBUA 3DG8C 1F28A 4XSDA 1F4FA 1CI7A 4H0UA 4H0RA 1JUTA 5J7WA 2G86A 4F2VA 1TSNA 1NCEA 1TSMA 3TMSA 3IK0A 1F4EA 1ZPRA 4ISKA 2A9WA 1BSPA 1FWMA 3INVA 1JG0A 1VZEA 1EV5A 2G8XA 2TDMA 3IX6A 1JUJA 3N5EA 4GYHA 1JMGA 4PSGA 5BY6A 3CL9A 1DDUA 3KJRA 1QQQA 4FQSA 1TLSA 3UWLA 1BJGA 3KGBA 4G6WX 5H38A 3EJLA 4EINA 1AOBA 1AJMA 1EVFA 4KPWA 1AIQA 2FTOX 1NJBA 3UM6A 1JMIA 1FFLA 1NJEA 4ISWA 3QJ7A 3GH2X 4GD7A 2RDAA 1J3KC 1BSFA 1B02A 3GG5A 3QGTA 3UM8A 4EB4A 3IK1A 2RD8B 1TDBA 3C06A 1RTSA 4O1UA 5HS3A 4O1XA 2G89A 3N5GA 3OB7A 2BBQA 1TDCA 4GEVA 3EF9A 4KYAA 4XSCA 2ONBA 4DPHA 1NJCA 1TYSA 3BGXA 2FTNA 3IRNA 1LCBA 5WRNA 1YPVA 3DL6A 1TDAA 3V8HA 1BQ1A 3BHRA 4EZ8A 5H39A 3ED7A 3CLBA 1QZFA 4Q0EA 3GH0A 1B5DA 3B9HA 3KJSA 3EAWX 1B49A 3N5EB 3EHIX 1VZCA 2OIPA 1VZAA 3I3RA 1TDUA 3UWLB 1BP0A 3EGYX 3H9KA 2H2QA 1BKPA 2TDDA 1TVUA 1LCEA 3BFIA 4DP3A 1BO7A 1TSXA 1THYA 1TSLA 1BP6A 1EVGA 2G8DA 1NJDA 4O7UA 1F4GA 1TSVA 4Q0DA 1BO8A 2FTQA 1VZDA 2TSRA 1JMFA 1KZIA 1BPJA 4KNZA 1VZBA 4H1IA 1F4CA 1BQ2A 3HJ3A 3QG2A 1JU6A 3EDWX 1TLCA 5H3AA 1TSWA 4UP1A 5FCTA 1LCAA 1KZJA 1TVVA 2AAZA 1TISA 1EV8A 2VF0A 3C0AA
chains in the Genus database with same CATH superfamily
3K2HA 4E5OA 3B5BA 2VETA 3BHLA 3IJZA 1JMHA 4ECKA 1TSZA 3BYXA 1AXWA 3DL5A 3NRRA 4DQ1A 1HZWA 1SYNA 1JTUA 4FOAA 4XSEA 3BNZA 4IQQA 4O1XD 1TVWA 1DNAA 1HW4A 4JEFA 3BZ0A 1TJSA 2G8AA 3UM5A 1F4DA 4IQBA 1J3IC 3JSUA 1BDUA 4KY8A 1TSYA 4EILA 3DGAC 1B5EA 1TRGA 4FOGA 4LRRA 2TSCA 2RD8A 3IHIA 4E28A 1BIDA 4IRRA 1SEJA 2KCEA 1F4BA 4KY4A 1TSDA 1I00A 4DPDA 1JTQA 1NJAA 4FOXA 1J3JC 3IROA 4G2OX 1HVYA 4TMSA 3HBBA 1KCEA 1HW3A 4FGTA 1AN5A 1BKOA 3HB8A 3IRMA 3EBUA 3DG8C 1F28A 4XSDA 1F4FA 1CI7A 4H0UA 4H0RA 1JUTA 5J7WA 2G86A 4F2VA 1TSNA 1NCEA 1TSMA 3TMSA 3IK0A 1F4EA 1ZPRA 4ISKA 2A9WA 1BSPA 1FWMA 3INVA 1JG0A 1VZEA 1EV5A 2G8XA 2TDMA 3IX6A 1JUJA 3N5EA 4GYHA 1JMGA 4PSGA 5BY6A 3CL9A 1DDUA 3KJRA 1QQQA 4FQSA 1TLSA 3UWLA 1BJGA 3KGBA 4G6WX 5H38A 3EJLA 4EINA 1AOBA 