4ISWA

Crystal structure of phosphorylated c.elegans thymidylate synthase in complex with dump
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
290
structure length
289
Chain Sequence
QQVHLNQDEYKYLKQVEQILREGTRRDDRTGTGTISIFGMQSKYCLRNGTIPLLTTKRVYWKGVLEELLWFISGSTDGKLLMEKNVKIWEKNGDRAFLDNLGFTREEGDLGPVYGFQWRHFGAKYVDCHTDYSGQGVDQLAEVIRQIKEQPDSRRIIMSAWNPSDLGQMVLPPCHTMCQFYVDNGELSCQLYQRSGDMGLGVPFNLASYGLLTHMIAKVCGLKPGTLVHTLGDAHVYSNHVDALKIQLDREPYAFPKIRFTRDVASIDDFTSDMIALDDYKCHPKIPMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase
publication title Crystal structure of phosphoramide-phosphorylated thymidylate synthase reveals pSer127, reflecting probably pHis to pSer phosphotransfer.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 89
structure length 289
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4iswA00
1BKPA 1TDUA 2VF0A 3KGBA 4FOAA 2G8XA 3BHLA 1KZJA 1BIDA 1TLCA 4EINA 1BP6A 4IRRA 1AIQA 1AJMA 3N5EA 3EGYX 1LCBA 3V8HA 4F2VA 1NJAA 1QZFA 3H9KA 4FOXA 3ED7A 5FCTA 2G8AA 4G6WX 4O7UA 1RTSA 1J3IC 1TRGA 4KY4A 1EV8A 2AAZA 3N5GA 4UP1A 3GH0A 5J7WA 3JSUA 3CLBA 3B5BA 3QGTA 1VZAA 1BP0A 1LCAA 4E5OA 1NCEA 3IK1A 1B49A 4O1UA 3HB8A 4FOGA 3IX6A 4DP3A 2KCEA 4XSCA 3UM5A 1VZDA 4H0RA 2A9WA 3QG2A 1SEJA 1EVGA 4IQQA 1VZEA 3IHIA 3UWLA 4JEFA 4LRRA 3EF9A 5H39A 1KCEA 1JTQA 3I3RA 4DQ1A 5HS3A 2TDMA 1BQ2A 4Q0DA 3N5EB 1TSLA 3C06A 3BNZA 3IJZA 1BO7A 1B5DA 3IRNA 1LCEA 1TSWA 4ECKA 1TDBA 2OIPA 3BGXA 4GD7A 4KYAA 1TDCA 1BDUA 4E28A 3DGAC 4DPHA 3BYXA 1EV5A 4O1XD 1VZCA 3BZ0A 1HZWA 2FTOX 3UM8A 3IRMA 1NJBA 2RD8A 4G2OX 1F4GA 1YPVA 1AN5A 2G89A 1B02A 1JUTA 2H2QA 2FTQA 2TSRA 4XSDA 4FQSA 1BJGA 3KJSA 1HVYA 3UWLB 4FGTA 4KY8A 1THYA 1TLSA 3EAWX 1TSDA 4PSGA 1BO8A 2G8DA 1HW3A 3IROA 3QJ7A 1NJEA 4ISKA 1I00A 1F4FA 1TVUA 2TDDA 1ZPRA 1TISA 3NRRA 1NJDA 1TSMA 1TDAA 1JUJA 1TVVA 1BQ1A 3EDWX 4DPDA 3DL5A 3C0AA 1B5EA 2VETA 4Q0EA 1F4CA 1JMHA 1AOBA 3IK0A 3BFIA 3K2HA 4H1IA 1JU6A 4GYHA 4IQBA 1DNAA 5H3AA 4GEVA 1SYNA 1F4BA 1JMIA 4ISWA 3GH2X 4XSEA 1TSVA 5BY6A 1QQQA 1BSPA 1HW4A 4KPWA 3UM6A 1J3KC 2FTNA 2RD8B 5WRNA 3BHRA 3OB7A 1JMFA 1JMGA 1FWMA 2TSCA 3HBBA 1TSNA 4O1XA 3TMSA 3CL9A 1DDUA 1JG0A 3EJLA 3EHIX 3INVA 1TYSA 3HJ3A 2G86A 1KZIA 1TVWA 1BSFA 4EB4A 4EILA 1JTUA 1NJCA 1BKOA 1TSYA 4H0UA 4TMSA 5H38A 4EZ8A 4KNZA 3DL6A 1BPJA 1TSXA 3EBUA 1TSZA 1EVFA 2BBQA 1CI7A 1F4DA 1TJSA 1FFLA 3GG5A 1J3JC 3DG8C 1VZBA 1F28A 1AXWA 2RDAA 3B9HA 1F4EA 2ONBA 3KJRA
