4IRRA

Crystal structure of c.elegans thymidylate synthase in complex with dump
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
290
structure length
290
Chain Sequence
QQVHLNQDEYKYLKQVEQILREGTRRDDRTGTGTISIFGMQSKYCLRNGTIPLLTTKRVYWKGVLEELLWFISGSTDGKLLMEKNVKIWEKNGDRAFLDNLGFTSREEGDLGPVYGFQWRHFGAKYVDCHTDYSGQGVDQLAEVIRQIKEQPDSRRIIMSAWNPSDLGQMVLPPCHTMCQFYVDNGELSCQLYQRSGDMGLGVPFNLASYGLLTHMIAKVCGLKPGTLVHTLGDAHVYSNHVDALKIQLDREPYAFPKIRFTRDVASIDDFTSDMIALDDYKCHPKIPMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase
publication title Crystal Structure of C.elegans Thymidylate Synthase in Complex with dUMP
rcsb
source organism Caenorhabditis elegans
total genus 96
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4irrA00
1JUTA 3DG8C 3EDWX 4KY4A 3H9KA 2TDMA 5BY6A 2KCEA 1B5EA 2VF0A 1B49A 4E5OA 4EILA 3BHLA 2TDDA 4F2VA 4GEVA 2OIPA 1TLSA 1HZWA 1VZCA 2A9WA 1VZAA 1TSWA 3GH0A 3UM5A 3IHIA 3BFIA 1BQ2A 3BYXA 3HB8A 4H0RA 1DNAA 1TSNA 1FFLA 3DL6A 1FWMA 4FGTA 1KZIA 1DDUA 1NJDA 4GD7A 5WRNA 4JEFA 4FOGA 1F28A 1KZJA 4H1IA 1LCBA 1TSZA 1EVFA 1HVYA 2ONBA 2RD8B 1VZDA 2G8DA 3B5BA 1F4BA 3IROA 4G2OX 1J3JC 3QG2A 1TVVA 1BKPA 2G8XA 4XSCA 3GG5A 3N5EB 1BKOA 1JMHA 3EGYX 4IQBA 1BSPA 5H39A 3UM8A 1TSLA 5HS3A 2G89A 1JMGA 1HW3A 4IRRA 3OB7A 1BP0A 1TJSA 2H2QA 1YPVA 1NCEA 1LCAA 4H0UA 3K2HA 4O1UA 4O1XD 1SYNA 1EV5A 1NJAA 3UM6A 5H3AA 1TDAA 3C0AA 3KGBA 4KYAA 3UWLB 4ECKA 4ISWA 4KPWA 3INVA 1TSDA 1TVWA 1TDCA 2FTOX 4FOXA 4XSEA 2G8AA 3IRNA 4LRRA 1TISA 1F4GA 1BSFA 1JUJA 1JMIA 3NRRA 3BNZA 3HBBA 1HW4A 4O1XA 4DPDA 3ED7A 1TDBA 2TSCA 4O7UA 1BIDA 1TSMA 1QZFA 1AOBA 1NJBA 1F4CA 1THYA 1TYSA 3KJSA 1JMFA 2FTNA 1JTQA 3DGAC 1ZPRA 1SEJA 5J7WA 1NJEA 1JG0A 3EF9A 1TSVA 1TVUA 5FCTA 4EZ8A 1AXWA 3CL9A 3IK0A 4EB4A 4Q0EA 4KY8A 1J3IC 3HJ3A 4Q0DA 1I00A 1VZBA 4ISKA 3IRMA 4E28A 3V8HA 3JSUA 1EVGA 1BP6A 2FTQA 1AIQA 1BO8A 2RD8A 1EV8A 1AJMA 3TMSA 3C06A 4FQSA 3CLBA 1F4FA 1JU6A 2VETA 1KCEA 4DPHA 1LCEA 3N5GA 4GYHA 3IJZA 2AAZA 3N5EA 5H38A 2BBQA 1JTUA 2RDAA 1TDUA 3EBUA 3QJ7A 4DP3A 1TLCA 1J3KC 1TSYA 1BO7A 1AN5A 4IQQA 1BPJA 1QQQA 3I3RA 3QGTA 1B5DA 1B02A 3EAWX 4PSGA 1CI7A 4DQ1A 3BZ0A 4KNZA 3KJRA 4TMSA 3EJLA 4XSDA 4EINA 3BHRA 1TSXA 3GH2X 1BJGA 1TRGA 3B9HA 1RTSA 3BGXA 1BQ1A 1F4DA 1VZEA 3UWLA 3IX6A 3IK1A 4FOAA 4UP1A 1F4EA 2TSRA 2G86A 3EHIX 3DL5A 1BDUA 1NJCA 4G6WX
