4LRRA

Ternary complex between e. coli thymidylate synthase, dump, and f9
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
264
structure length
263
Chain Sequence
MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase
publication title 2'-Deoxyuridine 5'-Monophosphate Substrate Displacement in Thymidylate Synthase through 6-Hydroxy-2H-naphtho[1,8-bc]furan-2-one Derivatives.
pubmed doi rcsb
source organism Escherichia coli
total genus 83
structure length 263
sequence length 264
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2013-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4lrrA00
1JG0A 1BP0A 1F4CA 1J3JC 1JMHA 1CI7A 1TVUA 1EVFA 1J3KC 3KGBA 1EV5A 3IHIA 1NJBA 3UWLB 3INVA 1AXWA 4KY8A 2FTNA 4DP3A 1BDUA 1NJDA 3K2HA 1BSFA 1TISA 1FFLA 2A9WA 1TSWA 3IK1A 4KY4A 3V8HA 4JEFA 1SYNA 4Q0DA 2H2QA 3DL6A 3UWLA 1AJMA 1JMFA 1TLSA 1TSXA 2RD8B 3EDWX 2VF0A 3EJLA 1TVVA 4FGTA 3BHLA 3C0AA 4EINA 1TDCA 3IRMA 1HW4A 3BYXA 1TSNA 3EBUA 3GH0A 4O7UA 1DDUA 3JSUA 2RD8A 1J3IC 2TSCA 2ONBA 3N5GA 5WRNA 1JMGA 1B49A 4O1XD 3B5BA 4H1IA 4EB4A 1VZCA 4FQSA 1ZPRA 3IK0A 4DPDA 1F28A 1EVGA 1FWMA 3CLBA 1BKPA 3IROA 1F4DA 2TDDA 3HB8A 5H3AA 2FTOX 3IJZA 4FOAA 3TMSA 4EZ8A 2G8DA 1BJGA 1JMIA 1JTQA 1BP6A 4FOGA 1NJCA 1TSDA 4O1UA 3I3RA 4ECKA 1TVWA 4LRRA 4DPHA 1QZFA 3EAWX 1NJEA 4H0RA 3BFIA 1HVYA 5BY6A 1LCBA 3DG8C 1AOBA 1TLCA 1TSLA 1BQ2A 1TRGA 3GG5A 4GD7A 1F4GA 1NCEA 2KCEA 3H9KA 1DNAA 2VETA 1RTSA 1VZBA 4TMSA 3ED7A 2G89A 4PSGA 1BKOA 3HBBA 1TSVA 1B5EA 1LCAA 1TSZA 4XSCA 4F2VA 1KCEA 1VZEA 1AIQA 4KPWA 2G86A 3OB7A 3EGYX 1THYA 1JU6A 1VZAA 3QJ7A 3BGXA 4E28A 1TSMA 1TYSA 3KJSA 4GYHA 1B02A 3QG2A 5FCTA 4DQ1A 4KNZA 2OIPA 5J7WA 3IRNA 4IRRA 3C06A 3N5EB 1I00A 4IQBA 4IQQA 1NJAA 4ISKA 3HJ3A 3NRRA 4UP1A 1TDAA 2AAZA 3N5EA 1TDUA 2TSRA 4XSEA 1EV8A 3IX6A 1BPJA 1KZIA 3BNZA 3BZ0A 1BO8A 3CL9A 3EF9A 3QGTA 4FOXA 5HS3A 3DL5A 3UM8A 1JUTA 1BO7A 1BSPA 1LCEA 1F4EA 4XSDA 5H39A 2BBQA 1TDBA 1JUJA 1QQQA 4KYAA 3BHRA 4G2OX 5H38A 4E5OA 1B5DA 2TDMA 3KJRA 1SEJA 1YPVA 3EHIX 4O1XA 4EILA 1HZWA 2FTQA 1TSYA 1VZDA 2RDAA 1BQ1A 2G8AA 4ISWA 3UM6A 3UM5A 4GEVA 1JTUA 1HW3A 1F4FA 3GH2X 1AN5A 4G6WX 2G8XA 1F4BA 4H0UA 3DGAC 4Q0EA 3B9HA 1TJSA 1KZJA 1BIDA
