4KPWA

Crystal structure of his-tagged human thymidylate synthase r175a mutant
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
286
structure length
261
Chain Sequence
PPHGELQYLGQIQHILRGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDARIIMAWNPRDLPLMALPPHALQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase
publication title Hotspots in an obligate homodimeric anticancer target. Structural and functional effects of interfacial mutations in human thymidylate synthase.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 261
sequence length 286
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4kpwA00
1JTUA 3EAWX 1SEJA 2TDDA 1QZFA 1B49A 1NJDA 1LCAA 3K2HA 1BDUA 3EGYX 4JEFA 2TDMA 4G2OX 5WRNA 3IRNA 4H1IA 4FQSA 4XSCA 2G8AA 1TDCA 3BHRA 1DNAA 1EV8A 4DPDA 4EILA 1AJMA 3QGTA 1F4GA 4IQBA 4KY8A 3IJZA 3UM8A 1HZWA 1TSVA 1LCBA 3NRRA 4IRRA 1F4FA 1LCEA 1VZBA 4O7UA 1JMIA 1VZCA 1JUTA 1TSYA 4O1XD 1EV5A 2TSRA 3BHLA 2TSCA 1CI7A 4DP3A 2KCEA 3GH0A 1BP6A 1TSZA 3V8HA 1TDAA 1EVGA 1YPVA 3B9HA 5BY6A 2BBQA 3IX6A 1JU6A 4E28A 1BQ1A 1TLCA 1NJBA 5J7WA 3IRMA 1DDUA 3CLBA 3DL5A 1NJAA 3HBBA 3IK1A 3UM5A 4H0RA 2A9WA 4Q0DA 1TSLA 4XSEA 5H3AA 5HS3A 1AXWA 1VZDA 3H9KA 4GD7A 4EZ8A 4TMSA 1F4CA 3IROA 1TDUA 1AOBA 2G8XA 3DG8C 1BKOA 1J3JC 3BNZA 1TYSA 4KPWA 4UP1A 3GH2X 3EJLA 2G8DA 2RDAA 3BGXA 1KZJA 1FFLA 1SYNA 1HW4A 3EHIX 3EBUA 1BKPA 4EINA 2AAZA 1TSNA 4KYAA 2RD8A 3OB7A 3ED7A 3N5EB 1TVVA 4E5OA 4FOAA 4FGTA 1BO8A 1TJSA 2RD8B 2FTQA 1KZIA 3HB8A 1BO7A 1HW3A 2VF0A 4IQQA 2H2QA 1JMGA 1NJCA 4Q0EA 3IHIA 1TVUA 4ISKA 1RTSA 3EDWX 3JSUA 1F4EA 4PSGA 1HVYA 4FOGA 3EF9A 1JMFA 1ZPRA 3IK0A 4F2VA 1TVWA 3QG2A 3BFIA 4DPHA 3TMSA 1VZEA 1NCEA 1JG0A 4H0UA 2OIPA 1TSMA 2FTNA 3BYXA 3DL6A 3CL9A 1BSPA 3C06A 1VZAA 3UWLA 3B5BA 1J3IC 1F4DA 3HJ3A 3KJSA 4GEVA 4O1UA 1EVFA 3UWLB 1THYA 1BSFA 3N5EA 4KNZA 3KJRA 2FTOX 1TRGA 2ONBA 3DGAC 3I3RA 3INVA 4ISWA 5H38A 1TSDA 1JMHA 3C0AA 1BPJA 1B5EA 1QQQA 1JUJA 1BQ2A 3N5GA 1TISA 1BJGA 1I00A 3KGBA 2G89A 3GG5A 1J3KC 3UM6A 1AN5A 4EB4A 4ECKA 1JTQA 3BZ0A 4KY4A 1TLSA 1AIQA 1TSXA 1KCEA 4LRRA 1TSWA 2VETA 4FOXA 4G6WX 4O1XA 4XSDA 1B02A 1F28A 1B5DA 1FWMA 2G86A 4GYHA 5FCTA 5H39A 1BIDA 1NJEA 1TDBA 4DQ1A 3QJ7A 1BP0A 1F4BA
