4ISKA

Crystal structure of e.coli thymidylate synthase with dump and the bgc 945 inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
263
structure length
263
Chain Sequence
KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate synthase
publication title Development and Binding Mode Assessment of N-[4-[2-Propyn-1-yl[(6S)-4,6,7,8-tetrahydro-2-(hydroxymethyl)-4-oxo-3H-cyclopenta[g]quinazolin-6-yl]amino]benzoyl]-l-gamma-glutamyl-d-glutamic Acid (BGC 945), a Novel Thymidylate Synthase Inhibitor That Targets Tumor Cells.
pubmed doi rcsb
source organism Escherichia coli
total genus 80
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4iskA00
3KGBA 3K2HA 1F4DA 1DDUA 1TDCA 2FTNA 4G2OX 1J3JC 4O1XD 1NJCA 1TSZA 1NJAA 4FGTA 4EZ8A 1JMIA 1B5EA 2TDDA 3IK0A 2AAZA 2G8XA 3N5GA 4TMSA 1BKOA 1TSXA 4E5OA 2FTOX 3IJZA 1TSVA 1TLCA 4FOAA 1JU6A 1TISA 1BKPA 1JMGA 1HW4A 2G8AA 3UWLA 1JMFA 2H2QA 3BHLA 4IRRA 1AJMA 3KJSA 3DGAC 3QG2A 1TDAA 4GD7A 5H39A 1HZWA 3BYXA 4XSDA 3DL6A 3V8HA 1AN5A 1KZJA 1TSWA 2ONBA 4FQSA 1FWMA 2A9WA 4JEFA 1BPJA 3BGXA 1BJGA 1I00A 2RD8B 3UM8A 1EVGA 4O1UA 4KYAA 5J7WA 1VZDA 3UWLB 3HBBA 1BQ1A 1VZCA 1JUTA 1SYNA 3BFIA 4KPWA 1JUJA 4F2VA 1NJEA 4O1XA 1J3KC 1TSDA 1BDUA 3HB8A 3DG8C 2TSCA 3ED7A 3INVA 4UP1A 4EB4A 4IQQA 3OB7A 1QQQA 1B5DA 2RD8A 3CL9A 2G89A 4G6WX 3NRRA 1SEJA 1JG0A 1JTQA 1TLSA 4H0UA 3EF9A 3DL5A 2G8DA 4ISKA 1J3IC 1TYSA 4FOGA 1TSMA 3TMSA 1TRGA 3C0AA 4ISWA 4DQ1A 4EILA 1F4GA 1BO7A 2RDAA 3QGTA 3N5EB 1EVFA 1YPVA 3BZ0A 3EJLA 4FOXA 4KNZA 2VETA 1F4CA 5HS3A 4H0RA 3UM6A 3IRNA 3QJ7A 3EGYX 1B02A 5FCTA 1TSYA 3GG5A 5H3AA 4EINA 1NJBA 1F4BA 3CLBA 2TDMA 3N5EA 3JSUA 1LCEA 4GEVA 4KY4A 1BIDA 1BSPA 1TJSA 3EDWX 3KJRA 3EAWX 1EV8A 4GYHA 4Q0DA 1B49A 1BQ2A 2G86A 1F28A 3GH0A 5WRNA 1AIQA 2BBQA 1LCAA 1HW3A 4IQBA 4DPHA 3BHRA 1NCEA 1ZPRA 4PSGA 3UM5A 1AOBA 1JTUA 1EV5A 3B5BA 3GH2X 4H1IA 1KCEA 4LRRA 1DNAA 1THYA 1TVWA 1VZEA 1TVVA 1VZAA 3H9KA 1F4FA 1NJDA 1VZBA 4O7UA 3IHIA 3IK1A 1FFLA 1JMHA 4ECKA 3HJ3A 4DP3A 1HVYA 3IRMA 5H38A 2KCEA 1BP6A 2FTQA 1TDUA 1TSLA 4XSEA 3EHIX 1KZIA 1TDBA 1QZFA 2VF0A 4Q0EA 4E28A 1BSFA 3IX6A 3B9HA 3C06A 5BY6A 1AXWA 1RTSA 4DPDA 1TVUA 4KY8A 1CI7A 3EBUA 1LCBA 3IROA 1BO8A 4XSCA 3BNZA 1BP0A 1F4EA 2TSRA 1TSNA 2OIPA 3I3RA