1AJMA 1EVFA 4KPWA 1AIQA 2FTOX 1NJBA 3UM6A 1JMIA 1FFLA 1NJEA 4ISWA 3QJ7A 3GH2X 4GD7A 2RDAA 1J3KC 1BSFA 1B02A 3GG5A 3QGTA 3UM8A 4EB4A 3IK1A 2RD8B 1TDBA 3C06A 1RTSA 4O1UA 5HS3A 4O1XA 2G89A 3N5GA 3OB7A 2BBQA 1TDCA 4GEVA 3EF9A 4KYAA 4XSCA 2ONBA 4DPHA 1NJCA 1TYSA 3BGXA 2FTNA 3IRNA 1LCBA 5WRNA 1YPVA 3DL6A 1TDAA 3V8HA 1BQ1A 3BHRA 4EZ8A 5H39A 3ED7A 3CLBA 1QZFA 4Q0EA 3GH0A 1B5DA 3B9HA 3KJSA 3EAWX 1B49A 3N5EB 3EHIX 1VZCA 2OIPA 1VZAA 3I3RA 1TDUA 3UWLB 1BP0A 3EGYX 3H9KA 2H2QA 1BKPA 2TDDA 1TVUA 1LCEA 3BFIA 4DP3A 1BO7A 1TSXA 1THYA 1TSLA 1BP6A 1EVGA 2G8DA 1NJDA 4O7UA 1F4GA 1TSVA 4Q0DA 1BO8A 2FTQA 1VZDA 2TSRA 1JMFA 1KZIA 1BPJA 4KNZA 1VZBA 4H1IA 1F4CA 1BQ2A 3HJ3A 3QG2A 1JU6A 3EDWX 1TLCA 5H3AA 1TSWA 4UP1A 5FCTA 1LCAA 1KZJA 1TVVA 2AAZA 1TISA 1EV8A 2VF0A 3C0AA
chains in the Genus database with same CATH topology
3K2HA 4E5OA 3B5BA 2VETA 3BHLA 3IJZA 1JMHA 4ECKA 1TSZA 3BYXA 1AXWA 3DL5A 3NRRA 4DQ1A 1HZWA 1SYNA 1JTUA 4FOAA 4XSEA 3BNZA 4IQQA 4O1XD 1TVWA 1DNAA 1HW4A 4JEFA 3BZ0A 1TJSA 2G8AA 3UM5A 1F4DA 4IQBA 1J3IC 3JSUA 1BDUA 4KY8A 1TSYA 4EILA 3DGAC 1B5EA 1TRGA 4FOGA 4LRRA 2TSCA 2RD8A 3IHIA 4E28A 1BIDA 4IRRA 1SEJA 2KCEA 1F4BA 4KY4A 1TSDA 1I00A 4DPDA 1JTQA 1NJAA 4FOXA 1J3JC 3IROA 4G2OX 1HVYA 4TMSA 3HBBA 1KCEA 1HW3A 4FGTA 1AN5A 1BKOA 3HB8A 3IRMA 3EBUA 3DG8C 1F28A 4XSDA 1F4FA 1CI7A 4H0UA 4H0RA 1JUTA 5J7WA 2G86A 4F2VA 1TSNA 1NCEA 1TSMA 3TMSA 3IK0A 1F4EA 1ZPRA 4ISKA 2A9WA 1BSPA 1FWMA 3INVA 1JG0A 1VZEA 1EV5A 2G8XA 2TDMA 3IX6A 1JUJA 3N5EA 4GYHA 1JMGA 4PSGA 5BY6A 3CL9A 1DDUA 3KJRA 1QQQA 4FQSA 1TLSA 3UWLA 1BJGA 3KGBA 4G6WX 5H38A 3EJLA 4EINA 1AOBA 1AJMA 1EVFA 4KPWA 1AIQA 2FTOX 1NJBA 3UM6A 1JMIA 1FFLA 1NJEA 4ISWA 3QJ7A 3GH2X 4GD7A 2RDAA 1J3KC 1BSFA 1B02A 3GG5A 3QGTA 3UM8A 4EB4A 3IK1A 2RD8B 1TDBA 3C06A 1RTSA 4O1UA 5HS3A 4O1XA 2G89A 3N5GA 3OB7A 2BBQA 1TDCA 4GEVA 3EF9A 4KYAA 4XSCA 2ONBA 4DPHA 1NJCA 1TYSA 3BGXA 2FTNA 3IRNA 1LCBA 5WRNA 1YPVA 