chains in the Genus database with same CATH superfamily
1JTUA 3EAWX 1SEJA 2TDDA 1QZFA 1B49A 1NJDA 1LCAA 3K2HA 1BDUA 3EGYX 4JEFA 2TDMA 4G2OX 5WRNA 3IRNA 4H1IA 4FQSA 4XSCA 2G8AA 1TDCA 3BHRA 1DNAA 1EV8A 4DPDA 4EILA 1AJMA 3QGTA 1F4GA 4IQBA 4KY8A 3IJZA 3UM8A 1HZWA 1TSVA 1LCBA 3NRRA 4IRRA 1F4FA 1LCEA 1VZBA 4O7UA 1JMIA 1VZCA 1JUTA 1TSYA 4O1XD 1EV5A 2TSRA 3BHLA 2TSCA 1CI7A 4DP3A 2KCEA 3GH0A 1BP6A 1TSZA 3V8HA 1TDAA 1EVGA 1YPVA 3B9HA 5BY6A 2BBQA 3IX6A 1JU6A 4E28A 1BQ1A 1TLCA 1NJBA 5J7WA 3IRMA 1DDUA 3CLBA 3DL5A 1NJAA 3HBBA 3IK1A 3UM5A 4H0RA 2A9WA 4Q0DA 1TSLA 4XSEA 5H3AA 5HS3A 1AXWA 1VZDA 3H9KA 4GD7A 4EZ8A 4TMSA 1F4CA 3IROA 1TDUA 1AOBA 2G8XA 3DG8C 1BKOA 1J3JC 3BNZA 1TYSA 4KPWA 4UP1A 3GH2X 3EJLA 2G8DA 2RDAA 3BGXA 1KZJA 1FFLA 1SYNA 1HW4A 3EHIX 3EBUA 1BKPA 4EINA 2AAZA 1TSNA 4KYAA 2RD8A 3OB7A 3ED7A 3N5EB 1TVVA 4E5OA 4FOAA 4FGTA 1BO8A 1TJSA 2RD8B 2FTQA 1KZIA 3HB8A 1BO7A 1HW3A 2VF0A 4IQQA 2H2QA 1JMGA 1NJCA 4Q0EA 3IHIA 1TVUA 4ISKA 1RTSA 3EDWX 3JSUA 1F4EA 4PSGA 1HVYA 4FOGA 3EF9A 1JMFA 1ZPRA 3IK0A 4F2VA 1TVWA 3QG2A 3BFIA 4DPHA 3TMSA 1VZEA 1NCEA 1JG0A 4H0UA 2OIPA 1TSMA 2FTNA 3BYXA 3DL6A 3CL9A 1BSPA 3C06A 1VZAA 3UWLA 3B5BA 1J3IC 1F4DA 3HJ3A 3KJSA 4GEVA 4O1UA 1EVFA 3UWLB 1THYA 1BSFA 3N5EA 4KNZA 3KJRA 2FTOX 1TRGA 2ONBA 3DGAC 3I3RA 3INVA 4ISWA 5H38A 1TSDA 1JMHA 3C0AA 1BPJA 1B5EA 1QQQA 1JUJA 1BQ2A 3N5GA 1TISA 1BJGA 1I00A 3KGBA 2G89A 3GG5A 1J3KC 3UM6A 1AN5A 4EB4A 4ECKA 1JTQA 3BZ0A 4KY4A 1TLSA 1AIQA 1TSXA 1KCEA 4LRRA 1TSWA 2VETA 4FOXA 4G6WX 4O1XA 4XSDA 1B02A 1F28A 1B5DA 1FWMA 2G86A 4GYHA 5FCTA 5H39A 1BIDA 1NJEA 1TDBA 4DQ1A 3QJ7A 1BP0A 1F4BA
chains in the Genus database with same CATH topology
1JTUA 3EAWX 1SEJA 2TDDA 1QZFA 1B49A 1NJDA 1LCAA 3K2HA 1BDUA 3EGYX 4JEFA 2TDMA 4G2OX 5WRNA 3IRNA 4H1IA 4FQSA 4XSCA 2G8AA 1TDCA 3BHRA 1DNAA 1EV8A 4DPDA 4EILA 1AJMA 3QGTA 1F4GA 4IQBA 4KY8A 3IJZA 3UM8A 1HZWA 1TSVA 1LCBA 3NRRA 4IRRA 1F4FA 1LCEA 1VZBA 4O7UA 1JMIA 1VZCA 1JUTA 1TSYA 4O1XD 1EV5A 2TSRA 3BHLA 2TSCA 1CI7A 4DP3A 