chains in the Genus database with same CATH superfamily
1JUTA 3DG8C 3EDWX 4KY4A 3H9KA 2TDMA 5BY6A 2KCEA 1B5EA 2VF0A 1B49A 4E5OA 4EILA 3BHLA 2TDDA 4F2VA 4GEVA 2OIPA 1TLSA 1HZWA 1VZCA 2A9WA 1VZAA 1TSWA 3GH0A 3UM5A 3IHIA 3BFIA 1BQ2A 3BYXA 3HB8A 4H0RA 1DNAA 1TSNA 1FFLA 3DL6A 1FWMA 4FGTA 1KZIA 1DDUA 1NJDA 4GD7A 5WRNA 4JEFA 4FOGA 1F28A 1KZJA 4H1IA 1LCBA 1TSZA 1EVFA 1HVYA 2ONBA 2RD8B 1VZDA 2G8DA 3B5BA 1F4BA 3IROA 4G2OX 1J3JC 3QG2A 1TVVA 1BKPA 2G8XA 4XSCA 3GG5A 3N5EB 1BKOA 1JMHA 3EGYX 4IQBA 1BSPA 5H39A 3UM8A 1TSLA 5HS3A 2G89A 1JMGA 1HW3A 4IRRA 3OB7A 1BP0A 1TJSA 2H2QA 1YPVA 1NCEA 1LCAA 4H0UA 3K2HA 4O1UA 4O1XD 1SYNA 1EV5A 1NJAA 3UM6A 5H3AA 1TDAA 3C0AA 3KGBA 4KYAA 3UWLB 4ECKA 4ISWA 4KPWA 3INVA 1TSDA 1TVWA 1TDCA 2FTOX 4FOXA 4XSEA 2G8AA 3IRNA 4LRRA 1TISA 1F4GA 1BSFA 1JUJA 1JMIA 3NRRA 3BNZA 3HBBA 1HW4A 4O1XA 4DPDA 3ED7A 1TDBA 2TSCA 4O7UA 1BIDA 1TSMA 1QZFA 1AOBA 1NJBA 1F4CA 1THYA 1TYSA 3KJSA 1JMFA 2FTNA 1JTQA 3DGAC 1ZPRA 1SEJA 5J7WA 1NJEA 1JG0A 3EF9A 1TSVA 1TVUA 5FCTA 4EZ8A 1AXWA 3CL9A 3IK0A 4EB4A 4Q0EA 4KY8A 1J3IC 3HJ3A 4Q0DA 1I00A 1VZBA 4ISKA 3IRMA 4E28A 3V8HA 3JSUA 1EVGA 1BP6A 2FTQA 1AIQA 1BO8A 2RD8A 1EV8A 1AJMA 3TMSA 3C06A 4FQSA 3CLBA 1F4FA 1JU6A 2VETA 1KCEA 4DPHA 1LCEA 3N5GA 4GYHA 3IJZA 2AAZA 3N5EA 5H38A 2BBQA 1JTUA 2RDAA 1TDUA 3EBUA 3QJ7A 4DP3A 1TLCA 1J3KC 1TSYA 1BO7A 1AN5A 4IQQA 1BPJA 1QQQA 3I3RA 3QGTA 1B5DA 1B02A 3EAWX 4PSGA 1CI7A 4DQ1A 3BZ0A 4KNZA 3KJRA 4TMSA 3EJLA 4XSDA 4EINA 3BHRA 1TSXA 3GH2X 1BJGA 1TRGA 3B9HA 1RTSA 3BGXA 1BQ1A 1F4DA 1VZEA 3UWLA 3IX6A 3IK1A 4FOAA 4UP1A 1F4EA 2TSRA 2G86A 3EHIX 3DL5A 1BDUA 1NJCA 4G6WX
chains in the Genus database with same CATH topology
