4O1UA

Crystal structure of human thymidylate synthase mutant y202c
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
284
structure length
257
Chain Sequence
PHGELQYLGQIQHILRGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMAWNPRDLPLMALPPHALQFVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase
publication title Tethering the dimer-dimer interface of human thymidylate synthase
rcsb
source organism Homo sapiens
total genus 72
structure length 257
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4o1uA00
3B9HA 3N5EA 4KY8A 1TRGA 2A9WA 3KJSA 4ISKA 1TSYA 4EB4A 1F4DA 3DG8C 1J3IC 1JUTA 1EVFA 1BQ2A 4PSGA 1VZCA 1NJDA 1BKOA 1J3KC 4KYAA 3DL6A 4KNZA 1TYSA 2BBQA 2OIPA 4EZ8A 4E28A 1SEJA 3CL9A 2G8DA 1F4BA 1F4GA 3UM6A 3B5BA 1VZAA 2TSCA 1LCBA 1TLSA 3EBUA 5J7WA 1FFLA 1DDUA 3QJ7A 1LCEA 2AAZA 4O1UA 2VETA 3K2HA 1YPVA 3BHRA 1JUJA 3IHIA 3EJLA 3KGBA 4GEVA 5H38A 1TVVA 1B49A 1JU6A 1AIQA 1TVUA 1F28A 3BNZA 2ONBA 4O1XA 1CI7A 3IK0A 5HS3A 4DP3A 4KPWA 1BP0A 1F4FA 3I3RA 1J3JC 1AOBA 1TSXA 1BPJA 3BFIA 1KCEA 3IX6A 3N5EB 1HW3A 3BZ0A 2H2QA 1EVGA 1TISA 3IRMA 4IRRA 4XSDA 1QZFA 5H3AA 3N5GA 3HB8A 1JTQA 1BP6A 1AXWA 2FTNA 4Q0DA 1B02A 1BKPA 2G86A 3UWLA 4IQQA 3QG2A 1TSZA 1HVYA 3HJ3A 4EINA 1DNAA 3C0AA 5BY6A 1JTUA 2FTOX 4H1IA 1ZPRA 3JSUA 4GYHA 4ECKA 1TDBA 3GH2X 4Q0EA 1JG0A 2TDMA 5FCTA 1VZBA 3CLBA 4UP1A 3GH0A 1JMHA 4G6WX 2TSRA 3BGXA 1AJMA 1BIDA 1F4CA 3DL5A 1NJAA 3EDWX 3ED7A 3IJZA 3IROA 3OB7A 4O1XD 4O7UA 3TMSA 4E5OA 4G2OX 2TDDA 4GD7A 3H9KA 1EV8A 1TDAA 1BDUA 4FOAA 1FWMA 1TSLA 4H0RA 4XSEA 2VF0A 3EAWX 1BO7A 3IK1A 1BSPA 3UM8A 1TSDA 5WRNA 1LCAA 4KY4A 1TJSA 1VZEA 2G8XA 4FOGA 3IRNA 4TMSA 4JEFA 1RTSA 4F2VA 1HW4A 1VZDA 3BYXA 1TLCA 1NJCA 1TSNA 1HZWA 1TDCA 3HBBA 4DQ1A 4ISWA 3C06A 1JMGA 1KZIA 1TVWA 2KCEA 4LRRA 3UWLB 4DPHA 1BO8A 2FTQA 3EHIX 3UM5A 4H0UA 5H39A 1NJBA 1F4EA 1NJEA 1TSMA 2RD8A 4FGTA 1B5EA 3QGTA 4FQSA 3KJRA 2G8AA 3EGYX 1TDUA 1AN5A 1SYNA 1QQQA 4EILA 2G89A 3NRRA 1BJGA 1KZJA 1JMFA 4XSCA 3V8HA 4DPDA 4IQBA 1THYA 2RDAA 1BSFA 3EF9A 1I00A 4FOXA 1NCEA 1TSVA 1BQ1A 1B5DA 3INVA 1EV5A 2RD8B 3BHLA 3DGAC 3GG5A 1TSWA 1JMIA