chains in the Genus database with same CATH superfamily
3KGBA 3K2HA 1F4DA 1DDUA 1TDCA 2FTNA 4G2OX 1J3JC 4O1XD 1NJCA 1TSZA 1NJAA 4FGTA 4EZ8A 1JMIA 1B5EA 2TDDA 3IK0A 2AAZA 2G8XA 3N5GA 4TMSA 1BKOA 1TSXA 4E5OA 2FTOX 3IJZA 1TSVA 1TLCA 4FOAA 1JU6A 1TISA 1BKPA 1JMGA 1HW4A 2G8AA 3UWLA 1JMFA 2H2QA 3BHLA 4IRRA 1AJMA 3KJSA 3DGAC 3QG2A 1TDAA 4GD7A 5H39A 1HZWA 3BYXA 4XSDA 3DL6A 3V8HA 1AN5A 1KZJA 1TSWA 2ONBA 4FQSA 1FWMA 2A9WA 4JEFA 1BPJA 3BGXA 1BJGA 1I00A 2RD8B 3UM8A 1EVGA 4O1UA 4KYAA 5J7WA 1VZDA 3UWLB 3HBBA 1BQ1A 1VZCA 1JUTA 1SYNA 3BFIA 4KPWA 1JUJA 4F2VA 1NJEA 4O1XA 1J3KC 1TSDA 1BDUA 3HB8A 3DG8C 2TSCA 3ED7A 3INVA 4UP1A 4EB4A 4IQQA 3OB7A 1QQQA 1B5DA 2RD8A 3CL9A 2G89A 4G6WX 3NRRA 1SEJA 1JG0A 1JTQA 1TLSA 4H0UA 3EF9A 3DL5A 2G8DA 4ISKA 1J3IC 1TYSA 4FOGA 1TSMA 3TMSA 1TRGA 3C0AA 4ISWA 4DQ1A 4EILA 1F4GA 1BO7A 2RDAA 3QGTA 3N5EB 1EVFA 1YPVA 3BZ0A 3EJLA 4FOXA 4KNZA 2VETA 1F4CA 5HS3A 4H0RA 3UM6A 3IRNA 3QJ7A 3EGYX 1B02A 5FCTA 1TSYA 3GG5A 5H3AA 4EINA 1NJBA 1F4BA 3CLBA 2TDMA 3N5EA 3JSUA 1LCEA 4GEVA 4KY4A 1BIDA 1BSPA 1TJSA 3EDWX 3KJRA 3EAWX 1EV8A 4GYHA 4Q0DA 1B49A 1BQ2A 2G86A 1F28A 3GH0A 5WRNA 1AIQA 2BBQA 1LCAA 1HW3A 4IQBA 4DPHA 3BHRA 1NCEA 1ZPRA 4PSGA 3UM5A 1AOBA 1JTUA 1EV5A 3B5BA 3GH2X 4H1IA 1KCEA 4LRRA 1DNAA 1THYA 1TVWA 1VZEA 1TVVA 1VZAA 3H9KA 1F4FA 1NJDA 1VZBA 4O7UA 3IHIA 3IK1A 1FFLA 1JMHA 4ECKA 3HJ3A 4DP3A 1HVYA 3IRMA 5H38A 2KCEA 1BP6A 2FTQA 1TDUA 1TSLA 4XSEA 3EHIX 1KZIA 1TDBA 1QZFA 2VF0A 4Q0EA 4E28A 1BSFA 3IX6A 3B9HA 3C06A 5BY6A 1AXWA 1RTSA 4DPDA 1TVUA 4KY8A 1CI7A 3EBUA 1LCBA 3IROA 1BO8A 4XSCA 3BNZA 1BP0A 1F4EA 2TSRA 1TSNA 2OIPA 3I3RA
chains in the Genus database with same CATH topology