1JUTA 3DG8C 3EDWX 4KY4A 3H9KA 2TDMA 5BY6A 2KCEA 1B5EA 2VF0A 1B49A 4E5OA 4EILA 3BHLA 2TDDA 4F2VA 4GEVA 2OIPA 1TLSA 1HZWA 1VZCA 2A9WA 1VZAA 1TSWA 3GH0A 3UM5A 3IHIA 3BFIA 1BQ2A 3BYXA 3HB8A 4H0RA 1DNAA 1TSNA 1FFLA 3DL6A 1FWMA 4FGTA 1KZIA 1DDUA 1NJDA 4GD7A 5WRNA 4JEFA 4FOGA 1F28A 1KZJA 4H1IA 1LCBA 1TSZA 1EVFA 1HVYA 2ONBA 2RD8B 1VZDA 2G8DA 3B5BA 1F4BA 3IROA 4G2OX 1J3JC 3QG2A 1TVVA 1BKPA 2G8XA 4XSCA 3GG5A 3N5EB 1BKOA 1JMHA 3EGYX 4IQBA 1BSPA 5H39A 3UM8A 1TSLA 5HS3A 2G89A 1JMGA 1HW3A 4IRRA 3OB7A 1BP0A 1TJSA 2H2QA 1YPVA 1NCEA 1LCAA 4H0UA 3K2HA 4O1UA 4O1XD 1SYNA 1EV5A 1NJAA 3UM6A 5H3AA 1TDAA 3C0AA 3KGBA 4KYAA 3UWLB 4ECKA 4ISWA 4KPWA 3INVA 1TSDA 1TVWA 1TDCA 2FTOX 4FOXA 4XSEA 2G8AA 3IRNA 4LRRA 1TISA 1F4GA 1BSFA 1JUJA 1JMIA 3NRRA 3BNZA 3HBBA 1HW4A 4O1XA 4DPDA 3ED7A 1TDBA 2TSCA 4O7UA 1BIDA 1TSMA 1QZFA 1AOBA 1NJBA 1F4CA 1THYA 1TYSA 3KJSA 1JMFA 2FTNA 1JTQA 3DGAC 1ZPRA 1SEJA 5J7WA 1NJEA 1JG0A 3EF9A 1TSVA 1TVUA 5FCTA 4EZ8A 1AXWA 3CL9A 3IK0A 4EB4A 4Q0EA 4KY8A 1J3IC 3HJ3A 4Q0DA 1I00A 1VZBA 4ISKA 3IRMA 4E28A 3V8HA 3JSUA 1EVGA 1BP6A 2FTQA 1AIQA 1BO8A 2RD8A 1EV8A 1AJMA 3TMSA 3C06A 4FQSA 3CLBA 1F4FA 1JU6A 2VETA 1KCEA 4DPHA 1LCEA 3N5GA 4GYHA 3IJZA 2AAZA 3N5EA 5H38A 2BBQA 1JTUA 2RDAA 1TDUA 3EBUA 3QJ7A 4DP3A 1TLCA 1J3KC 1TSYA 1BO7A 1AN5A 4IQQA 1BPJA 1QQQA 3I3RA 3QGTA 1B5DA 1B02A 3EAWX 4PSGA 1CI7A 4DQ1A 3BZ0A 4KNZA 3KJRA 4TMSA 3EJLA 4XSDA 4EINA 3BHRA 1TSXA 3GH2X 1BJGA 1TRGA 3B9HA 1RTSA 3BGXA 1BQ1A 1F4DA 1VZEA 3UWLA 3IX6A 3IK1A 4FOAA 4UP1A 1F4EA 2TSRA 2G86A 3EHIX 3DL5A 1BDUA 1NJCA 4G6WX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JUT A;  3DG8 C;  3EDW X;  4KY4 A;  3H9K A;  2TDM A;  5BY6 A;  2KCE A;  1B5E A;  2VF0 A;  1B49 A;  4E5O A;  4EIL A;  3BHL A;  2TDD A;  4F2V A;  4GEV A;  2OIP A;  1TLS A;  1HZW A;  1VZC A;  2A9W A;  1VZA A;  1TSW A;  3GH0 A;  3UM5 A;  3IHI A;  3BFI A;  1BQ2 A;  3BYX A;  3HB8 A;  4H0R A;  1DNA A;  1TSN A;  1FFL A;  3DL6 A;  1FWM A;  4FGT A;  1KZI A;  1DDU A;  1NJD A;  4GD7 A;  5WRN A;  4JEF A;  4FOG A;  1F28 A;  1KZJ A;  4H1I A;  1LCB A;  1TSZ A;  1EVF A;  1HVY A;  2ONB A;  2RD8 B;  1VZD A;  2G8D A;  3B5B A;  1F4B A;  3IRO A;  4G2O X;  1J3J C;  3QG2 A;  1TVV A;  1BKP A;  2G8X A;  4XSC A;  3GG5 A;  3N5E B;  1BKO A;  1JMH A;  3EGY X;  4IQB A;  1BSP A;  5H39 A;  3UM8 A;  1TSL A;  5HS3 A;  2G89 A;  1JMG A;  1HW3 A;  4IRR A;  3OB7 A;  1BP0 A;  