4JEFA

Crystal structure of human thymidylate synthase y202a in inactive conformation.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
286
structure length
246
Chain Sequence
PPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSLGPVYGFQWRHFYSGQGVDQLQRVIDTIKTNPDDRRIIMAWNPRDLPLMALPPHALCQFAVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase
publication title Hotspots in an obligate homodimeric anticancer target. Structural and functional effects of interfacial mutations in human thymidylate synthase.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 246
sequence length 286
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2013-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4jefA00
1EVFA 3NRRA 3IROA 1LCAA 4FOXA 3H9KA 1SEJA 4XSCA 3DL6A 4XSEA 4EZ8A 1HW3A 1KZJA 1QZFA 1VZDA 4Q0EA 1F4EA 4FQSA 4FGTA 1TLSA 1TSWA 1B02A 1AXWA 1TSXA 1JG0A 3EHIX 3BGXA 1BQ2A 3IRMA 3IX6A 4IQQA 4IRRA 1TDBA 5BY6A 4F2VA 1VZEA 1LCBA 5H38A 4GD7A 2RDAA 4DPHA 1EVGA 5WRNA 1EV8A 2FTNA 3BNZA 2H2QA 1DDUA 3DL5A 1NJDA 1NJBA 1TRGA 2G86A 3EDWX 3IK1A 1BSPA 3N5GA 1F28A 1JUTA 3DGAC 4GEVA 1TLCA 1TDUA 1QQQA 1AIQA 1JMIA 3HB8A 1DNAA 3B5BA 1CI7A 1TSDA 1TYSA 1ZPRA 1F4DA 2TDDA 1KCEA 3GH2X 3BHRA 3DG8C 4XSDA 1J3JC 3BFIA 3OB7A 1BKPA 3CLBA 3QG2A 3HJ3A 4FOAA 4JEFA 4ECKA 3EGYX 1TSVA 1SYNA 1TSMA 1TSNA 4E28A 3CL9A 2G89A 3IK0A 3UWLA 4G2OX 3GG5A 3JSUA 2BBQA 3EJLA 3IJZA 4PSGA 2TDMA 1I00A 1LCEA 4KPWA 2G8DA 1HZWA 1JTUA 1B49A 3UWLB 1TISA 4TMSA 3TMSA 3EF9A 1AOBA 2FTQA 3IRNA 1EV5A 1BQ1A 1JMHA 4O7UA 4KY4A 1NCEA 5H3AA 1KZIA 2AAZA 1BP0A 4EINA 2RD8A 1BKOA 1B5EA 1JTQA 1NJEA 2ONBA 2OIPA 3QGTA 3N5EB 1HW4A 3QJ7A 1FFLA 1TJSA 3B9HA 5FCTA 4O1XA 1TVVA 4G6WX 3GH0A 1TVWA 4H0RA 4DP3A 1F4GA 1AJMA 5HS3A 4IQBA 1JUJA 1JU6A 1VZAA 1TSLA 4DPDA 4H0UA 2G8XA 3EAWX 3KJSA 4DQ1A 5J7WA 3EBUA 1FWMA 3UM5A 2VETA 3ED7A 1AN5A 3BYXA 3HBBA 3I3RA 4ISKA 4Q0DA 1NJCA 3UM6A 4E5OA 4EILA 1BJGA 3KGBA 1F4CA 4H1IA 4UP1A 1NJAA 2A9WA 3INVA 4GYHA 1TSYA 5H39A 1TVUA 4KY8A 1THYA 3KJRA 1YPVA 4O1UA 3UM8A 1BO8A 1B5DA 1BPJA 1J3IC 4ISWA 2G8AA 2RD8B 1J3KC 2TSRA 4LRRA 2TSCA 3IHIA 3BZ0A 3C06A 1TSZA 2FTOX 3V8HA 1F4BA 2VF0A 1BIDA 1HVYA 4EB4A 1RTSA 1F4FA 1BDUA 1VZCA 4O1XD 1BP6A 1JMGA 1BO7A 1TDCA 1VZBA 2KCEA 4FOGA 4KNZA 1BSFA 1TDAA 4KYAA 3N5EA 3K2HA 3C0AA 3BHLA 1JMFA