chains in the Genus database with same CATH superfamily
1BKPA 1TDUA 2VF0A 3KGBA 4FOAA 2G8XA 3BHLA 1KZJA 1BIDA 1TLCA 4EINA 1BP6A 4IRRA 1AIQA 1AJMA 3N5EA 3EGYX 1LCBA 3V8HA 4F2VA 1NJAA 1QZFA 3H9KA 4FOXA 3ED7A 5FCTA 2G8AA 4G6WX 4O7UA 1RTSA 1J3IC 1TRGA 4KY4A 1EV8A 2AAZA 3N5GA 4UP1A 3GH0A 5J7WA 3JSUA 3CLBA 3B5BA 3QGTA 1VZAA 1BP0A 1LCAA 4E5OA 1NCEA 3IK1A 1B49A 4O1UA 3HB8A 4FOGA 3IX6A 4DP3A 2KCEA 4XSCA 3UM5A 1VZDA 4H0RA 2A9WA 3QG2A 1SEJA 1EVGA 4IQQA 1VZEA 3IHIA 3UWLA 4JEFA 4LRRA 3EF9A 5H39A 1KCEA 1JTQA 3I3RA 4DQ1A 5HS3A 2TDMA 1BQ2A 4Q0DA 3N5EB 1TSLA 3C06A 3BNZA 3IJZA 1BO7A 1B5DA 3IRNA 1LCEA 1TSWA 4ECKA 1TDBA 2OIPA 3BGXA 4GD7A 4KYAA 1TDCA 1BDUA 4E28A 3DGAC 4DPHA 3BYXA 1EV5A 4O1XD 1VZCA 3BZ0A 1HZWA 2FTOX 3UM8A 3IRMA 1NJBA 2RD8A 4G2OX 1F4GA 1YPVA 1AN5A 2G89A 1B02A 1JUTA 2H2QA 2FTQA 2TSRA 4XSDA 4FQSA 1BJGA 3KJSA 1HVYA 3UWLB 4FGTA 4KY8A 1THYA 1TLSA 3EAWX 1TSDA 4PSGA 1BO8A 2G8DA 1HW3A 3IROA 3QJ7A 1NJEA 4ISKA 1I00A 1F4FA 1TVUA 2TDDA 1ZPRA 1TISA 3NRRA 1NJDA 1TSMA 1TDAA 1JUJA 1TVVA 1BQ1A 3EDWX 4DPDA 3DL5A 3C0AA 1B5EA 2VETA 4Q0EA 1F4CA 1JMHA 1AOBA 3IK0A 3BFIA 3K2HA 4H1IA 1JU6A 4GYHA 4IQBA 1DNAA 5H3AA 4GEVA 1SYNA 1F4BA 1JMIA 4ISWA 3GH2X 4XSEA 1TSVA 5BY6A 1QQQA 1BSPA 1HW4A 4KPWA 3UM6A 1J3KC 2FTNA 2RD8B 5WRNA 3BHRA 3OB7A 1JMFA 1JMGA 1FWMA 2TSCA 3HBBA 1TSNA 4O1XA 3TMSA 3CL9A 1DDUA 1JG0A 3EJLA 3EHIX 3INVA 1TYSA 3HJ3A 2G86A 1KZIA 1TVWA 1BSFA 4EB4A 4EILA 1JTUA 1NJCA 1BKOA 1TSYA 4H0UA 4TMSA 5H38A 4EZ8A 4KNZA 3DL6A 1BPJA 1TSXA 3EBUA 1TSZA 1EVFA 2BBQA 1CI7A 1F4DA 1TJSA 1FFLA 3GG5A 1J3JC 3DG8C 1VZBA 1F28A 1AXWA 2RDAA 3B9HA 1F4EA 2ONBA 3KJRA
chains in the Genus database with same CATH topology