1TJS A;  2H2Q A;  1YPV A;  1NCE A;  1LCA A;  4H0U A;  3K2H A;  4O1U A;  4O1X D;  1SYN A;  1EV5 A;  1NJA A;  3UM6 A;  5H3A A;  1TDA A;  3C0A A;  3KGB A;  4KYA A;  3UWL B;  4ECK A;  4ISW A;  4KPW A;  3INV A;  1TSD A;  1TVW A;  1TDC A;  2FTO X;  4FOX A;  4XSE A;  2G8A A;  3IRN A;  4LRR A;  1TIS A;  1F4G A;  1BSF A;  1JUJ A;  1JMI A;  3NRR A;  3BNZ A;  3HBB A;  1HW4 A;  4O1X A;  4DPD A;  3ED7 A;  1TDB A;  2TSC A;  4O7U A;  1BID A;  1TSM A;  1QZF A;  1AOB A;  1NJB A;  1F4C A;  1THY A;  1TYS A;  3KJS A;  1JMF A;  2FTN A;  1JTQ A;  3DGA C;  1ZPR A;  1SEJ A;  5J7W A;  1NJE A;  1JG0 A;  3EF9 A;  1TSV A;  1TVU A;  5FCT A;  4EZ8 A;  1AXW A;  3CL9 A;  3IK0 A;  4EB4 A;  4Q0E A;  4KY8 A;  1J3I C;  3HJ3 A;  4Q0D A;  1I00 A;  1VZB A;  4ISK A;  3IRM A;  4E28 A;  3V8H A;  3JSU A;  1EVG A;  1BP6 A;  2FTQ A;  1AIQ A;  1BO8 A;  2RD8 A;  1EV8 A;  1AJM A;  3TMS A;  3C06 A;  4FQS A;  3CLB A;  1F4F A;  1JU6 A;  2VET A;  1KCE A;  4DPH A;  1LCE A;  3N5G A;  4GYH A;  3IJZ A;  2AAZ A;  3N5E A;  5H38 A;  2BBQ A;  1JTU A;  2RDA A;  1TDU A;  3EBU A;  3QJ7 A;  4DP3 A;  1TLC A;  1J3K C;  1TSY A;  1BO7 A;  1AN5 A;  4IQQ A;  1BPJ A;  1QQQ A;  3I3R A;  3QGT A;  1B5D A;  1B02 A;  3EAW X;  4PSG A;  1CI7 A;  4DQ1 A;  3BZ0 A;  4KNZ A;  3KJR A;  4TMS A;  3EJL A;  4XSD A;  4EIN A;  3BHR A;  1TSX A;  3GH2 X;  1BJG A;  1TRG A;  3B9H A;  1RTS A;  3BGX A;  1BQ1 A;  1F4D A;  1VZE A;  3UWL A;  3IX6 A;  3IK1 A;  4FOA A;  4UP1 A;  1F4E A;  2TSR A;  2G86 A;  3EHI X;  3DL5 A;  1BDU A;  1NJC A;  4G6W X; 
#chains in the Genus database with same CATH topology
 1JUT A;  3DG8 C;  3EDW X;  4KY4 A;  3H9K A;  2TDM A;  5BY6 A;  2KCE A;  1B5E A;  2VF0 A;  1B49 A;  4E5O A;  4EIL A;  3BHL A;  2TDD A;  4F2V A;  4GEV A;  2OIP A;  1TLS A;  1HZW A;  1VZC A;  2A9W A;  1VZA A;  1TSW A;  3GH0 A;  3UM5 A;  3IHI A;  3BFI A;  1BQ2 A;  3BYX A;  3HB8 A;  4H0R A;  1DNA A;  1TSN A;  1FFL A;  3DL6 A;  1FWM A;  4FGT A;  1KZI A;  1DDU A;  1NJD A;  4GD7 A;  5WRN A;  4JEF A;  4FOG A;  1F28 A;  1KZJ A;  4H1I A;  1LCB A;  1TSZ A;  1EVF A;  1HVY A;  2ONB A;  2RD8 B;  1VZD A;  2G8D