chains in the Genus database with same CATH superfamily
1EVFA 3NRRA 3IROA 1LCAA 4FOXA 3H9KA 1SEJA 4XSCA 3DL6A 4XSEA 4EZ8A 1HW3A 1KZJA 1QZFA 1VZDA 4Q0EA 1F4EA 4FQSA 4FGTA 1TLSA 1TSWA 1B02A 1AXWA 1TSXA 1JG0A 3EHIX 3BGXA 1BQ2A 3IRMA 3IX6A 4IQQA 4IRRA 1TDBA 5BY6A 4F2VA 1VZEA 1LCBA 5H38A 4GD7A 2RDAA 4DPHA 1EVGA 5WRNA 1EV8A 2FTNA 3BNZA 2H2QA 1DDUA 3DL5A 1NJDA 1NJBA 1TRGA 2G86A 3EDWX 3IK1A 1BSPA 3N5GA 1F28A 1JUTA 3DGAC 4GEVA 1TLCA 1TDUA 1QQQA 1AIQA 1JMIA 3HB8A 1DNAA 3B5BA 1CI7A 1TSDA 1TYSA 1ZPRA 1F4DA 2TDDA 1KCEA 3GH2X 3BHRA 3DG8C 4XSDA 1J3JC 3BFIA 3OB7A 1BKPA 3CLBA 3QG2A 3HJ3A 4FOAA 4JEFA 4ECKA 3EGYX 1TSVA 1SYNA 1TSMA 1TSNA 4E28A 3CL9A 2G89A 3IK0A 3UWLA 4G2OX 3GG5A 3JSUA 2BBQA 3EJLA 3IJZA 4PSGA 2TDMA 1I00A 1LCEA 4KPWA 2G8DA 1HZWA 1JTUA 1B49A 3UWLB 1TISA 4TMSA 3TMSA 3EF9A 1AOBA 2FTQA 3IRNA 1EV5A 1BQ1A 1JMHA 4O7UA 4KY4A 1NCEA 5H3AA 1KZIA 2AAZA 1BP0A 4EINA 2RD8A 1BKOA 1B5EA 1JTQA 1NJEA 2ONBA 2OIPA 3QGTA 3N5EB 1HW4A 3QJ7A 1FFLA 1TJSA 3B9HA 5FCTA 4O1XA 1TVVA 4G6WX 3GH0A 1TVWA 4H0RA 4DP3A 1F4GA 1AJMA 5HS3A 4IQBA 1JUJA 1JU6A 1VZAA 1TSLA 4DPDA 4H0UA 2G8XA 3EAWX 3KJSA 4DQ1A 5J7WA 3EBUA 1FWMA 3UM5A 2VETA 3ED7A 1AN5A 3BYXA 3HBBA 3I3RA 4ISKA 4Q0DA 1NJCA 3UM6A 4E5OA 4EILA 1BJGA 3KGBA 1F4CA 4H1IA 4UP1A 1NJAA 2A9WA 3INVA 4GYHA 1TSYA 5H39A 1TVUA 4KY8A 1THYA 3KJRA 1YPVA 4O1UA 3UM8A 1BO8A 1B5DA 1BPJA 1J3IC 4ISWA 2G8AA 2RD8B 1J3KC 2TSRA 4LRRA 2TSCA 3IHIA 3BZ0A 3C06A 1TSZA 2FTOX 3V8HA 1F4BA 2VF0A 1BIDA 1HVYA 4EB4A 1RTSA 1F4FA 1BDUA 1VZCA 4O1XD 1BP6A 1JMGA 1BO7A 1TDCA 1VZBA 2KCEA 4FOGA 4KNZA 1BSFA 1TDAA 4KYAA 3N5EA 3K2HA 3C0AA 3BHLA 1JMFA
chains in the Genus database with same CATH topology