2KCEA 3GH0A 1BP6A 1TSZA 3V8HA 1TDAA 1EVGA 1YPVA 3B9HA 5BY6A 2BBQA 3IX6A 1JU6A 4E28A 1BQ1A 1TLCA 1NJBA 5J7WA 3IRMA 1DDUA 3CLBA 3DL5A 1NJAA 3HBBA 3IK1A 3UM5A 4H0RA 2A9WA 4Q0DA 1TSLA 4XSEA 5H3AA 5HS3A 1AXWA 1VZDA 3H9KA 4GD7A 4EZ8A 4TMSA 1F4CA 3IROA 1TDUA 1AOBA 2G8XA 3DG8C 1BKOA 1J3JC 3BNZA 1TYSA 4KPWA 4UP1A 3GH2X 3EJLA 2G8DA 2RDAA 3BGXA 1KZJA 1FFLA 1SYNA 1HW4A 3EHIX 3EBUA 1BKPA 4EINA 2AAZA 1TSNA 4KYAA 2RD8A 3OB7A 3ED7A 3N5EB 1TVVA 4E5OA 4FOAA 4FGTA 1BO8A 1TJSA 2RD8B 2FTQA 1KZIA 3HB8A 1BO7A 1HW3A 2VF0A 4IQQA 2H2QA 1JMGA 1NJCA 4Q0EA 3IHIA 1TVUA 4ISKA 1RTSA 3EDWX 3JSUA 1F4EA 4PSGA 1HVYA 4FOGA 3EF9A 1JMFA 1ZPRA 3IK0A 4F2VA 1TVWA 3QG2A 3BFIA 4DPHA 3TMSA 1VZEA 1NCEA 1JG0A 4H0UA 2OIPA 1TSMA 2FTNA 3BYXA 3DL6A 3CL9A 1BSPA 3C06A 1VZAA 3UWLA 3B5BA 1J3IC 1F4DA 3HJ3A 3KJSA 4GEVA 4O1UA 1EVFA 3UWLB 1THYA 1BSFA 3N5EA 4KNZA 3KJRA 2FTOX 1TRGA 2ONBA 3DGAC 3I3RA 3INVA 4ISWA 5H38A 1TSDA 1JMHA 3C0AA 1BPJA 1B5EA 1QQQA 1JUJA 1BQ2A 3N5GA 1TISA 1BJGA 1I00A 3KGBA 2G89A 3GG5A 1J3KC 3UM6A 1AN5A 4EB4A 4ECKA 1JTQA 3BZ0A 4KY4A 1TLSA 1AIQA 1TSXA 1KCEA 4LRRA 1TSWA 2VETA 4FOXA 4G6WX 4O1XA 4XSDA 1B02A 1F28A 1B5DA 1FWMA 2G86A 4GYHA 5FCTA 5H39A 1BIDA 1NJEA 1TDBA 4DQ1A 3QJ7A 1BP0A 1F4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTU A;  3EAW X;  1SEJ A;  2TDD A;  1QZF A;  1B49 A;  1NJD A;  1LCA A;  3K2H A;  1BDU A;  3EGY X;  4JEF A;  2TDM A;  4G2O X;  5WRN A;  3IRN A;  4H1I A;  4FQS A;  4XSC A;  2G8A A;  1TDC A;  3BHR A;  1DNA A;  1EV8 A;  4DPD A;  4EIL A;  1AJM A;  3QGT A;  1F4G A;  4IQB A;  4KY8 A;  3IJZ A;  3UM8 A;  1HZW A;  1TSV A;  1LCB A;  3NRR A;  4IRR A;  1F4F A;  1LCE A;  1VZB A;  4O7U A;  1JMI A;  1VZC A;  1JUT A;  1TSY A;  4O1X D;  1EV5 A;  2TSR A;  3BHL A;  2TSC A;  1CI7 A;  4DP3 A;  2KCE A;  3GH0 A;  1BP6 A;  1TSZ A;  3V8H A;  1TDA A;  1EVG A;  1YPV A;  3B9H A;  5BY6 A;  2BBQ A;  3IX6 A;  1JU6 A;  4E28 A;  1BQ1 A;  1TLC A;  1NJB A;  5J7W A;  3IRM A;  1DDU A;  3CLB A;  3DL5 A;  1NJA A;  3HBB A;  3IK1 A;  3UM5 A;  4H0R A;  2A9W A;  4Q0D A;  1TSL A;  4XSE A;  5H3A A;  5HS3 A;  1AXW A;  1VZD A;  3H9K A;  