1BKPA 1TDUA 2VF0A 3KGBA 4FOAA 2G8XA 3BHLA 1KZJA 1BIDA 1TLCA 4EINA 1BP6A 4IRRA 1AIQA 1AJMA 3N5EA 3EGYX 1LCBA 3V8HA 4F2VA 1NJAA 1QZFA 3H9KA 4FOXA 3ED7A 5FCTA 2G8AA 4G6WX 4O7UA 1RTSA 1J3IC 1TRGA 4KY4A 1EV8A 2AAZA 3N5GA 4UP1A 3GH0A 5J7WA 3JSUA 3CLBA 3B5BA 3QGTA 1VZAA 1BP0A 1LCAA 4E5OA 1NCEA 3IK1A 1B49A 4O1UA 3HB8A 4FOGA 3IX6A 4DP3A 2KCEA 4XSCA 3UM5A 1VZDA 4H0RA 2A9WA 3QG2A 1SEJA 1EVGA 4IQQA 1VZEA 3IHIA 3UWLA 4JEFA 4LRRA 3EF9A 5H39A 1KCEA 1JTQA 3I3RA 4DQ1A 5HS3A 2TDMA 1BQ2A 4Q0DA 3N5EB 1TSLA 3C06A 3BNZA 3IJZA 1BO7A 1B5DA 3IRNA 1LCEA 1TSWA 4ECKA 1TDBA 2OIPA 3BGXA 4GD7A 4KYAA 1TDCA 1BDUA 4E28A 3DGAC 4DPHA 3BYXA 1EV5A 4O1XD 1VZCA 3BZ0A 1HZWA 2FTOX 3UM8A 3IRMA 1NJBA 2RD8A 4G2OX 1F4GA 1YPVA 1AN5A 2G89A 1B02A 1JUTA 2H2QA 2FTQA 2TSRA 4XSDA 4FQSA 1BJGA 3KJSA 1HVYA 3UWLB 4FGTA 4KY8A 1THYA 1TLSA 3EAWX 1TSDA 4PSGA 1BO8A 2G8DA 1HW3A 3IROA 3QJ7A 1NJEA 4ISKA 1I00A 1F4FA 1TVUA 2TDDA 1ZPRA 1TISA 3NRRA 1NJDA 1TSMA 1TDAA 1JUJA 1TVVA 1BQ1A 3EDWX 4DPDA 3DL5A 3C0AA 1B5EA 2VETA 4Q0EA 1F4CA 1JMHA 1AOBA 3IK0A 3BFIA 3K2HA 4H1IA 1JU6A 4GYHA 4IQBA 1DNAA 5H3AA 4GEVA 1SYNA 1F4BA 1JMIA 4ISWA 3GH2X 4XSEA 1TSVA 5BY6A 1QQQA 1BSPA 1HW4A 4KPWA 3UM6A 1J3KC 2FTNA 2RD8B 5WRNA 3BHRA 3OB7A 1JMFA 1JMGA 1FWMA 2TSCA 3HBBA 1TSNA 4O1XA 3TMSA 3CL9A 1DDUA 1JG0A 3EJLA 3EHIX 3INVA 1TYSA 3HJ3A 2G86A 1KZIA 1TVWA 1BSFA 4EB4A 4EILA 1JTUA 1NJCA 1BKOA 1TSYA 4H0UA 4TMSA 5H38A 4EZ8A 4KNZA 3DL6A 1BPJA 1TSXA 3EBUA 1TSZA 1EVFA 2BBQA 1CI7A 1F4DA 1TJSA 1FFLA 3GG5A 1J3JC 3DG8C 1VZBA 1F28A 1AXWA 2RDAA 3B9HA 1F4EA 2ONBA 3KJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BKP A;  1TDU A;  2VF0 A;  3KGB A;  4FOA A;  2G8X A;  3BHL A;  1KZJ A;  1BID A;  1TLC A;  4EIN A;  1BP6 A;  4IRR A;  1AIQ A;  1AJM A;  3N5E A;  3EGY X;  1LCB A;  3V8H A;  4F2V A;  1NJA A;  1QZF A;  3H9K A;  4FOX A;  3ED7 A;  5FCT A;  2G8A A;  4G6W X;  4O7U A;  1RTS A;  1J3I C;  1TRG A;  4KY4 A;  1EV8 A;  2AAZ A;  3N5G A;  4UP1 A;  3GH0 A;  5J7W A;  3JSU A;  3CLB A;  3B5B A;  3QGT A;  1VZA A;  1BP0 A;  1LCA A;  4E5O A;  1NCE A;  3IK1 A;  1B49 A;  4O1U A;  3HB8 A;  4FOG A;  3IX6 A;  4DP3 A;  2KCE A;  4XSC A;  3UM5 A;  1VZD A;  4H0R A;  2A9W A;  3QG2 A;  1SEJ A;  1EVG A;  4IQQ A;  1VZE A;  3IHI A;  3UWL A;  4JEF A;  4LRR A;  3EF9 A;  5H39 A;  1KCE A;  1JTQ A;  3I3R A;  4DQ1 A;  5HS3 A;  2TDM