3KGBA 3K2HA 1F4DA 1DDUA 1TDCA 2FTNA 4G2OX 1J3JC 4O1XD 1NJCA 1TSZA 1NJAA 4FGTA 4EZ8A 1JMIA 1B5EA 2TDDA 3IK0A 2AAZA 2G8XA 3N5GA 4TMSA 1BKOA 1TSXA 4E5OA 2FTOX 3IJZA 1TSVA 1TLCA 4FOAA 1JU6A 1TISA 1BKPA 1JMGA 1HW4A 2G8AA 3UWLA 1JMFA 2H2QA 3BHLA 4IRRA 1AJMA 3KJSA 3DGAC 3QG2A 1TDAA 4GD7A 5H39A 1HZWA 3BYXA 4XSDA 3DL6A 3V8HA 1AN5A 1KZJA 1TSWA 2ONBA 4FQSA 1FWMA 2A9WA 4JEFA 1BPJA 3BGXA 1BJGA 1I00A 2RD8B 3UM8A 1EVGA 4O1UA 4KYAA 5J7WA 1VZDA 3UWLB 3HBBA 1BQ1A 1VZCA 1JUTA 1SYNA 3BFIA 4KPWA 1JUJA 4F2VA 1NJEA 4O1XA 1J3KC 1TSDA 1BDUA 3HB8A 3DG8C 2TSCA 3ED7A 3INVA 4UP1A 4EB4A 4IQQA 3OB7A 1QQQA 1B5DA 2RD8A 3CL9A 2G89A 4G6WX 3NRRA 1SEJA 1JG0A 1JTQA 1TLSA 4H0UA 3EF9A 3DL5A 2G8DA 4ISKA 1J3IC 1TYSA 4FOGA 1TSMA 3TMSA 1TRGA 3C0AA 4ISWA 4DQ1A 4EILA 1F4GA 1BO7A 2RDAA 3QGTA 3N5EB 1EVFA 1YPVA 3BZ0A 3EJLA 4FOXA 4KNZA 2VETA 1F4CA 5HS3A 4H0RA 3UM6A 3IRNA 3QJ7A 3EGYX 1B02A 5FCTA 1TSYA 3GG5A 5H3AA 4EINA 1NJBA 1F4BA 3CLBA 2TDMA 3N5EA 3JSUA 1LCEA 4GEVA 4KY4A 1BIDA 1BSPA 1TJSA 3EDWX 3KJRA 3EAWX 1EV8A 4GYHA 4Q0DA 1B49A 1BQ2A 2G86A 1F28A 3GH0A 5WRNA 1AIQA 2BBQA 1LCAA 1HW3A 4IQBA 4DPHA 3BHRA 1NCEA 1ZPRA 4PSGA 3UM5A 1AOBA 1JTUA 1EV5A 3B5BA 3GH2X 4H1IA 1KCEA 4LRRA 1DNAA 1THYA 1TVWA 1VZEA 1TVVA 1VZAA 3H9KA 1F4FA 1NJDA 1VZBA 4O7UA 3IHIA 3IK1A 1FFLA 1JMHA 4ECKA 3HJ3A 4DP3A 1HVYA 3IRMA 5H38A 2KCEA 1BP6A 2FTQA 1TDUA 1TSLA 4XSEA 3EHIX 1KZIA 1TDBA 1QZFA 2VF0A 4Q0EA 4E28A 1BSFA 3IX6A 3B9HA 3C06A 5BY6A 1AXWA 1RTSA 4DPDA 1TVUA 4KY8A 1CI7A 3EBUA 1LCBA 3IROA 1BO8A 4XSCA 3BNZA 1BP0A 1F4EA 2TSRA 1TSNA 2OIPA 3I3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KGB A;  3K2H A;  1F4D A;  1DDU A;  1TDC A;  2FTN A;  4G2O X;  1J3J C;  4O1X D;  1NJC A;  1TSZ A;  1NJA A;  4FGT A;  4EZ8 A;  1JMI A;  1B5E A;  2TDD A;  3IK0 A;  2AAZ A;  2G8X A;  3N5G A;  4TMS A;  1BKO A;  1TSX A;  4E5O A;  2FTO X;  3IJZ A;  1TSV A;  1TLC A;  4FOA A;  1JU6 A;  1TIS A;  1BKP A;  1JMG A;  1HW4 A;  2G8A A;  3UWL A;  1JMF A;  2H2Q A;  3BHL A;  4IRR A;  1AJM A;  3KJS A;  3DGA C;  3QG2 A;  1TDA A;  4GD7 A;  5H39 A;  1HZW A;  3BYX A;  4XSD A;  3DL6 A;  3V8H A;  1AN5 A;  1KZJ A;  1TSW A;  2ONB A;  4FQS A;  1FWM A;  2A9W A;  4JEF A;  1BPJ A;  3BGX A;  1BJG A;  1I00 A;  2RD8 B;  3UM8 A;  1EVG A;  4O1U A;  4KYA A;  5J7W A;  1VZD A;  3UWL B;  3HBB A;  1BQ1 A;  1VZC A;  1JUT A;  1SYN A;  3BFI A;  4KPW A;  1JUJ A;  4F2V A;  1NJE A;  4O1X A;  1J3K C;  1TSD A;  1BDU A;  