chains in the Genus database with same CATH superfamily
1JG0A 1BP0A 1F4CA 1J3JC 1JMHA 1CI7A 1TVUA 1EVFA 1J3KC 3KGBA 1EV5A 3IHIA 1NJBA 3UWLB 3INVA 1AXWA 4KY8A 2FTNA 4DP3A 1BDUA 1NJDA 3K2HA 1BSFA 1TISA 1FFLA 2A9WA 1TSWA 3IK1A 4KY4A 3V8HA 4JEFA 1SYNA 4Q0DA 2H2QA 3DL6A 3UWLA 1AJMA 1JMFA 1TLSA 1TSXA 2RD8B 3EDWX 2VF0A 3EJLA 1TVVA 4FGTA 3BHLA 3C0AA 4EINA 1TDCA 3IRMA 1HW4A 3BYXA 1TSNA 3EBUA 3GH0A 4O7UA 1DDUA 3JSUA 2RD8A 1J3IC 2TSCA 2ONBA 3N5GA 5WRNA 1JMGA 1B49A 4O1XD 3B5BA 4H1IA 4EB4A 1VZCA 4FQSA 1ZPRA 3IK0A 4DPDA 1F28A 1EVGA 1FWMA 3CLBA 1BKPA 3IROA 1F4DA 2TDDA 3HB8A 5H3AA 2FTOX 3IJZA 4FOAA 3TMSA 4EZ8A 2G8DA 1BJGA 1JMIA 1JTQA 1BP6A 4FOGA 1NJCA 1TSDA 4O1UA 3I3RA 4ECKA 1TVWA 4LRRA 4DPHA 1QZFA 3EAWX 1NJEA 4H0RA 3BFIA 1HVYA 5BY6A 1LCBA 3DG8C 1AOBA 1TLCA 1TSLA 1BQ2A 1TRGA 3GG5A 4GD7A 1F4GA 1NCEA 2KCEA 3H9KA 1DNAA 2VETA 1RTSA 1VZBA 4TMSA 3ED7A 2G89A 4PSGA 1BKOA 3HBBA 1TSVA 1B5EA 1LCAA 1TSZA 4XSCA 4F2VA 1KCEA 1VZEA 1AIQA 4KPWA 2G86A 3OB7A 3EGYX 1THYA 1JU6A 1VZAA 3QJ7A 3BGXA 4E28A 1TSMA 1TYSA 3KJSA 4GYHA 1B02A 3QG2A 5FCTA 4DQ1A 4KNZA 2OIPA 5J7WA 3IRNA 4IRRA 3C06A 3N5EB 1I00A 4IQBA 4IQQA 1NJAA 4ISKA 3HJ3A 3NRRA 4UP1A 1TDAA 2AAZA 3N5EA 1TDUA 2TSRA 4XSEA 1EV8A 3IX6A 1BPJA 1KZIA 3BNZA 3BZ0A 1BO8A 3CL9A 3EF9A 3QGTA 4FOXA 5HS3A 3DL5A 3UM8A 1JUTA 1BO7A 1BSPA 1LCEA 1F4EA 4XSDA 5H39A 2BBQA 1TDBA 1JUJA 1QQQA 4KYAA 3BHRA 4G2OX 5H38A 4E5OA 1B5DA 2TDMA 3KJRA 1SEJA 1YPVA 3EHIX 4O1XA 4EILA 1HZWA 2FTQA 1TSYA 1VZDA 2RDAA 1BQ1A 2G8AA 4ISWA 3UM6A 3UM5A 4GEVA 1JTUA 1HW3A 1F4FA 3GH2X 1AN5A 4G6WX 2G8XA 1F4BA 4H0UA 3DGAC 4Q0EA 3B9HA 1TJSA 1KZJA 1BIDA
chains in the Genus database with same CATH topology
1JG0A 1BP0A 1F4CA 1J3JC 1JMHA 1CI7A 1TVUA 1EVFA 1J3KC 3KGBA 1EV5A 3IHIA 1NJBA 3UWLB 3INVA 1AXWA 4KY8A 2FTNA 4DP3A 1BDUA 1NJDA 3K2HA 1BSFA 1TISA 1FFLA 2A9WA 1TSWA 3IK1A 4KY4A 3V8HA 4JEFA 1SYNA 4Q0DA 2H2QA 3DL6A 3UWLA 1AJMA 1JMFA 1TLSA 1TSXA 2RD8B 3EDWX 2VF0A 3EJLA 1TVVA 4FGTA 3BHLA 3C0AA 4EINA 1TDCA 3IRMA 1HW4A 3BYXA 1TSNA 3EBUA 