A;  1BQ2 A;  4Q0D A;  3N5E B;  1TSL A;  3C06 A;  3BNZ A;  3IJZ A;  1BO7 A;  1B5D A;  3IRN A;  1LCE A;  1TSW A;  4ECK A;  1TDB A;  2OIP A;  3BGX A;  4GD7 A;  4KYA A;  1TDC A;  1BDU A;  4E28 A;  3DGA C;  4DPH A;  3BYX A;  1EV5 A;  4O1X D;  1VZC A;  3BZ0 A;  1HZW A;  2FTO X;  3UM8 A;  3IRM A;  1NJB A;  2RD8 A;  4G2O X;  1F4G A;  1YPV A;  1AN5 A;  2G89 A;  1B02 A;  1JUT A;  2H2Q A;  2FTQ A;  2TSR A;  4XSD A;  4FQS A;  1BJG A;  3KJS A;  1HVY A;  3UWL B;  4FGT A;  4KY8 A;  1THY A;  1TLS A;  3EAW X;  1TSD A;  4PSG A;  1BO8 A;  2G8D A;  1HW3 A;  3IRO A;  3QJ7 A;  1NJE A;  4ISK A;  1I00 A;  1F4F A;  1TVU A;  2TDD A;  1ZPR A;  1TIS A;  3NRR A;  1NJD A;  1TSM A;  1TDA A;  1JUJ A;  1TVV A;  1BQ1 A;  3EDW X;  4DPD A;  3DL5 A;  3C0A A;  1B5E A;  2VET A;  4Q0E A;  1F4C A;  1JMH A;  1AOB A;  3IK0 A;  3BFI A;  3K2H A;  4H1I A;  1JU6 A;  4GYH A;  4IQB A;  1DNA A;  5H3A A;  4GEV A;  1SYN A;  1F4B A;  1JMI A;  4ISW A;  3GH2 X;  4XSE A;  1TSV A;  5BY6 A;  1QQQ A;  1BSP A;  1HW4 A;  4KPW A;  3UM6 A;  1J3K C;  2FTN A;  2RD8 B;  5WRN A;  3BHR A;  3OB7 A;  1JMF A;  1JMG A;  1FWM A;  2TSC A;  3HBB A;  1TSN A;  4O1X A;  3TMS A;  3CL9 A;  1DDU A;  1JG0 A;  3EJL A;  3EHI X;  3INV A;  1TYS A;  3HJ3 A;  2G86 A;  1KZI A;  1TVW A;  1BSF A;  4EB4 A;  4EIL A;  1JTU A;  1NJC A;  1BKO A;  1TSY A;  4H0U A;  4TMS A;  5H38 A;  4EZ8 A;  4KNZ A;  3DL6 A;  1BPJ A;  1TSX A;  3EBU A;  1TSZ A;  1EVF A;  2BBQ A;  1CI7 A;  1F4D A;  1TJS A;  1FFL A;  3GG5 A;  1J3J C;  3DG8 C;  1VZB A;  1F28 A;  1AXW A;  2RDA A;  3B9H A;  1F4E A;  2ONB A;  3KJR A; 
#chains in the Genus database with same CATH topology
 1BKP A;  1TDU A;  2VF0 A;  3KGB A;  4FOA A;  2G8X A;  3BHL A;  1KZJ A;  1BID A;  1TLC A;  4EIN A;  1BP6 A;  4IRR A;  1AIQ A;  1AJM A;  3N5E A;  3EGY X;  1LCB A;  3V8H A;  4F2V A;  1NJA A;  1QZF A;  3H9K A;  4FOX A;  3ED7 A;  5FCT A;  2G8A A;  4G6W X;  4O7U A;  1RTS A;  1J3I C;  1TRG A;  4KY4 A;  1EV8 A;  2AAZ A;  3N5G A;  4UP1 A;  3GH0 A;  5J7W A;  3JSU A;  3CLB A;  3B5B A;  3QGT A;  1VZA A;  1BP0 A;  1LCA A;  4E5O A;  1NCE A;  3IK1 A;  1B49 A;  4O1U A;  3HB8 