3HB8 A;  3DG8 C;  2TSC A;  3ED7 A;  3INV A;  4UP1 A;  4EB4 A;  4IQQ A;  3OB7 A;  1QQQ A;  1B5D A;  2RD8 A;  3CL9 A;  2G89 A;  4G6W X;  3NRR A;  1SEJ A;  1JG0 A;  1JTQ A;  1TLS A;  4H0U A;  3EF9 A;  3DL5 A;  2G8D A;  4ISK A;  1J3I C;  1TYS A;  4FOG A;  1TSM A;  3TMS A;  1TRG A;  3C0A A;  4ISW A;  4DQ1 A;  4EIL A;  1F4G A;  1BO7 A;  2RDA A;  3QGT A;  3N5E B;  1EVF A;  1YPV A;  3BZ0 A;  3EJL A;  4FOX A;  4KNZ A;  2VET A;  1F4C A;  5HS3 A;  4H0R A;  3UM6 A;  3IRN A;  3QJ7 A;  3EGY X;  1B02 A;  5FCT A;  1TSY A;  3GG5 A;  5H3A A;  4EIN A;  1NJB A;  1F4B A;  3CLB A;  2TDM A;  3N5E A;  3JSU A;  1LCE A;  4GEV A;  4KY4 A;  1BID A;  1BSP A;  1TJS A;  3EDW X;  3KJR A;  3EAW X;  1EV8 A;  4GYH A;  4Q0D A;  1B49 A;  1BQ2 A;  2G86 A;  1F28 A;  3GH0 A;  5WRN A;  1AIQ A;  2BBQ A;  1LCA A;  1HW3 A;  4IQB A;  4DPH A;  3BHR A;  1NCE A;  1ZPR A;  4PSG A;  3UM5 A;  1AOB A;  1JTU A;  1EV5 A;  3B5B A;  3GH2 X;  4H1I A;  1KCE A;  4LRR A;  1DNA A;  1THY A;  1TVW A;  1VZE A;  1TVV A;  1VZA A;  3H9K A;  1F4F A;  1NJD A;  1VZB A;  4O7U A;  3IHI A;  3IK1 A;  1FFL A;  1JMH A;  4ECK A;  3HJ3 A;  4DP3 A;  1HVY A;  3IRM A;  5H38 A;  2KCE A;  1BP6 A;  2FTQ A;  1TDU A;  1TSL A;  4XSE A;  3EHI X;  1KZI A;  1TDB A;  1QZF A;  2VF0 A;  4Q0E A;  4E28 A;  1BSF A;  3IX6 A;  3B9H A;  3C06 A;  5BY6 A;  1AXW A;  1RTS A;  4DPD A;  1TVU A;  4KY8 A;  1CI7 A;  3EBU A;  1LCB A;  3IRO A;  1BO8 A;  4XSC A;  3BNZ A;  1BP0 A;  1F4E A;  2TSR A;  1TSN A;  2OIP A;  3I3R A; 
#chains in the Genus database with same CATH topology
 3KGB A;  3K2H A;  1F4D A;  1DDU A;  1TDC A;  2FTN A;  4G2O X;  1J3J C;  4O1X D;  1NJC A;  1TSZ A;  1NJA A;  4FGT A;  4EZ8 A;  1JMI A;  1B5E A;  2TDD A;  3IK0 A;  2AAZ A;  2G8X A;  3N5G A;  4TMS A;  1BKO A;  1TSX A;  4E5O A;  2FTO X;  3IJZ A;  1TSV A;  1TLC A;  4FOA A;  1JU6 A;  1TIS A;  1BKP A;  1JMG A;  1HW4 A;  2G8A A;  3UWL A;  1JMF A;  2H2Q A;  3BHL A;  4IRR A;  1AJM A;  3KJS A;  3DGA C;  3QG2 A;  1TDA A;  4GD7 A;  5H39 A;  1HZW A;  3BYX A;  4XSD A;  3DL6 A;  3V8H A;  1AN5 A;  1KZJ A;  1TSW A;  2ONB A;  4FQS A;  