4GD7 A;  4EZ8 A;  4TMS A;  1F4C A;  3IRO A;  1TDU A;  1AOB A;  2G8X A;  3DG8 C;  1BKO A;  1J3J C;  3BNZ A;  1TYS A;  4KPW A;  4UP1 A;  3GH2 X;  3EJL A;  2G8D A;  2RDA A;  3BGX A;  1KZJ A;  1FFL A;  1SYN A;  1HW4 A;  3EHI X;  3EBU A;  1BKP A;  4EIN A;  2AAZ A;  1TSN A;  4KYA A;  2RD8 A;  3OB7 A;  3ED7 A;  3N5E B;  1TVV A;  4E5O A;  4FOA A;  4FGT A;  1BO8 A;  1TJS A;  2RD8 B;  2FTQ A;  1KZI A;  3HB8 A;  1BO7 A;  1HW3 A;  2VF0 A;  4IQQ A;  2H2Q A;  1JMG A;  1NJC A;  4Q0E A;  3IHI A;  1TVU A;  4ISK A;  1RTS A;  3EDW X;  3JSU A;  1F4E A;  4PSG A;  1HVY A;  4FOG A;  3EF9 A;  1JMF A;  1ZPR A;  3IK0 A;  4F2V A;  1TVW A;  3QG2 A;  3BFI A;  4DPH A;  3TMS A;  1VZE A;  1NCE A;  1JG0 A;  4H0U A;  2OIP A;  1TSM A;  2FTN A;  3BYX A;  3DL6 A;  3CL9 A;  1BSP A;  3C06 A;  1VZA A;  3UWL A;  3B5B A;  1J3I C;  1F4D A;  3HJ3 A;  3KJS A;  4GEV A;  4O1U A;  1EVF A;  3UWL B;  1THY A;  1BSF A;  3N5E A;  4KNZ A;  3KJR A;  2FTO X;  1TRG A;  2ONB A;  3DGA C;  3I3R A;  3INV A;  4ISW A;  5H38 A;  1TSD A;  1JMH A;  3C0A A;  1BPJ A;  1B5E A;  1QQQ A;  1JUJ A;  1BQ2 A;  3N5G A;  1TIS A;  1BJG A;  1I00 A;  3KGB A;  2G89 A;  3GG5 A;  1J3K C;  3UM6 A;  1AN5 A;  4EB4 A;  4ECK A;  1JTQ A;  3BZ0 A;  4KY4 A;  1TLS A;  1AIQ A;  1TSX A;  1KCE A;  4LRR A;  1TSW A;  2VET A;  4FOX A;  4G6W X;  4O1X A;  4XSD A;  1B02 A;  1F28 A;  1B5D A;  1FWM A;  2G86 A;  4GYH A;  5FCT A;  5H39 A;  1BID A;  1NJE A;  1TDB A;  4DQ1 A;  3QJ7 A;  1BP0 A;  1F4B A; 
#chains in the Genus database with same CATH topology
 1JTU A;  3EAW X;  1SEJ A;  2TDD A;  1QZF A;  1B49 A;  1NJD A;  1LCA A;  3K2H A;  1BDU A;  3EGY X;  4JEF A;  2TDM A;  4G2O X;  5WRN A;  3IRN A;  4H1I A;  4FQS A;  4XSC A;  2G8A A;  1TDC A;  3BHR A;  1DNA A;  1EV8 A;  4DPD A;  4EIL A;  1AJM A;  3QGT A;  1F4G A;  4IQB A;  4KY8 A;  3IJZ A;  3UM8 A;  1HZW A;  1TSV A;  1LCB A;  3NRR A;  4IRR A;  1F4F A;  1LCE A;  1VZB A;  4O7U A;  1JMI A;  1VZC A;  1JUT A;  1TSY A;  4O1X D;  1EV5 A;  2TSR A;  3BHL A;  2TSC A;  1CI7 A;  4DP3 A;  2KCE A;  3GH0 A;  1BP6 A;  1TSZ A;  3V8H A;  1TDA A;  