1EVFA 3NRRA 3IROA 1LCAA 4FOXA 3H9KA 1SEJA 4XSCA 3DL6A 4XSEA 4EZ8A 1HW3A 1KZJA 1QZFA 1VZDA 4Q0EA 1F4EA 4FQSA 4FGTA 1TLSA 1TSWA 1B02A 1AXWA 1TSXA 1JG0A 3EHIX 3BGXA 1BQ2A 3IRMA 3IX6A 4IQQA 4IRRA 1TDBA 5BY6A 4F2VA 1VZEA 1LCBA 5H38A 4GD7A 2RDAA 4DPHA 1EVGA 5WRNA 1EV8A 2FTNA 3BNZA 2H2QA 1DDUA 3DL5A 1NJDA 1NJBA 1TRGA 2G86A 3EDWX 3IK1A 1BSPA 3N5GA 1F28A 1JUTA 3DGAC 4GEVA 1TLCA 1TDUA 1QQQA 1AIQA 1JMIA 3HB8A 1DNAA 3B5BA 1CI7A 1TSDA 1TYSA 1ZPRA 1F4DA 2TDDA 1KCEA 3GH2X 3BHRA 3DG8C 4XSDA 1J3JC 3BFIA 3OB7A 1BKPA 3CLBA 3QG2A 3HJ3A 4FOAA 4JEFA 4ECKA 3EGYX 1TSVA 1SYNA 1TSMA 1TSNA 4E28A 3CL9A 2G89A 3IK0A 3UWLA 4G2OX 3GG5A 3JSUA 2BBQA 3EJLA 3IJZA 4PSGA 2TDMA 1I00A 1LCEA 4KPWA 2G8DA 1HZWA 1JTUA 1B49A 3UWLB 1TISA 4TMSA 3TMSA 3EF9A 1AOBA 2FTQA 3IRNA 1EV5A 1BQ1A 1JMHA 4O7UA 4KY4A 1NCEA 5H3AA 1KZIA 2AAZA 1BP0A 4EINA 2RD8A 1BKOA 1B5EA 1JTQA 1NJEA 2ONBA 2OIPA 3QGTA 3N5EB 1HW4A 3QJ7A 1FFLA 1TJSA 3B9HA 5FCTA 4O1XA 1TVVA 4G6WX 3GH0A 1TVWA 4H0RA 4DP3A 1F4GA 1AJMA 5HS3A 4IQBA 1JUJA 1JU6A 1VZAA 1TSLA 4DPDA 4H0UA 2G8XA 3EAWX 3KJSA 4DQ1A 5J7WA 3EBUA 1FWMA 3UM5A 2VETA 3ED7A 1AN5A 3BYXA 3HBBA 3I3RA 4ISKA 4Q0DA 1NJCA 3UM6A 4E5OA 4EILA 1BJGA 3KGBA 1F4CA 4H1IA 4UP1A 1NJAA 2A9WA 3INVA 4GYHA 1TSYA 5H39A 1TVUA 4KY8A 1THYA 3KJRA 1YPVA 4O1UA 3UM8A 1BO8A 1B5DA 1BPJA 1J3IC 4ISWA 2G8AA 2RD8B 1J3KC 2TSRA 4LRRA 2TSCA 3IHIA 3BZ0A 3C06A 1TSZA 2FTOX 3V8HA 1F4BA 2VF0A 1BIDA 1HVYA 4EB4A 1RTSA 1F4FA 1BDUA 1VZCA 4O1XD 1BP6A 1JMGA 1BO7A 1TDCA 1VZBA 2KCEA 4FOGA 4KNZA 1BSFA 1TDAA 4KYAA 3N5EA 3K2HA 3C0AA 3BHLA 1JMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EVF A;  3NRR A;  3IRO A;  1LCA A;  4FOX A;  3H9K A;  1SEJ A;  4XSC A;  3DL6 A;  4XSE A;  4EZ8 A;  1HW3 A;  1KZJ A;  1QZF A;  1VZD A;  4Q0E A;  1F4E A;  4FQS A;  4FGT A;  1TLS A;  1TSW A;  1B02 A;  1AXW A;  1TSX A;  1JG0 A;  3EHI X;  3BGX A;  1BQ2 A;  3IRM A;  3IX6 A;  4IQQ A;  4IRR A;  1TDB A;  5BY6 A;  4F2V A;  1VZE A;  1LCB A;  5H38 A;  4GD7 A;  2RDA A;  4DPH A;  1EVG A;  5WRN A;  1EV8 A;  2FTN A;  3BNZ A;  2H2Q A;  1DDU A;  3DL5 A;  1NJD A;  1NJB A;  1TRG A;  2G86 A;  3EDW X;  3IK1 A;  1BSP A;  3N5G A;  1F28 A;  1JUT A;  3DGA C;  4GEV A;  1TLC A;  1TDU A;  1QQQ A;  1AIQ A;  1JMI A;  3HB8 A;  1DNA A;  3B5B A;  1CI7 A;  1TSD A;  1TYS A;  1ZPR A;  1F4D A;  2TDD A;  1KCE A;  3GH2 X;  3BHR A;  3DG8 C;  4XSD A;  1J3J C;  3BFI A;  3OB7 A;  1BKP A;  