3GH0A 4O7UA 1DDUA 3JSUA 2RD8A 1J3IC 2TSCA 2ONBA 3N5GA 5WRNA 1JMGA 1B49A 4O1XD 3B5BA 4H1IA 4EB4A 1VZCA 4FQSA 1ZPRA 3IK0A 4DPDA 1F28A 1EVGA 1FWMA 3CLBA 1BKPA 3IROA 1F4DA 2TDDA 3HB8A 5H3AA 2FTOX 3IJZA 4FOAA 3TMSA 4EZ8A 2G8DA 1BJGA 1JMIA 1JTQA 1BP6A 4FOGA 1NJCA 1TSDA 4O1UA 3I3RA 4ECKA 1TVWA 4LRRA 4DPHA 1QZFA 3EAWX 1NJEA 4H0RA 3BFIA 1HVYA 5BY6A 1LCBA 3DG8C 1AOBA 1TLCA 1TSLA 1BQ2A 1TRGA 3GG5A 4GD7A 1F4GA 1NCEA 2KCEA 3H9KA 1DNAA 2VETA 1RTSA 1VZBA 4TMSA 3ED7A 2G89A 4PSGA 1BKOA 3HBBA 1TSVA 1B5EA 1LCAA 1TSZA 4XSCA 4F2VA 1KCEA 1VZEA 1AIQA 4KPWA 2G86A 3OB7A 3EGYX 1THYA 1JU6A 1VZAA 3QJ7A 3BGXA 4E28A 1TSMA 1TYSA 3KJSA 4GYHA 1B02A 3QG2A 5FCTA 4DQ1A 4KNZA 2OIPA 5J7WA 3IRNA 4IRRA 3C06A 3N5EB 1I00A 4IQBA 4IQQA 1NJAA 4ISKA 3HJ3A 3NRRA 4UP1A 1TDAA 2AAZA 3N5EA 1TDUA 2TSRA 4XSEA 1EV8A 3IX6A 1BPJA 1KZIA 3BNZA 3BZ0A 1BO8A 3CL9A 3EF9A 3QGTA 4FOXA 5HS3A 3DL5A 3UM8A 1JUTA 1BO7A 1BSPA 1LCEA 1F4EA 4XSDA 5H39A 2BBQA 1TDBA 1JUJA 1QQQA 4KYAA 3BHRA 4G2OX 5H38A 4E5OA 1B5DA 2TDMA 3KJRA 1SEJA 1YPVA 3EHIX 4O1XA 4EILA 1HZWA 2FTQA 1TSYA 1VZDA 2RDAA 1BQ1A 2G8AA 4ISWA 3UM6A 3UM5A 4GEVA 1JTUA 1HW3A 1F4FA 3GH2X 1AN5A 4G6WX 2G8XA 1F4BA 4H0UA 3DGAC 4Q0EA 3B9HA 1TJSA 1KZJA 1BIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JG0 A;  1BP0 A;  1F4C A;  1J3J C;  1JMH A;  1CI7 A;  1TVU A;  1EVF A;  1J3K C;  3KGB A;  1EV5 A;  3IHI A;  1NJB A;  3UWL B;  3INV A;  1AXW A;  4KY8 A;  2FTN A;  4DP3 A;  1BDU A;  1NJD A;  3K2H A;  1BSF A;  1TIS A;  1FFL A;  2A9W A;  1TSW A;  3IK1 A;  4KY4 A;  3V8H A;  4JEF A;  1SYN A;  4Q0D A;  2H2Q A;  3DL6 A;  3UWL A;  1AJM A;  1JMF A;  1TLS A;  1TSX A;  2RD8 B;  3EDW X;  2VF0 A;  3EJL A;  1TVV A;  4FGT A;  3BHL A;  3C0A A;  4EIN A;  1TDC A;  3IRM A;  1HW4 A;  3BYX A;  1TSN A;  3EBU A;  3GH0 A;  4O7U A;  1DDU A;  3JSU A;  2RD8 A;  1J3I C;  2TSC A;  2ONB A;  3N5G A;  5WRN A;  1JMG A;  1B49 A;  4O1X D;  3B5B A;  4H1I A;  4EB4 A;  1VZC A;  4FQS A;  1ZPR A;  3IK0 A;  4DPD A;  1F28 A;  1EVG A;  1FWM A;  3CLB A;  1BKP A;  3IRO A;  1F4D A;  2TDD A;  3HB8 A;  5H3A A;  2FTO X;  3IJZ A;  4FOA A;  3TMS A;  