chains in the Genus database with same CATH superfamily
3B9HA 3N5EA 4KY8A 1TRGA 2A9WA 3KJSA 4ISKA 1TSYA 4EB4A 1F4DA 3DG8C 1J3IC 1JUTA 1EVFA 1BQ2A 4PSGA 1VZCA 1NJDA 1BKOA 1J3KC 4KYAA 3DL6A 4KNZA 1TYSA 2BBQA 2OIPA 4EZ8A 4E28A 1SEJA 3CL9A 2G8DA 1F4BA 1F4GA 3UM6A 3B5BA 1VZAA 2TSCA 1LCBA 1TLSA 3EBUA 5J7WA 1FFLA 1DDUA 3QJ7A 1LCEA 2AAZA 4O1UA 2VETA 3K2HA 1YPVA 3BHRA 1JUJA 3IHIA 3EJLA 3KGBA 4GEVA 5H38A 1TVVA 1B49A 1JU6A 1AIQA 1TVUA 1F28A 3BNZA 2ONBA 4O1XA 1CI7A 3IK0A 5HS3A 4DP3A 4KPWA 1BP0A 1F4FA 3I3RA 1J3JC 1AOBA 1TSXA 1BPJA 3BFIA 1KCEA 3IX6A 3N5EB 1HW3A 3BZ0A 2H2QA 1EVGA 1TISA 3IRMA 4IRRA 4XSDA 1QZFA 5H3AA 3N5GA 3HB8A 1JTQA 1BP6A 1AXWA 2FTNA 4Q0DA 1B02A 1BKPA 2G86A 3UWLA 4IQQA 3QG2A 1TSZA 1HVYA 3HJ3A 4EINA 1DNAA 3C0AA 5BY6A 1JTUA 2FTOX 4H1IA 1ZPRA 3JSUA 4GYHA 4ECKA 1TDBA 3GH2X 4Q0EA 1JG0A 2TDMA 5FCTA 1VZBA 3CLBA 4UP1A 3GH0A 1JMHA 4G6WX 2TSRA 3BGXA 1AJMA 1BIDA 1F4CA 3DL5A 1NJAA 3EDWX 3ED7A 3IJZA 3IROA 3OB7A 4O1XD 4O7UA 3TMSA 4E5OA 4G2OX 2TDDA 4GD7A 3H9KA 1EV8A 1TDAA 1BDUA 4FOAA 1FWMA 1TSLA 4H0RA 4XSEA 2VF0A 3EAWX 1BO7A 3IK1A 1BSPA 3UM8A 1TSDA 5WRNA 1LCAA 4KY4A 1TJSA 1VZEA 2G8XA 4FOGA 3IRNA 4TMSA 4JEFA 1RTSA 4F2VA 1HW4A 1VZDA 3BYXA 1TLCA 1NJCA 1TSNA 1HZWA 1TDCA 3HBBA 4DQ1A 4ISWA 3C06A 1JMGA 1KZIA 1TVWA 2KCEA 4LRRA 3UWLB 4DPHA 1BO8A 2FTQA 3EHIX 3UM5A 4H0UA 5H39A 1NJBA 1F4EA 1NJEA 1TSMA 2RD8A 4FGTA 1B5EA 3QGTA 4FQSA 3KJRA 2G8AA 3EGYX 1TDUA 1AN5A 1SYNA 1QQQA 4EILA 2G89A 3NRRA 1BJGA 1KZJA 1JMFA 4XSCA 3V8HA 4DPDA 4IQBA 1THYA 2RDAA 1BSFA 3EF9A 1I00A 4FOXA 1NCEA 1TSVA 1BQ1A 1B5DA 3INVA 1EV5A 2RD8B 3BHLA 3DGAC 3GG5A 1TSWA 1JMIA
chains in the Genus database with same CATH topology