3DL6A 1TDAA 3V8HA 1BQ1A 3BHRA 4EZ8A 5H39A 3ED7A 3CLBA 1QZFA 4Q0EA 3GH0A 1B5DA 3B9HA 3KJSA 3EAWX 1B49A 3N5EB 3EHIX 1VZCA 2OIPA 1VZAA 3I3RA 1TDUA 3UWLB 1BP0A 3EGYX 3H9KA 2H2QA 1BKPA 2TDDA 1TVUA 1LCEA 3BFIA 4DP3A 1BO7A 1TSXA 1THYA 1TSLA 1BP6A 1EVGA 2G8DA 1NJDA 4O7UA 1F4GA 1TSVA 4Q0DA 1BO8A 2FTQA 1VZDA 2TSRA 1JMFA 1KZIA 1BPJA 4KNZA 1VZBA 4H1IA 1F4CA 1BQ2A 3HJ3A 3QG2A 1JU6A 3EDWX 1TLCA 5H3AA 1TSWA 4UP1A 5FCTA 1LCAA 1KZJA 1TVVA 2AAZA 1TISA 1EV8A 2VF0A 3C0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K2H A;  4E5O A;  3B5B A;  2VET A;  3BHL A;  3IJZ A;  1JMH A;  4ECK A;  1TSZ A;  3BYX A;  1AXW A;  3DL5 A;  3NRR A;  4DQ1 A;  1HZW A;  1SYN A;  1JTU A;  4FOA A;  4XSE A;  3BNZ A;  4IQQ A;  4O1X D;  1TVW A;  1DNA A;  1HW4 A;  4JEF A;  3BZ0 A;  1TJS A;  2G8A A;  3UM5 A;  1F4D A;  4IQB A;  1J3I C;  3JSU A;  1BDU A;  4KY8 A;  1TSY A;  4EIL A;  3DGA C;  1B5E A;  1TRG A;  4FOG A;  4LRR A;  2TSC A;  2RD8 A;  3IHI A;  4E28 A;  1BID A;  4IRR A;  1SEJ A;  2KCE A;  1F4B A;  4KY4 A;  1TSD A;  1I00 A;  4DPD A;  1JTQ A;  1NJA A;  4FOX A;  1J3J C;  3IRO A;  4G2O X;  1HVY A;  4TMS A;  3HBB A;  1KCE A;  1HW3 A;  4FGT A;  1AN5 A;  1BKO A;  3HB8 A;  3IRM A;  3EBU A;  3DG8 C;  1F28 A;  4XSD A;  1F4F A;  1CI7 A;  4H0U A;  4H0R A;  1JUT A;  5J7W A;  2G86 A;  4F2V A;  1TSN A;  1NCE A;  1TSM A;  3TMS A;  3IK0 A;  1F4E A;  1ZPR A;  4ISK A;  2A9W A;  1BSP A;  1FWM A;  3INV A;  1JG0 A;  1VZE A;  1EV5 A;  2G8X A;  2TDM A;  3IX6 A;  1JUJ A;  3N5E A;  4GYH A;  1JMG A;  4PSG A;  5BY6 A;  3CL9 A;  1DDU A;  3KJR A;  1QQQ A;  4FQS A;  1TLS A;  3UWL A;  1BJG A;  3KGB A;  4G6W X;  5H38 A;  3EJL A;  4EIN A;  1AOB A;  1AJM A;  1EVF A;  4KPW A;  1AIQ A;  2FTO X;  1NJB A;  3UM6 A;  1JMI A;  1FFL A;  1NJE A;  4ISW A;  3QJ7 A;  3GH2 X;  4GD7 A;  2RDA A;  1J3K C;  1BSF A;  1B02 A;  3GG5 A;  3QGT A;  3UM8 A;  4EB4 A;  3IK1 A;  2RD8 B;  1TDB A;  3C06 