3CLB A;  3QG2 A;  3HJ3 A;  4FOA A;  4JEF A;  4ECK A;  3EGY X;  1TSV A;  1SYN A;  1TSM A;  1TSN A;  4E28 A;  3CL9 A;  2G89 A;  3IK0 A;  3UWL A;  4G2O X;  3GG5 A;  3JSU A;  2BBQ A;  3EJL A;  3IJZ A;  4PSG A;  2TDM A;  1I00 A;  1LCE A;  4KPW A;  2G8D A;  1HZW A;  1JTU A;  1B49 A;  3UWL B;  1TIS A;  4TMS A;  3TMS A;  3EF9 A;  1AOB A;  2FTQ A;  3IRN A;  1EV5 A;  1BQ1 A;  1JMH A;  4O7U A;  4KY4 A;  1NCE A;  5H3A A;  1KZI A;  2AAZ A;  1BP0 A;  4EIN A;  2RD8 A;  1BKO A;  1B5E A;  1JTQ A;  1NJE A;  2ONB A;  2OIP A;  3QGT A;  3N5E B;  1HW4 A;  3QJ7 A;  1FFL A;  1TJS A;  3B9H A;  5FCT A;  4O1X A;  1TVV A;  4G6W X;  3GH0 A;  1TVW A;  4H0R A;  4DP3 A;  1F4G A;  1AJM A;  5HS3 A;  4IQB A;  1JUJ A;  1JU6 A;  1VZA A;  1TSL A;  4DPD A;  4H0U A;  2G8X A;  3EAW X;  3KJS A;  4DQ1 A;  5J7W A;  3EBU A;  1FWM A;  3UM5 A;  2VET A;  3ED7 A;  1AN5 A;  3BYX A;  3HBB A;  3I3R A;  4ISK A;  4Q0D A;  1NJC A;  3UM6 A;  4E5O A;  4EIL A;  1BJG A;  3KGB A;  1F4C A;  4H1I A;  4UP1 A;  1NJA A;  2A9W A;  3INV A;  4GYH A;  1TSY A;  5H39 A;  1TVU A;  4KY8 A;  1THY A;  3KJR A;  1YPV A;  4O1U A;  3UM8 A;  1BO8 A;  1B5D A;  1BPJ A;  1J3I C;  4ISW A;  2G8A A;  2RD8 B;  1J3K C;  2TSR A;  4LRR A;  2TSC A;  3IHI A;  3BZ0 A;  3C06 A;  1TSZ A;  2FTO X;  3V8H A;  1F4B A;  2VF0 A;  1BID A;  1HVY A;  4EB4 A;  1RTS A;  1F4F A;  1BDU A;  1VZC A;  4O1X D;  1BP6 A;  1JMG A;  1BO7 A;  1TDC A;  1VZB A;  2KCE A;  4FOG A;  4KNZ A;  1BSF A;  1TDA A;  4KYA A;  3N5E A;  3K2H A;  3C0A A;  3BHL A;  1JMF A; 
#chains in the Genus database with same CATH topology
 1EVF A;  3NRR A;  3IRO A;  1LCA A;  4FOX A;  3H9K A;  1SEJ A;  4XSC A;  3DL6 A;  4XSE A;  4EZ8 A;  1HW3 A;  1KZJ A;  1QZF A;  1VZD A;  4Q0E A;  1F4E A;  4FQS A;  4FGT A;  1TLS A;  1TSW A;  1B02 A;  1AXW A;  1TSX A;  1JG0 A;  3EHI X;  3BGX A;  1BQ2 A;  3IRM A;  3IX6 A;  4IQQ A;  4IRR A;  1TDB A;  5BY6 A;  4F2V A;  1VZE A;  1LCB A;  5H38 A;  4GD7 A;  2RDA A;  4DPH A;  1EVG A;  5WRN A;  1EV8 A;  2FTN A;  3BNZ A;  2H2Q A;  1DDU A;  3DL5 A;  1NJD A;  1NJB A;  1TRG A;  2G86 A;  3EDW X;  3IK1 A;  1BSP A;  