A;  4FOG A;  3IX6 A;  4DP3 A;  2KCE A;  4XSC A;  3UM5 A;  1VZD A;  4H0R A;  2A9W A;  3QG2 A;  1SEJ A;  1EVG A;  4IQQ A;  1VZE A;  3IHI A;  3UWL A;  4JEF A;  4LRR A;  3EF9 A;  5H39 A;  1KCE A;  1JTQ A;  3I3R A;  4DQ1 A;  5HS3 A;  2TDM A;  1BQ2 A;  4Q0D A;  3N5E B;  1TSL A;  3C06 A;  3BNZ A;  3IJZ A;  1BO7 A;  1B5D A;  3IRN A;  1LCE A;  1TSW A;  4ECK A;  1TDB A;  2OIP A;  3BGX A;  4GD7 A;  4KYA A;  1TDC A;  1BDU A;  4E28 A;  3DGA C;  4DPH A;  3BYX A;  1EV5 A;  4O1X D;  1VZC A;  3BZ0 A;  1HZW A;  2FTO X;  3UM8 A;  3IRM A;  1NJB A;  2RD8 A;  4G2O X;  1F4G A;  1YPV A;  1AN5 A;  2G89 A;  1B02 A;  1JUT A;  2H2Q A;  2FTQ A;  2TSR A;  4XSD A;  4FQS A;  1BJG A;  3KJS A;  1HVY A;  3UWL B;  4FGT A;  4KY8 A;  1THY A;  1TLS A;  3EAW X;  1TSD A;  4PSG A;  1BO8 A;  2G8D A;  1HW3 A;  3IRO A;  3QJ7 A;  1NJE A;  4ISK A;  1I00 A;  1F4F A;  1TVU A;  2TDD A;  1ZPR A;  1TIS A;  3NRR A;  1NJD A;  1TSM A;  1TDA A;  1JUJ A;  1TVV A;  1BQ1 A;  3EDW X;  4DPD A;  3DL5 A;  3C0A A;  1B5E A;  2VET A;  4Q0E A;  1F4C A;  1JMH A;  1AOB A;  3IK0 A;  3BFI A;  3K2H A;  4H1I A;  1JU6 A;  4GYH A;  4IQB A;  1DNA A;  5H3A A;  4GEV A;  1SYN A;  1F4B A;  1JMI A;  4ISW A;  3GH2 X;  4XSE A;  1TSV A;  5BY6 A;  1QQQ A;  1BSP A;  1HW4 A;  4KPW A;  3UM6 A;  1J3K C;  2FTN A;  2RD8 B;  5WRN A;  3BHR A;  3OB7 A;  1JMF A;  1JMG A;  1FWM A;  2TSC A;  3HBB A;  1TSN A;  4O1X A;  3TMS A;  3CL9 A;  1DDU A;  1JG0 A;  3EJL A;  3EHI X;  3INV A;  1TYS A;  3HJ3 A;  2G86 A;  1KZI A;  1TVW A;  1BSF A;  4EB4 A;  4EIL A;  1JTU A;  1NJC A;  1BKO A;  1TSY A;  4H0U A;  4TMS A;  5H38 A;  4EZ8 A;  4KNZ A;  3DL6 A;  1BPJ A;  1TSX A;  3EBU A;  1TSZ A;  1EVF A;  2BBQ A;  1CI7 A;  1F4D A;  1TJS A;  1FFL A;  3GG5 A;  1J3J C;  3DG8 C;  1VZB A;  1F28 A;  1AXW A;  2RDA A;  3B9H A;  1F4E A;  2ONB A;  3KJR A; 
#chains in the Genus database with same CATH homology