4EZ8 A;  2G8D A;  1BJG A;  1JMI A;  1JTQ A;  1BP6 A;  4FOG A;  1NJC A;  1TSD A;  4O1U A;  3I3R A;  4ECK A;  1TVW A;  4LRR A;  4DPH A;  1QZF A;  3EAW X;  1NJE A;  4H0R A;  3BFI A;  1HVY A;  5BY6 A;  1LCB A;  3DG8 C;  1AOB A;  1TLC A;  1TSL A;  1BQ2 A;  1TRG A;  3GG5 A;  4GD7 A;  1F4G A;  1NCE A;  2KCE A;  3H9K A;  1DNA A;  2VET A;  1RTS A;  1VZB A;  4TMS A;  3ED7 A;  2G89 A;  4PSG A;  1BKO A;  3HBB A;  1TSV A;  1B5E A;  1LCA A;  1TSZ A;  4XSC A;  4F2V A;  1KCE A;  1VZE A;  1AIQ A;  4KPW A;  2G86 A;  3OB7 A;  3EGY X;  1THY A;  1JU6 A;  1VZA A;  3QJ7 A;  3BGX A;  4E28 A;  1TSM A;  1TYS A;  3KJS A;  4GYH A;  1B02 A;  3QG2 A;  5FCT A;  4DQ1 A;  4KNZ A;  2OIP A;  5J7W A;  3IRN A;  4IRR A;  3C06 A;  3N5E B;  1I00 A;  4IQB A;  4IQQ A;  1NJA A;  4ISK A;  3HJ3 A;  3NRR A;  4UP1 A;  1TDA A;  2AAZ A;  3N5E A;  1TDU A;  2TSR A;  4XSE A;  1EV8 A;  3IX6 A;  1BPJ A;  1KZI A;  3BNZ A;  3BZ0 A;  1BO8 A;  3CL9 A;  3EF9 A;  3QGT A;  4FOX A;  5HS3 A;  3DL5 A;  3UM8 A;  1JUT A;  1BO7 A;  1BSP A;  1LCE A;  1F4E A;  4XSD A;  5H39 A;  2BBQ A;  1TDB A;  1JUJ A;  1QQQ A;  4KYA A;  3BHR A;  4G2O X;  5H38 A;  4E5O A;  1B5D A;  2TDM A;  3KJR A;  1SEJ A;  1YPV A;  3EHI X;  4O1X A;  4EIL A;  1HZW A;  2FTQ A;  1TSY A;  1VZD A;  2RDA A;  1BQ1 A;  2G8A A;  4ISW A;  3UM6 A;  3UM5 A;  4GEV A;  1JTU A;  1HW3 A;  1F4F A;  3GH2 X;  1AN5 A;  4G6W X;  2G8X A;  1F4B A;  4H0U A;  3DGA C;  4Q0E A;  3B9H A;  1TJS A;  1KZJ A;  1BID A; 
#chains in the Genus database with same CATH topology
 1JG0 A;  1BP0 A;  1F4C A;  1J3J C;  1JMH A;  1CI7 A;  1TVU A;  1EVF A;  1J3K C;  3KGB A;  1EV5 A;  3IHI A;  1NJB A;  3UWL B;  3INV A;  1AXW A;  4KY8 A;  2FTN A;  4DP3 A;  1BDU A;  1NJD A;  3K2H A;  1BSF A;  1TIS A;  1FFL A;  2A9W A;  1TSW A;  3IK1 A;  4KY4 A;  3V8H A;  4JEF A;  1SYN A;  4Q0D A;  2H2Q A;  3DL6 A;  3UWL A;  1AJM A;  1JMF A;  1TLS A;  1TSX A;  2RD8 B;  3EDW X;  2VF0 A;  3EJL A;  1TVV A;  4FGT A;  3BHL A;  3C0A A;  4EIN A;  1TDC A;  3IRM A;  1HW4 A;  3BYX A;  1TSN A;  3EBU A;  3GH0 A;  4O7U A;  1DDU A;  3JSU A;  2RD8 