A;  1RTS A;  4O1U A;  5HS3 A;  4O1X A;  2G89 A;  3N5G A;  3OB7 A;  2BBQ A;  1TDC A;  4GEV A;  3EF9 A;  4KYA A;  4XSC A;  2ONB A;  4DPH A;  1NJC A;  1TYS A;  3BGX A;  2FTN A;  3IRN A;  1LCB A;  5WRN A;  1YPV A;  3DL6 A;  1TDA A;  3V8H A;  1BQ1 A;  3BHR A;  4EZ8 A;  5H39 A;  3ED7 A;  3CLB A;  1QZF A;  4Q0E A;  3GH0 A;  1B5D A;  3B9H A;  3KJS A;  3EAW X;  1B49 A;  3N5E B;  3EHI X;  1VZC A;  2OIP A;  1VZA A;  3I3R A;  1TDU A;  3UWL B;  1BP0 A;  3EGY X;  3H9K A;  2H2Q A;  1BKP A;  2TDD A;  1TVU A;  1LCE A;  3BFI A;  4DP3 A;  1BO7 A;  1TSX A;  1THY A;  1TSL A;  1BP6 A;  1EVG A;  2G8D A;  1NJD A;  4O7U A;  1F4G A;  1TSV A;  4Q0D A;  1BO8 A;  2FTQ A;  1VZD A;  2TSR A;  1JMF A;  1KZI A;  1BPJ A;  4KNZ A;  1VZB A;  4H1I A;  1F4C A;  1BQ2 A;  3HJ3 A;  3QG2 A;  1JU6 A;  3EDW X;  1TLC A;  5H3A A;  1TSW A;  4UP1 A;  5FCT A;  1LCA A;  1KZJ A;  1TVV A;  2AAZ A;  1TIS A;  1EV8 A;  2VF0 A;  3C0A A; 
#chains in the Genus database with same CATH topology
 3K2H A;  4E5O A;  3B5B A;  2VET A;  3BHL A;  3IJZ A;  1JMH A;  4ECK A;  1TSZ A;  3BYX A;  1AXW A;  3DL5 A;  3NRR A;  4DQ1 A;  1HZW A;  1SYN A;  1JTU A;  4FOA A;  4XSE A;  3BNZ A;  4IQQ A;  4O1X D;  1TVW A;  1DNA A;  1HW4 A;  4JEF A;  3BZ0 A;  1TJS A;  2G8A A;  3UM5 A;  1F4D A;  4IQB A;  1J3I C;  3JSU A;  1BDU A;  4KY8 A;  1TSY A;  4EIL A;  3DGA C;  1B5E A;  1TRG A;  4FOG A;  4LRR A;  2TSC A;  2RD8 A;  3IHI A;  4E28 A;  1BID A;  4IRR A;  1SEJ A;  2KCE A;  1F4B A;  4KY4 A;  1TSD A;  1I00 A;  4DPD A;  1JTQ A;  1NJA A;  4FOX A;  1J3J C;  3IRO A;  4G2O X;  1HVY A;  4TMS A;  3HBB A;  1KCE A;  1HW3 A;  4FGT A;  1AN5 A;  1BKO A;  3HB8 A;  3IRM A;  3EBU A;  3DG8 C;  1F28 A;  4XSD A;  1F4F A;  1CI7 A;  4H0U A;  4H0R A;  1JUT A;  5J7W A;  2G86 A;  4F2V A;  1TSN A;  1NCE A;  1TSM A;  3TMS A;  3IK0 A;  1F4E A;  1ZPR A;  4ISK A;  2A9W A;  1BSP A;  1FWM A;  3INV A;  1JG0 A;  1VZE A;  1EV5 