3N5G A;  1F28 A;  1JUT A;  3DGA C;  4GEV A;  1TLC A;  1TDU A;  1QQQ A;  1AIQ A;  1JMI A;  3HB8 A;  1DNA A;  3B5B A;  1CI7 A;  1TSD A;  1TYS A;  1ZPR A;  1F4D A;  2TDD A;  1KCE A;  3GH2 X;  3BHR A;  3DG8 C;  4XSD A;  1J3J C;  3BFI A;  3OB7 A;  1BKP A;  3CLB A;  3QG2 A;  3HJ3 A;  4FOA A;  4JEF A;  4ECK A;  3EGY X;  1TSV A;  1SYN A;  1TSM A;  1TSN A;  4E28 A;  3CL9 A;  2G89 A;  3IK0 A;  3UWL A;  4G2O X;  3GG5 A;  3JSU A;  2BBQ A;  3EJL A;  3IJZ A;  4PSG A;  2TDM A;  1I00 A;  1LCE A;  4KPW A;  2G8D A;  1HZW A;  1JTU A;  1B49 A;  3UWL B;  1TIS A;  4TMS A;  3TMS A;  3EF9 A;  1AOB A;  2FTQ A;  3IRN A;  1EV5 A;  1BQ1 A;  1JMH A;  4O7U A;  4KY4 A;  1NCE A;  5H3A A;  1KZI A;  2AAZ A;  1BP0 A;  4EIN A;  2RD8 A;  1BKO A;  1B5E A;  1JTQ A;  1NJE A;  2ONB A;  2OIP A;  3QGT A;  3N5E B;  1HW4 A;  3QJ7 A;  1FFL A;  1TJS A;  3B9H A;  5FCT A;  4O1X A;  1TVV A;  4G6W X;  3GH0 A;  1TVW A;  4H0R A;  4DP3 A;  1F4G A;  1AJM A;  5HS3 A;  4IQB A;  1JUJ A;  1JU6 A;  1VZA A;  1TSL A;  4DPD A;  4H0U A;  2G8X A;  3EAW X;  3KJS A;  4DQ1 A;  5J7W A;  3EBU A;  1FWM A;  3UM5 A;  2VET A;  3ED7 A;  1AN5 A;  3BYX A;  3HBB A;  3I3R A;  4ISK A;  4Q0D A;  1NJC A;  3UM6 A;  4E5O A;  4EIL A;  1BJG A;  3KGB A;  1F4C A;  4H1I A;  4UP1 A;  1NJA A;  2A9W A;  3INV A;  4GYH A;  1TSY A;  5H39 A;  1TVU A;  4KY8 A;  1THY A;  3KJR A;  1YPV A;  4O1U A;  3UM8 A;  1BO8 A;  1B5D A;  1BPJ A;  1J3I C;  4ISW A;  2G8A A;  2RD8 B;  1J3K C;  2TSR A;  4LRR A;  2TSC A;  3IHI A;  3BZ0 A;  3C06 A;  1TSZ A;  2FTO X;  3V8H A;  1F4B A;  2VF0 A;  1BID A;  1HVY A;  4EB4 A;  1RTS A;  1F4F A;  1BDU A;  1VZC A;  4O1X D;  1BP6 A;  1JMG A;  1BO7 A;  1TDC A;  1VZB A;  2KCE A;  4FOG A;  4KNZ A;  1BSF A;  1TDA A;  4KYA A;  3N5E A;  3K2H A;  3C0A A;  3BHL A;  1JMF A; 
#chains in the Genus database with same CATH homology