A;  1J3I C;  2TSC A;  2ONB A;  3N5G A;  5WRN A;  1JMG A;  1B49 A;  4O1X D;  3B5B A;  4H1I A;  4EB4 A;  1VZC A;  4FQS A;  1ZPR A;  3IK0 A;  4DPD A;  1F28 A;  1EVG A;  1FWM A;  3CLB A;  1BKP A;  3IRO A;  1F4D A;  2TDD A;  3HB8 A;  5H3A A;  2FTO X;  3IJZ A;  4FOA A;  3TMS A;  4EZ8 A;  2G8D A;  1BJG A;  1JMI A;  1JTQ A;  1BP6 A;  4FOG A;  1NJC A;  1TSD A;  4O1U A;  3I3R A;  4ECK A;  1TVW A;  4LRR A;  4DPH A;  1QZF A;  3EAW X;  1NJE A;  4H0R A;  3BFI A;  1HVY A;  5BY6 A;  1LCB A;  3DG8 C;  1AOB A;  1TLC A;  1TSL A;  1BQ2 A;  1TRG A;  3GG5 A;  4GD7 A;  1F4G A;  1NCE A;  2KCE A;  3H9K A;  1DNA A;  2VET A;  1RTS A;  1VZB A;  4TMS A;  3ED7 A;  2G89 A;  4PSG A;  1BKO A;  3HBB A;  1TSV A;  1B5E A;  1LCA A;  1TSZ A;  4XSC A;  4F2V A;  1KCE A;  1VZE A;  1AIQ A;  4KPW A;  2G86 A;  3OB7 A;  3EGY X;  1THY A;  1JU6 A;  1VZA A;  3QJ7 A;  3BGX A;  4E28 A;  1TSM A;  1TYS A;  3KJS A;  4GYH A;  1B02 A;  3QG2 A;  5FCT A;  4DQ1 A;  4KNZ A;  2OIP A;  5J7W A;  3IRN A;  4IRR A;  3C06 A;  3N5E B;  1I00 A;  4IQB A;  4IQQ A;  1NJA A;  4ISK A;  3HJ3 A;  3NRR A;  4UP1 A;  1TDA A;  2AAZ A;  3N5E A;  1TDU A;  2TSR A;  4XSE A;  1EV8 A;  3IX6 A;  1BPJ A;  1KZI A;  3BNZ A;  3BZ0 A;  1BO8 A;  3CL9 A;  3EF9 A;  3QGT A;  4FOX A;  5HS3 A;  3DL5 A;  3UM8 A;  1JUT A;  1BO7 A;  1BSP A;  1LCE A;  1F4E A;  4XSD A;  5H39 A;  2BBQ A;  1TDB A;  1JUJ A;  1QQQ A;  4KYA A;  3BHR A;  4G2O X;  5H38 A;  4E5O A;  1B5D A;  2TDM A;  3KJR A;  1SEJ A;  1YPV A;  3EHI X;  4O1X A;  4EIL A;  1HZW A;  2FTQ A;  1TSY A;  1VZD A;  2RDA A;  1BQ1 A;  2G8A A;  4ISW A;  3UM6 A;  3UM5 A;  4GEV A;  1JTU A;  1HW3 A;  1F4F A;  3GH2 X;  1AN5 A;  4G6W X;  2G8X A;  1F4B A;  4H0U A;  3DGA C;  4Q0E A;  3B9H A;  1TJS A;  1KZJ A;  1BID A; 
#chains in the Genus database with same CATH homology