1EVG A;  1YPV A;  3B9H A;  5BY6 A;  2BBQ A;  3IX6 A;  1JU6 A;  4E28 A;  1BQ1 A;  1TLC A;  1NJB A;  5J7W A;  3IRM A;  1DDU A;  3CLB A;  3DL5 A;  1NJA A;  3HBB A;  3IK1 A;  3UM5 A;  4H0R A;  2A9W A;  4Q0D A;  1TSL A;  4XSE A;  5H3A A;  5HS3 A;  1AXW A;  1VZD A;  3H9K A;  4GD7 A;  4EZ8 A;  4TMS A;  1F4C A;  3IRO A;  1TDU A;  1AOB A;  2G8X A;  3DG8 C;  1BKO A;  1J3J C;  3BNZ A;  1TYS A;  4KPW A;  4UP1 A;  3GH2 X;  3EJL A;  2G8D A;  2RDA A;  3BGX A;  1KZJ A;  1FFL A;  1SYN A;  1HW4 A;  3EHI X;  3EBU A;  1BKP A;  4EIN A;  2AAZ A;  1TSN A;  4KYA A;  2RD8 A;  3OB7 A;  3ED7 A;  3N5E B;  1TVV A;  4E5O A;  4FOA A;  4FGT A;  1BO8 A;  1TJS A;  2RD8 B;  2FTQ A;  1KZI A;  3HB8 A;  1BO7 A;  1HW3 A;  2VF0 A;  4IQQ A;  2H2Q A;  1JMG A;  1NJC A;  4Q0E A;  3IHI A;  1TVU A;  4ISK A;  1RTS A;  3EDW X;  3JSU A;  1F4E A;  4PSG A;  1HVY A;  4FOG A;  3EF9 A;  1JMF A;  1ZPR A;  3IK0 A;  4F2V A;  1TVW A;  3QG2 A;  3BFI A;  4DPH A;  3TMS A;  1VZE A;  1NCE A;  1JG0 A;  4H0U A;  2OIP A;  1TSM A;  2FTN A;  3BYX A;  3DL6 A;  3CL9 A;  1BSP A;  3C06 A;  1VZA A;  3UWL A;  3B5B A;  1J3I C;  1F4D A;  3HJ3 A;  3KJS A;  4GEV A;  4O1U A;  1EVF A;  3UWL B;  1THY A;  1BSF A;  3N5E A;  4KNZ A;  3KJR A;  2FTO X;  1TRG A;  2ONB A;  3DGA C;  3I3R A;  3INV A;  4ISW A;  5H38 A;  1TSD A;  1JMH A;  3C0A A;  1BPJ A;  1B5E A;  1QQQ A;  1JUJ A;  1BQ2 A;  3N5G A;  1TIS A;  1BJG A;  1I00 A;  3KGB A;  2G89 A;  3GG5 A;  1J3K C;  3UM6 A;  1AN5 A;  4EB4 A;  4ECK A;  1JTQ A;  3BZ0 A;  4KY4 A;  1TLS A;  1AIQ A;  1TSX A;  1KCE A;  4LRR A;  1TSW A;  2VET A;  4FOX A;  4G6W X;  4O1X A;  4XSD A;  1B02 A;  1F28 A;  1B5D A;  1FWM A;  2G86 A;  4GYH A;  5FCT A;  5H39 A;  1BID A;  1NJE A;  1TDB A;  4DQ1 A;  3QJ7 A;  1BP0 A;  1F4B A; 
#chains in the Genus database with same CATH homology