 1EVF A;  3NRR A;  3IRO A;  1LCA A;  4FOX A;  3H9K A;  1SEJ A;  4XSC A;  3DL6 A;  4XSE A;  4EZ8 A;  1HW3 A;  1KZJ A;  1QZF A;  1VZD A;  4Q0E A;  1F4E A;  4FQS A;  4FGT A;  1TLS A;  1TSW A;  1B02 A;  1AXW A;  1TSX A;  1JG0 A;  3EHI X;  3BGX A;  1BQ2 A;  3IRM A;  3IX6 A;  4IQQ A;  4IRR A;  1TDB A;  5BY6 A;  4F2V A;  1VZE A;  1LCB A;  5H38 A;  4GD7 A;  2RDA A;  4DPH A;  1EVG A;  5WRN A;  1EV8 A;  2FTN A;  3BNZ A;  2H2Q A;  1DDU A;  3DL5 A;  1NJD A;  1NJB A;  1TRG A;  2G86 A;  3EDW X;  3IK1 A;  1BSP A;  3N5G A;  1F28 A;  1JUT A;  3DGA C;  4GEV A;  1TLC A;  1TDU A;  1QQQ A;  1AIQ A;  1JMI A;  3HB8 A;  1DNA A;  3B5B A;  1CI7 A;  1TSD A;  1TYS A;  1ZPR A;  1F4D A;  2TDD A;  1KCE A;  3GH2 X;  3BHR A;  3DG8 C;  4XSD A;  1J3J C;  3BFI A;  3OB7 A;  1BKP A;  3CLB A;  3QG2 A;  3HJ3 A;  4FOA A;  4JEF A;  4ECK A;  3EGY X;  1TSV A;  1SYN A;  1TSM A;  1TSN A;  4E28 A;  3CL9 A;  2G89 A;  3IK0 A;  3UWL A;  4G2O X;  3GG5 A;  3JSU A;  2BBQ A;  3EJL A;  3IJZ A;  4PSG A;  2TDM A;  1I00 A;  1LCE A;  4KPW A;  2G8D A;  1HZW A;  1JTU A;  1B49 A;  3UWL B;  1TIS A;  4TMS A;  3TMS A;  3EF9 A;  1AOB A;  2FTQ A;  3IRN A;  1EV5 A;  1BQ1 A;  1JMH A;  4O7U A;  4KY4 A;  1NCE A;  5H3A A;  1KZI A;  2AAZ A;  1BP0 A;  4EIN A;  2RD8 A;  1BKO A;  1B5E A;  1JTQ A;  1NJE A;  2ONB A;  2OIP A;  3QGT A;  3N5E B;  1HW4 A;  3QJ7 A;  1FFL A;  1TJS A;  3B9H A;  5FCT A;  4O1X A;  1TVV A;  4G6W X;  3GH0 A;  1TVW A;  4H0R A;  4DP3 A;  1F4G A;  1AJM A;  5HS3 A;  4IQB A;  1JUJ A;  1JU6 A;  1VZA A;  1TSL A;  4DPD A;  4H0U A;  2G8X A;  3EAW X;  3KJS A;  4DQ1 A;  5J7W A;  3EBU A;  1FWM A;  3UM5 A;  2VET A;  3ED7 A;  1AN5 A;  3BYX A;  3HBB A;  3I3R A;  4ISK A;  4Q0D A;  1NJC A;  3UM6 A;  4E5O A;  4EIL A;  1BJG A;  3KGB A;  1F4C A;  4H1I A;  4UP1 A;  1NJA A;  2A9W A;  3INV A;  4GYH A;  1TSY A;  5H39 A;  1TVU A;  4KY8 A;  1THY A;  3KJR A;  1YPV A;  4O1U A;  3UM8 A;  1BO8 A;  1B5D A;  1BPJ A;  1J3I C;  4ISW A;  2G8A A;  2RD8 B;  1J3K C;  2TSR A;  4LRR A;  2TSC A;  3IHI A;  3BZ0 A;  3C06 A;  1TSZ A;  2FTO X;  3V8H A;  1F4B A;  2VF0 A;  1BID A;  1HVY A;  4EB4 A;  1RTS A;  1F4F A;  1BDU A;  1VZC A;  4O1X D;  1BP6 A;  1JMG A;  1BO7 A;  1TDC A;  1VZB A;  2KCE A;  4FOG A;  4KNZ A;  1BSF A;  1TDA A;  4KYA A;  3N5E A;  3K2H A;  3C0A A;  3BHL A;  1JMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...