1FWM A;  2A9W A;  4JEF A;  1BPJ A;  3BGX A;  1BJG A;  1I00 A;  2RD8 B;  3UM8 A;  1EVG A;  4O1U A;  4KYA A;  5J7W A;  1VZD A;  3UWL B;  3HBB A;  1BQ1 A;  1VZC A;  1JUT A;  1SYN A;  3BFI A;  4KPW A;  1JUJ A;  4F2V A;  1NJE A;  4O1X A;  1J3K C;  1TSD A;  1BDU A;  3HB8 A;  3DG8 C;  2TSC A;  3ED7 A;  3INV A;  4UP1 A;  4EB4 A;  4IQQ A;  3OB7 A;  1QQQ A;  1B5D A;  2RD8 A;  3CL9 A;  2G89 A;  4G6W X;  3NRR A;  1SEJ A;  1JG0 A;  1JTQ A;  1TLS A;  4H0U A;  3EF9 A;  3DL5 A;  2G8D A;  4ISK A;  1J3I C;  1TYS A;  4FOG A;  1TSM A;  3TMS A;  1TRG A;  3C0A A;  4ISW A;  4DQ1 A;  4EIL A;  1F4G A;  1BO7 A;  2RDA A;  3QGT A;  3N5E B;  1EVF A;  1YPV A;  3BZ0 A;  3EJL A;  4FOX A;  4KNZ A;  2VET A;  1F4C A;  5HS3 A;  4H0R A;  3UM6 A;  3IRN A;  3QJ7 A;  3EGY X;  1B02 A;  5FCT A;  1TSY A;  3GG5 A;  5H3A A;  4EIN A;  1NJB A;  1F4B A;  3CLB A;  2TDM A;  3N5E A;  3JSU A;  1LCE A;  4GEV A;  4KY4 A;  1BID A;  1BSP A;  1TJS A;  3EDW X;  3KJR A;  3EAW X;  1EV8 A;  4GYH A;  4Q0D A;  1B49 A;  1BQ2 A;  2G86 A;  1F28 A;  3GH0 A;  5WRN A;  1AIQ A;  2BBQ A;  1LCA A;  1HW3 A;  4IQB A;  4DPH A;  3BHR A;  1NCE A;  1ZPR A;  4PSG A;  3UM5 A;  1AOB A;  1JTU A;  1EV5 A;  3B5B A;  3GH2 X;  4H1I A;  1KCE A;  4LRR A;  1DNA A;  1THY A;  1TVW A;  1VZE A;  1TVV A;  1VZA A;  3H9K A;  1F4F A;  1NJD A;  1VZB A;  4O7U A;  3IHI A;  3IK1 A;  1FFL A;  1JMH A;  4ECK A;  3HJ3 A;  4DP3 A;  1HVY A;  3IRM A;  5H38 A;  2KCE A;  1BP6 A;  2FTQ A;  1TDU A;  1TSL A;  4XSE A;  3EHI X;  1KZI A;  1TDB A;  1QZF A;  2VF0 A;  4Q0E A;  4E28 A;  1BSF A;  3IX6 A;  3B9H A;  3C06 A;  5BY6 A;  1AXW A;  1RTS A;  4DPD A;  1TVU A;  4KY8 A;  1CI7 A;  3EBU A;  1LCB A;  3IRO A;  1BO8 A;  4XSC A;  3BNZ A;  1BP0 A;  1F4E A;  2TSR A;  1TSN A;  2OIP A;  3I3R A; 
#chains in the Genus database with same CATH homology