A;  3B5B A;  1F4B A;  3IRO A;  4G2O X;  1J3J C;  3QG2 A;  1TVV A;  1BKP A;  2G8X A;  4XSC A;  3GG5 A;  3N5E B;  1BKO A;  1JMH A;  3EGY X;  4IQB A;  1BSP A;  5H39 A;  3UM8 A;  1TSL A;  5HS3 A;  2G89 A;  1JMG A;  1HW3 A;  4IRR A;  3OB7 A;  1BP0 A;  1TJS A;  2H2Q A;  1YPV A;  1NCE A;  1LCA A;  4H0U A;  3K2H A;  4O1U A;  4O1X D;  1SYN A;  1EV5 A;  1NJA A;  3UM6 A;  5H3A A;  1TDA A;  3C0A A;  3KGB A;  4KYA A;  3UWL B;  4ECK A;  4ISW A;  4KPW A;  3INV A;  1TSD A;  1TVW A;  1TDC A;  2FTO X;  4FOX A;  4XSE A;  2G8A A;  3IRN A;  4LRR A;  1TIS A;  1F4G A;  1BSF A;  1JUJ A;  1JMI A;  3NRR A;  3BNZ A;  3HBB A;  1HW4 A;  4O1X A;  4DPD A;  3ED7 A;  1TDB A;  2TSC A;  4O7U A;  1BID A;  1TSM A;  1QZF A;  1AOB A;  1NJB A;  1F4C A;  1THY A;  1TYS A;  3KJS A;  1JMF A;  2FTN A;  1JTQ A;  3DGA C;  1ZPR A;  1SEJ A;  5J7W A;  1NJE A;  1JG0 A;  3EF9 A;  1TSV A;  1TVU A;  5FCT A;  4EZ8 A;  1AXW A;  3CL9 A;  3IK0 A;  4EB4 A;  4Q0E A;  4KY8 A;  1J3I C;  3HJ3 A;  4Q0D A;  1I00 A;  1VZB A;  4ISK A;  3IRM A;  4E28 A;  3V8H A;  3JSU A;  1EVG A;  1BP6 A;  2FTQ A;  1AIQ A;  1BO8 A;  2RD8 A;  1EV8 A;  1AJM A;  3TMS A;  3C06 A;  4FQS A;  3CLB A;  1F4F A;  1JU6 A;  2VET A;  1KCE A;  4DPH A;  1LCE A;  3N5G A;  4GYH A;  3IJZ A;  2AAZ A;  3N5E A;  5H38 A;  2BBQ A;  1JTU A;  2RDA A;  1TDU A;  3EBU A;  3QJ7 A;  4DP3 A;  1TLC A;  1J3K C;  1TSY A;  1BO7 A;  1AN5 A;  4IQQ A;  1BPJ A;  1QQQ A;  3I3R A;  3QGT A;  1B5D A;  1B02 A;  3EAW X;  4PSG A;  1CI7 A;  4DQ1 A;  3BZ0 A;  4KNZ A;  3KJR A;  4TMS A;  3EJL A;  4XSD A;  4EIN A;  3BHR A;  1TSX A;  3GH2 X;  1BJG A;  1TRG A;  3B9H A;  1RTS A;  3BGX A;  1BQ1 A;  1F4D A;  1VZE A;  3UWL A;  3IX6 A;  3IK1 A;  4FOA A;  4UP1 A;  1F4E A;  2TSR A;  2G86 A;  3EHI X;  3DL5 A;  1BDU A;  1NJC A;  4G6W X; 
#chains in the Genus database with same CATH homology