 1JTU A;  3EAW X;  1SEJ A;  2TDD A;  1QZF A;  1B49 A;  1NJD A;  1LCA A;  3K2H A;  1BDU A;  3EGY X;  4JEF A;  2TDM A;  4G2O X;  5WRN A;  3IRN A;  4H1I A;  4FQS A;  4XSC A;  2G8A A;  1TDC A;  3BHR A;  1DNA A;  1EV8 A;  4DPD A;  4EIL A;  1AJM A;  3QGT A;  1F4G A;  4IQB A;  4KY8 A;  3IJZ A;  3UM8 A;  1HZW A;  1TSV A;  1LCB A;  3NRR A;  4IRR A;  1F4F A;  1LCE A;  1VZB A;  4O7U A;  1JMI A;  1VZC A;  1JUT A;  1TSY A;  4O1X D;  1EV5 A;  2TSR A;  3BHL A;  2TSC A;  1CI7 A;  4DP3 A;  2KCE A;  3GH0 A;  1BP6 A;  1TSZ A;  3V8H A;  1TDA A;  1EVG A;  1YPV A;  3B9H A;  5BY6 A;  2BBQ A;  3IX6 A;  1JU6 A;  4E28 A;  1BQ1 A;  1TLC A;  1NJB A;  5J7W A;  3IRM A;  1DDU A;  3CLB A;  3DL5 A;  1NJA A;  3HBB A;  3IK1 A;  3UM5 A;  4H0R A;  2A9W A;  4Q0D A;  1TSL A;  4XSE A;  5H3A A;  5HS3 A;  1AXW A;  1VZD A;  3H9K A;  4GD7 A;  4EZ8 A;  4TMS A;  1F4C A;  3IRO A;  1TDU A;  1AOB A;  2G8X A;  3DG8 C;  1BKO A;  1J3J C;  3BNZ A;  1TYS A;  4KPW A;  4UP1 A;  3GH2 X;  3EJL A;  2G8D A;  2RDA A;  3BGX A;  1KZJ A;  1FFL A;  1SYN A;  1HW4 A;  3EHI X;  3EBU A;  1BKP A;  4EIN A;  2AAZ A;  1TSN A;  4KYA A;  2RD8 A;  3OB7 A;  3ED7 A;  3N5E B;  1TVV A;  4E5O A;  4FOA A;  4FGT A;  1BO8 A;  1TJS A;  2RD8 B;  2FTQ A;  1KZI A;  3HB8 A;  1BO7 A;  1HW3 A;  2VF0 A;  4IQQ A;  2H2Q A;  1JMG A;  1NJC A;  4Q0E A;  3IHI A;  1TVU A;  4ISK A;  1RTS A;  3EDW X;  3JSU A;  1F4E A;  4PSG A;  1HVY A;  4FOG A;  3EF9 A;  1JMF A;  1ZPR A;  3IK0 A;  4F2V A;  1TVW A;  3QG2 A;  3BFI A;  4DPH A;  3TMS A;  1VZE A;  1NCE A;  1JG0 A;  4H0U A;  2OIP A;  1TSM A;  2FTN A;  3BYX A;  3DL6 A;  3CL9 A;  1BSP A;  3C06 A;  1VZA A;  3UWL A;  3B5B A;  1J3I C;  1F4D A;  3HJ3 A;  3KJS A;  4GEV A;  4O1U A;  1EVF A;  3UWL B;  1THY A;  1BSF A;  3N5E A;  4KNZ A;  3KJR A;  2FTO X;  1TRG A;  2ONB A;  3DGA C;  3I3R A;  3INV A;  4ISW A;  5H38 A;  1TSD A;  1JMH A;  3C0A A;  1BPJ A;  1B5E A;  1QQQ A;  1JUJ A;  1BQ2 A;  3N5G A;  1TIS A;  1BJG A;  1I00 A;  3KGB A;  2G89 A;  3GG5 A;  1J3K C;  3UM6 A;  1AN5 A;  4EB4 A;  4ECK A;  1JTQ A;  3BZ0 A;  4KY4 A;  1TLS A;  1AIQ A;  1TSX A;  1KCE A;  4LRR A;  1TSW A;  2VET A;  4FOX A;  4G6W X;  4O1X A;  4XSD A;  1B02 A;  1F28 A;  1B5D A;  1FWM A;  2G86 A;  4GYH A;  5FCT A;  5H39 A;  1BID A;  1NJE A;  1TDB A;  4DQ1 A;  3QJ7 A;  1BP0 A;  1F4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...