A;  2G8X A;  2TDM A;  3IX6 A;  1JUJ A;  3N5E A;  4GYH A;  1JMG A;  4PSG A;  5BY6 A;  3CL9 A;  1DDU A;  3KJR A;  1QQQ A;  4FQS A;  1TLS A;  3UWL A;  1BJG A;  3KGB A;  4G6W X;  5H38 A;  3EJL A;  4EIN A;  1AOB A;  1AJM A;  1EVF A;  4KPW A;  1AIQ A;  2FTO X;  1NJB A;  3UM6 A;  1JMI A;  1FFL A;  1NJE A;  4ISW A;  3QJ7 A;  3GH2 X;  4GD7 A;  2RDA A;  1J3K C;  1BSF A;  1B02 A;  3GG5 A;  3QGT A;  3UM8 A;  4EB4 A;  3IK1 A;  2RD8 B;  1TDB A;  3C06 A;  1RTS A;  4O1U A;  5HS3 A;  4O1X A;  2G89 A;  3N5G A;  3OB7 A;  2BBQ A;  1TDC A;  4GEV A;  3EF9 A;  4KYA A;  4XSC A;  2ONB A;  4DPH A;  1NJC A;  1TYS A;  3BGX A;  2FTN A;  3IRN A;  1LCB A;  5WRN A;  1YPV A;  3DL6 A;  1TDA A;  3V8H A;  1BQ1 A;  3BHR A;  4EZ8 A;  5H39 A;  3ED7 A;  3CLB A;  1QZF A;  4Q0E A;  3GH0 A;  1B5D A;  3B9H A;  3KJS A;  3EAW X;  1B49 A;  3N5E B;  3EHI X;  1VZC A;  2OIP A;  1VZA A;  3I3R A;  1TDU A;  3UWL B;  1BP0 A;  3EGY X;  3H9K A;  2H2Q A;  1BKP A;  2TDD A;  1TVU A;  1LCE A;  3BFI A;  4DP3 A;  1BO7 A;  1TSX A;  1THY A;  1TSL A;  1BP6 A;  1EVG A;  2G8D A;  1NJD A;  4O7U A;  1F4G A;  1TSV A;  4Q0D A;  1BO8 A;  2FTQ A;  1VZD A;  2TSR A;  1JMF A;  1KZI A;  1BPJ A;  4KNZ A;  1VZB A;  4H1I A;  1F4C A;  1BQ2 A;  3HJ3 A;  3QG2 A;  1JU6 A;  3EDW X;  1TLC A;  5H3A A;  1TSW A;  4UP1 A;  5FCT A;  1LCA A;  1KZJ A;  1TVV A;  2AAZ A;  1TIS A;  1EV8 A;  2VF0 A;  3C0A A; 
#chains in the Genus database with same CATH homology
 3K2H A;  4E5O A;  3B5B A;  2VET A;  3BHL A;  3IJZ A;  1JMH A;  4ECK A;  1TSZ A;  3BYX A;  1AXW A;  3DL5 A;  3NRR A;  4DQ1 A;  1HZW A;  1SYN A;  1JTU A;  4FOA A;  4XSE A;  3BNZ A;  4IQQ A;  4O1X D;  1TVW A;  1DNA A;  1HW4 A;  4JEF A;  3BZ0 A;  1TJS A;  2G8A A;  3UM5 A;  1F4D A;  4IQB A;  1J3I C;  3JSU A;  1BDU A;  4KY8 A;  1TSY A;  4EIL A;  3DGA C;  1B5E A;  1TRG A;  4FOG A;  4LRR A;  2TSC A;  2RD8 A;  3IHI A;  4E28 A;  1BID A;  4IRR A;  