 1JUT A;  3DG8 C;  3EDW X;  4KY4 A;  3H9K A;  2TDM A;  5BY6 A;  2KCE A;  1B5E A;  2VF0 A;  1B49 A;  4E5O A;  4EIL A;  3BHL A;  2TDD A;  4F2V A;  4GEV A;  2OIP A;  1TLS A;  1HZW A;  1VZC A;  2A9W A;  1VZA A;  1TSW A;  3GH0 A;  3UM5 A;  3IHI A;  3BFI A;  1BQ2 A;  3BYX A;  3HB8 A;  4H0R A;  1DNA A;  1TSN A;  1FFL A;  3DL6 A;  1FWM A;  4FGT A;  1KZI A;  1DDU A;  1NJD A;  4GD7 A;  5WRN A;  4JEF A;  4FOG A;  1F28 A;  1KZJ A;  4H1I A;  1LCB A;  1TSZ A;  1EVF A;  1HVY A;  2ONB A;  2RD8 B;  1VZD A;  2G8D A;  3B5B A;  1F4B A;  3IRO A;  4G2O X;  1J3J C;  3QG2 A;  1TVV A;  1BKP A;  2G8X A;  4XSC A;  3GG5 A;  3N5E B;  1BKO A;  1JMH A;  3EGY X;  4IQB A;  1BSP A;  5H39 A;  3UM8 A;  1TSL A;  5HS3 A;  2G89 A;  1JMG A;  1HW3 A;  4IRR A;  3OB7 A;  1BP0 A;  1TJS A;  2H2Q A;  1YPV A;  1NCE A;  1LCA A;  4H0U A;  3K2H A;  4O1U A;  4O1X D;  1SYN A;  1EV5 A;  1NJA A;  3UM6 A;  5H3A A;  1TDA A;  3C0A A;  3KGB A;  4KYA A;  3UWL B;  4ECK A;  4ISW A;  4KPW A;  3INV A;  1TSD A;  1TVW A;  1TDC A;  2FTO X;  4FOX A;  4XSE A;  2G8A A;  3IRN A;  4LRR A;  1TIS A;  1F4G A;  1BSF A;  1JUJ A;  1JMI A;  3NRR A;  3BNZ A;  3HBB A;  1HW4 A;  4O1X A;  4DPD A;  3ED7 A;  1TDB A;  2TSC A;  4O7U A;  1BID A;  1TSM A;  1QZF A;  1AOB A;  1NJB A;  1F4C A;  1THY A;  1TYS A;  3KJS A;  1JMF A;  2FTN A;  1JTQ A;  3DGA C;  1ZPR A;  1SEJ A;  5J7W A;  1NJE A;  1JG0 A;  3EF9 A;  1TSV A;  1TVU A;  5FCT A;  4EZ8 A;  1AXW A;  3CL9 A;  3IK0 A;  4EB4 A;  4Q0E A;  4KY8 A;  1J3I C;  3HJ3 A;  4Q0D A;  1I00 A;  1VZB A;  4ISK A;  3IRM A;  4E28 A;  3V8H A;  3JSU A;  1EVG A;  1BP6 A;  2FTQ A;  1AIQ A;  1BO8 A;  2RD8 A;  1EV8 A;  1AJM A;  3TMS A;  3C06 A;  4FQS A;  3CLB A;  1F4F A;  1JU6 A;  2VET A;  1KCE A;  4DPH A;  1LCE A;  3N5G A;  4GYH A;  3IJZ A;  2AAZ A;  3N5E A;  5H38 A;  2BBQ A;  1JTU A;  2RDA A;  1TDU A;  3EBU A;  3QJ7 A;  4DP3 A;  1TLC A;  1J3K C;  1TSY A;  1BO7 A;  1AN5 A;  4IQQ A;  1BPJ A;  1QQQ A;  3I3R A;  3QGT A;  1B5D A;  1B02 A;  3EAW X;  4PSG A;  1CI7 A;  4DQ1 A;  3BZ0 A;  4KNZ A;  3KJR A;  4TMS A;  3EJL A;  4XSD A;  4EIN A;  3BHR A;  1TSX A;  3GH2 X;  1BJG A;  1TRG A;  3B9H A;  1RTS A;  3BGX A;  1BQ1 A;  1F4D A;  1VZE A;  3UWL A;  3IX6 A;  3IK1 A;  4FOA A;  4UP1 A;  1F4E A;  2TSR A;  2G86 A;  3EHI X;  3DL5 A;  1BDU A;  1NJC A;  4G6W X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...