 3KGB A;  3K2H A;  1F4D A;  1DDU A;  1TDC A;  2FTN A;  4G2O X;  1J3J C;  4O1X D;  1NJC A;  1TSZ A;  1NJA A;  4FGT A;  4EZ8 A;  1JMI A;  1B5E A;  2TDD A;  3IK0 A;  2AAZ A;  2G8X A;  3N5G A;  4TMS A;  1BKO A;  1TSX A;  4E5O A;  2FTO X;  3IJZ A;  1TSV A;  1TLC A;  4FOA A;  1JU6 A;  1TIS A;  1BKP A;  1JMG A;  1HW4 A;  2G8A A;  3UWL A;  1JMF A;  2H2Q A;  3BHL A;  4IRR A;  1AJM A;  3KJS A;  3DGA C;  3QG2 A;  1TDA A;  4GD7 A;  5H39 A;  1HZW A;  3BYX A;  4XSD A;  3DL6 A;  3V8H A;  1AN5 A;  1KZJ A;  1TSW A;  2ONB A;  4FQS A;  1FWM A;  2A9W A;  4JEF A;  1BPJ A;  3BGX A;  1BJG A;  1I00 A;  2RD8 B;  3UM8 A;  1EVG A;  4O1U A;  4KYA A;  5J7W A;  1VZD A;  3UWL B;  3HBB A;  1BQ1 A;  1VZC A;  1JUT A;  1SYN A;  3BFI A;  4KPW A;  1JUJ A;  4F2V A;  1NJE A;  4O1X A;  1J3K C;  1TSD A;  1BDU A;  3HB8 A;  3DG8 C;  2TSC A;  3ED7 A;  3INV A;  4UP1 A;  4EB4 A;  4IQQ A;  3OB7 A;  1QQQ A;  1B5D A;  2RD8 A;  3CL9 A;  2G89 A;  4G6W X;  3NRR A;  1SEJ A;  1JG0 A;  1JTQ A;  1TLS A;  4H0U A;  3EF9 A;  3DL5 A;  2G8D A;  4ISK A;  1J3I C;  1TYS A;  4FOG A;  1TSM A;  3TMS A;  1TRG A;  3C0A A;  4ISW A;  4DQ1 A;  4EIL A;  1F4G A;  1BO7 A;  2RDA A;  3QGT A;  3N5E B;  1EVF A;  1YPV A;  3BZ0 A;  3EJL A;  4FOX A;  4KNZ A;  2VET A;  1F4C A;  5HS3 A;  4H0R A;  3UM6 A;  3IRN A;  3QJ7 A;  3EGY X;  1B02 A;  5FCT A;  1TSY A;  3GG5 A;  5H3A A;  4EIN A;  1NJB A;  1F4B A;  3CLB A;  2TDM A;  3N5E A;  3JSU A;  1LCE A;  4GEV A;  4KY4 A;  1BID A;  1BSP A;  1TJS A;  3EDW X;  3KJR A;  3EAW X;  1EV8 A;  4GYH A;  4Q0D A;  1B49 A;  1BQ2 A;  2G86 A;  1F28 A;  3GH0 A;  5WRN A;  1AIQ A;  2BBQ A;  1LCA A;  1HW3 A;  4IQB A;  4DPH A;  3BHR A;  1NCE A;  1ZPR A;  4PSG A;  3UM5 A;  1AOB A;  1JTU A;  1EV5 A;  3B5B A;  3GH2 X;  4H1I A;  1KCE A;  4LRR A;  1DNA A;  1THY A;  1TVW A;  1VZE A;  1TVV A;  1VZA A;  3H9K A;  1F4F A;  1NJD A;  1VZB A;  4O7U A;  3IHI A;  3IK1 A;  1FFL A;  1JMH A;  4ECK A;  3HJ3 A;  4DP3 A;  1HVY A;  3IRM A;  5H38 A;  2KCE A;  1BP6 A;  2FTQ A;  1TDU A;  1TSL A;  4XSE A;  3EHI X;  1KZI A;  1TDB A;  1QZF A;  2VF0 A;  4Q0E A;  4E28 A;  1BSF A;  3IX6 A;  3B9H A;  3C06 A;  5BY6 A;  1AXW A;  1RTS A;  4DPD A;  1TVU A;  4KY8 A;  1CI7 A;  3EBU A;  1LCB A;  3IRO A;  1BO8 A;  4XSC A;  3BNZ A;  1BP0 A;  1F4E A;  2TSR A;  1TSN A;  2OIP A;  3I3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...