 1JG0 A;  1BP0 A;  1F4C A;  1J3J C;  1JMH A;  1CI7 A;  1TVU A;  1EVF A;  1J3K C;  3KGB A;  1EV5 A;  3IHI A;  1NJB A;  3UWL B;  3INV A;  1AXW A;  4KY8 A;  2FTN A;  4DP3 A;  1BDU A;  1NJD A;  3K2H A;  1BSF A;  1TIS A;  1FFL A;  2A9W A;  1TSW A;  3IK1 A;  4KY4 A;  3V8H A;  4JEF A;  1SYN A;  4Q0D A;  2H2Q A;  3DL6 A;  3UWL A;  1AJM A;  1JMF A;  1TLS A;  1TSX A;  2RD8 B;  3EDW X;  2VF0 A;  3EJL A;  1TVV A;  4FGT A;  3BHL A;  3C0A A;  4EIN A;  1TDC A;  3IRM A;  1HW4 A;  3BYX A;  1TSN A;  3EBU A;  3GH0 A;  4O7U A;  1DDU A;  3JSU A;  2RD8 A;  1J3I C;  2TSC A;  2ONB A;  3N5G A;  5WRN A;  1JMG A;  1B49 A;  4O1X D;  3B5B A;  4H1I A;  4EB4 A;  1VZC A;  4FQS A;  1ZPR A;  3IK0 A;  4DPD A;  1F28 A;  1EVG A;  1FWM A;  3CLB A;  1BKP A;  3IRO A;  1F4D A;  2TDD A;  3HB8 A;  5H3A A;  2FTO X;  3IJZ A;  4FOA A;  3TMS A;  4EZ8 A;  2G8D A;  1BJG A;  1JMI A;  1JTQ A;  1BP6 A;  4FOG A;  1NJC A;  1TSD A;  4O1U A;  3I3R A;  4ECK A;  1TVW A;  4LRR A;  4DPH A;  1QZF A;  3EAW X;  1NJE A;  4H0R A;  3BFI A;  1HVY A;  5BY6 A;  1LCB A;  3DG8 C;  1AOB A;  1TLC A;  1TSL A;  1BQ2 A;  1TRG A;  3GG5 A;  4GD7 A;  1F4G A;  1NCE A;  2KCE A;  3H9K A;  1DNA A;  2VET A;  1RTS A;  1VZB A;  4TMS A;  3ED7 A;  2G89 A;  4PSG A;  1BKO A;  3HBB A;  1TSV A;  1B5E A;  1LCA A;  1TSZ A;  4XSC A;  4F2V A;  1KCE A;  1VZE A;  1AIQ A;  4KPW A;  2G86 A;  3OB7 A;  3EGY X;  1THY A;  1JU6 A;  1VZA A;  3QJ7 A;  3BGX A;  4E28 A;  1TSM A;  1TYS A;  3KJS A;  4GYH A;  1B02 A;  3QG2 A;  5FCT A;  4DQ1 A;  4KNZ A;  2OIP A;  5J7W A;  3IRN A;  4IRR A;  3C06 A;  3N5E B;  1I00 A;  4IQB A;  4IQQ A;  1NJA A;  4ISK A;  3HJ3 A;  3NRR A;  4UP1 A;  1TDA A;  2AAZ A;  3N5E A;  1TDU A;  2TSR A;  4XSE A;  1EV8 A;  3IX6 A;  1BPJ A;  1KZI A;  3BNZ A;  3BZ0 A;  1BO8 A;  3CL9 A;  3EF9 A;  3QGT A;  4FOX A;  5HS3 A;  3DL5 A;  3UM8 A;  1JUT A;  1BO7 A;  1BSP A;  1LCE A;  1F4E A;  4XSD A;  5H39 A;  2BBQ A;  1TDB A;  1JUJ A;  1QQQ A;  4KYA A;  3BHR A;  4G2O X;  5H38 A;  4E5O A;  1B5D A;  2TDM A;  3KJR A;  1SEJ A;  1YPV A;  3EHI X;  4O1X A;  4EIL A;  1HZW A;  2FTQ A;  1TSY A;  1VZD A;  2RDA A;  1BQ1 A;  2G8A A;  4ISW A;  3UM6 A;  3UM5 A;  4GEV A;  1JTU A;  1HW3 A;  1F4F A;  3GH2 X;  1AN5 A;  4G6W X;  2G8X A;  1F4B A;  4H0U A;  3DGA C;  4Q0E A;  3B9H A;  1TJS A;  1KZJ A;  1BID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...