 1BKP A;  1TDU A;  2VF0 A;  3KGB A;  4FOA A;  2G8X A;  3BHL A;  1KZJ A;  1BID A;  1TLC A;  4EIN A;  1BP6 A;  4IRR A;  1AIQ A;  1AJM A;  3N5E A;  3EGY X;  1LCB A;  3V8H A;  4F2V A;  1NJA A;  1QZF A;  3H9K A;  4FOX A;  3ED7 A;  5FCT A;  2G8A A;  4G6W X;  4O7U A;  1RTS A;  1J3I C;  1TRG A;  4KY4 A;  1EV8 A;  2AAZ A;  3N5G A;  4UP1 A;  3GH0 A;  5J7W A;  3JSU A;  3CLB A;  3B5B A;  3QGT A;  1VZA A;  1BP0 A;  1LCA A;  4E5O A;  1NCE A;  3IK1 A;  1B49 A;  4O1U A;  3HB8 A;  4FOG A;  3IX6 A;  4DP3 A;  2KCE A;  4XSC A;  3UM5 A;  1VZD A;  4H0R A;  2A9W A;  3QG2 A;  1SEJ A;  1EVG A;  4IQQ A;  1VZE A;  3IHI A;  3UWL A;  4JEF A;  4LRR A;  3EF9 A;  5H39 A;  1KCE A;  1JTQ A;  3I3R A;  4DQ1 A;  5HS3 A;  2TDM A;  1BQ2 A;  4Q0D A;  3N5E B;  1TSL A;  3C06 A;  3BNZ A;  3IJZ A;  1BO7 A;  1B5D A;  3IRN A;  1LCE A;  1TSW A;  4ECK A;  1TDB A;  2OIP A;  3BGX A;  4GD7 A;  4KYA A;  1TDC A;  1BDU A;  4E28 A;  3DGA C;  4DPH A;  3BYX A;  1EV5 A;  4O1X D;  1VZC A;  3BZ0 A;  1HZW A;  2FTO X;  3UM8 A;  3IRM A;  1NJB A;  2RD8 A;  4G2O X;  1F4G A;  1YPV A;  1AN5 A;  2G89 A;  1B02 A;  1JUT A;  2H2Q A;  2FTQ A;  2TSR A;  4XSD A;  4FQS A;  1BJG A;  3KJS A;  1HVY A;  3UWL B;  4FGT A;  4KY8 A;  1THY A;  1TLS A;  3EAW X;  1TSD A;  4PSG A;  1BO8 A;  2G8D A;  1HW3 A;  3IRO A;  3QJ7 A;  1NJE A;  4ISK A;  1I00 A;  1F4F A;  1TVU A;  2TDD A;  1ZPR A;  1TIS A;  3NRR A;  1NJD A;  1TSM A;  1TDA A;  1JUJ A;  1TVV A;  1BQ1 A;  3EDW X;  4DPD A;  3DL5 A;  3C0A A;  1B5E A;  2VET A;  4Q0E A;  1F4C A;  1JMH A;  1AOB A;  3IK0 A;  3BFI A;  3K2H A;  4H1I A;  1JU6 A;  4GYH A;  4IQB A;  1DNA A;  5H3A A;  4GEV A;  1SYN A;  1F4B A;  1JMI A;  4ISW A;  3GH2 X;  4XSE A;  1TSV A;  5BY6 A;  1QQQ A;  1BSP A;  1HW4 A;  4KPW A;  3UM6 A;  1J3K C;  2FTN A;  2RD8 B;  5WRN A;  3BHR A;  3OB7 A;  1JMF A;  1JMG A;  1FWM A;  2TSC A;  3HBB A;  1TSN A;  4O1X A;  3TMS A;  3CL9 A;  1DDU A;  1JG0 A;  3EJL A;  3EHI X;  3INV A;  1TYS A;  3HJ3 A;  2G86 A;  1KZI A;  1TVW A;  1BSF A;  4EB4 A;  4EIL A;  1JTU A;  1NJC A;  1BKO A;  1TSY A;  4H0U A;  4TMS A;  5H38 A;  4EZ8 A;  4KNZ A;  3DL6 A;  1BPJ A;  1TSX A;  3EBU A;  1TSZ A;  1EVF A;  2BBQ A;  1CI7 A;  1F4D A;  1TJS A;  1FFL A;  3GG5 A;  1J3J C;  3DG8 C;  1VZB A;  1F28 A;  1AXW A;  2RDA A;  3B9H A;  1F4E A;  2ONB A;  3KJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...