1SEJ A;  2KCE A;  1F4B A;  4KY4 A;  1TSD A;  1I00 A;  4DPD A;  1JTQ A;  1NJA A;  4FOX A;  1J3J C;  3IRO A;  4G2O X;  1HVY A;  4TMS A;  3HBB A;  1KCE A;  1HW3 A;  4FGT A;  1AN5 A;  1BKO A;  3HB8 A;  3IRM A;  3EBU A;  3DG8 C;  1F28 A;  4XSD A;  1F4F A;  1CI7 A;  4H0U A;  4H0R A;  1JUT A;  5J7W A;  2G86 A;  4F2V A;  1TSN A;  1NCE A;  1TSM A;  3TMS A;  3IK0 A;  1F4E A;  1ZPR A;  4ISK A;  2A9W A;  1BSP A;  1FWM A;  3INV A;  1JG0 A;  1VZE A;  1EV5 A;  2G8X A;  2TDM A;  3IX6 A;  1JUJ A;  3N5E A;  4GYH A;  1JMG A;  4PSG A;  5BY6 A;  3CL9 A;  1DDU A;  3KJR A;  1QQQ A;  4FQS A;  1TLS A;  3UWL A;  1BJG A;  3KGB A;  4G6W X;  5H38 A;  3EJL A;  4EIN A;  1AOB A;  1AJM A;  1EVF A;  4KPW A;  1AIQ A;  2FTO X;  1NJB A;  3UM6 A;  1JMI A;  1FFL A;  1NJE A;  4ISW A;  3QJ7 A;  3GH2 X;  4GD7 A;  2RDA A;  1J3K C;  1BSF A;  1B02 A;  3GG5 A;  3QGT A;  3UM8 A;  4EB4 A;  3IK1 A;  2RD8 B;  1TDB A;  3C06 A;  1RTS A;  4O1U A;  5HS3 A;  4O1X A;  2G89 A;  3N5G A;  3OB7 A;  2BBQ A;  1TDC A;  4GEV A;  3EF9 A;  4KYA A;  4XSC A;  2ONB A;  4DPH A;  1NJC A;  1TYS A;  3BGX A;  2FTN A;  3IRN A;  1LCB A;  5WRN A;  1YPV A;  3DL6 A;  1TDA A;  3V8H A;  1BQ1 A;  3BHR A;  4EZ8 A;  5H39 A;  3ED7 A;  3CLB A;  1QZF A;  4Q0E A;  3GH0 A;  1B5D A;  3B9H A;  3KJS A;  3EAW X;  1B49 A;  3N5E B;  3EHI X;  1VZC A;  2OIP A;  1VZA A;  3I3R A;  1TDU A;  3UWL B;  1BP0 A;  3EGY X;  3H9K A;  2H2Q A;  1BKP A;  2TDD A;  1TVU A;  1LCE A;  3BFI A;  4DP3 A;  1BO7 A;  1TSX A;  1THY A;  1TSL A;  1BP6 A;  1EVG A;  2G8D A;  1NJD A;  4O7U A;  1F4G A;  1TSV A;  4Q0D A;  1BO8 A;  2FTQ A;  1VZD A;  2TSR A;  1JMF A;  1KZI A;  1BPJ A;  4KNZ A;  1VZB A;  4H1I A;  1F4C A;  1BQ2 A;  3HJ3 A;  3QG2 A;  1JU6 A;  3EDW X;  1TLC A;  5H3A A;  1TSW A;  4UP1 A;  5FCT A;  1LCA A;  1KZJ A;  1TVV A;  2AAZ A;  1TIS A;  1EV8 A;  2VF0 A;  3C0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...