3B9HA 3N5EA 4KY8A 1TRGA 2A9WA 3KJSA 4ISKA 1TSYA 4EB4A 1F4DA 3DG8C 1J3IC 1JUTA 1EVFA 1BQ2A 4PSGA 1VZCA 1NJDA 1BKOA 1J3KC 4KYAA 3DL6A 4KNZA 1TYSA 2BBQA 2OIPA 4EZ8A 4E28A 1SEJA 3CL9A 2G8DA 1F4BA 1F4GA 3UM6A 3B5BA 1VZAA 2TSCA 1LCBA 1TLSA 3EBUA 5J7WA 1FFLA 1DDUA 3QJ7A 1LCEA 2AAZA 4O1UA 2VETA 3K2HA 1YPVA 3BHRA 1JUJA 3IHIA 3EJLA 3KGBA 4GEVA 5H38A 1TVVA 1B49A 1JU6A 1AIQA 1TVUA 1F28A 3BNZA 2ONBA 4O1XA 1CI7A 3IK0A 5HS3A 4DP3A 4KPWA 1BP0A 1F4FA 3I3RA 1J3JC 1AOBA 1TSXA 1BPJA 3BFIA 1KCEA 3IX6A 3N5EB 1HW3A 3BZ0A 2H2QA 1EVGA 1TISA 3IRMA 4IRRA 4XSDA 1QZFA 5H3AA 3N5GA 3HB8A 1JTQA 1BP6A 1AXWA 2FTNA 4Q0DA 1B02A 1BKPA 2G86A 3UWLA 4IQQA 3QG2A 1TSZA 1HVYA 3HJ3A 4EINA 1DNAA 3C0AA 5BY6A 1JTUA 2FTOX 4H1IA 1ZPRA 3JSUA 4GYHA 4ECKA 1TDBA 3GH2X 4Q0EA 1JG0A 2TDMA 5FCTA 1VZBA 3CLBA 4UP1A 3GH0A 1JMHA 4G6WX 2TSRA 3BGXA 1AJMA 1BIDA 1F4CA 3DL5A 1NJAA 3EDWX 3ED7A 3IJZA 3IROA 3OB7A 4O1XD 4O7UA 3TMSA 4E5OA 4G2OX 2TDDA 4GD7A 3H9KA 1EV8A 1TDAA 1BDUA 4FOAA 1FWMA 1TSLA 4H0RA 4XSEA 2VF0A 3EAWX 1BO7A 3IK1A 1BSPA 3UM8A 1TSDA 5WRNA 1LCAA 4KY4A 1TJSA 1VZEA 2G8XA 4FOGA 3IRNA 4TMSA 4JEFA 1RTSA 4F2VA 1HW4A 1VZDA 3BYXA 1TLCA 1NJCA 1TSNA 1HZWA 1TDCA 3HBBA 4DQ1A 4ISWA 3C06A 1JMGA 1KZIA 1TVWA 2KCEA 4LRRA 3UWLB 4DPHA 1BO8A 2FTQA 3EHIX 3UM5A 4H0UA 5H39A 1NJBA 1F4EA 1NJEA 1TSMA 2RD8A 4FGTA 1B5EA 3QGTA 4FQSA 3KJRA 2G8AA 3EGYX 1TDUA 1AN5A 1SYNA 1QQQA 4EILA 2G89A 3NRRA 1BJGA 1KZJA 1JMFA 4XSCA 3V8HA 4DPDA 4IQBA 1THYA 2RDAA 1BSFA 3EF9A 1I00A 4FOXA 1NCEA 1TSVA 1BQ1A 1B5DA 3INVA 1EV5A 2RD8B 3BHLA 3DGAC 3GG5A 1TSWA 1JMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B9H A;  3N5E A;  4KY8 A;  1TRG A;  2A9W A;  3KJS A;  4ISK A;  1TSY A;  4EB4 A;  1F4D A;  3DG8 C;  1J3I C;  1JUT A;  1EVF A;  1BQ2 A;  4PSG A;  1VZC A;  1NJD A;  1BKO A;  1J3K C;  4KYA A;  3DL6 A;  4KNZ A;  1TYS A;  2BBQ A;  2OIP A;  4EZ8 A;  4E28 A;  1SEJ A;  3CL9 A;  2G8D A;  1F4B A;  1F4G A;  3UM6 A;  3B5B A;  1VZA A;  2TSC A;  1LCB A;  1TLS A;  3EBU A;  5J7W A;  1FFL A;  1DDU A;  3QJ7 A;  1LCE A;  2AAZ A;  4O1U A;  2VET A;  3K2H A;  1YPV A;  3BHR A;  1JUJ A;  3IHI A;  3EJL A;  3KGB A;  4GEV A;  5H38 A;  1TVV A;  1B49 A;  1JU6 A;  1AIQ A;  1TVU A;  1F28 A;  3BNZ A;  2ONB A;  4O1X A;  1CI7 A;  3IK0 A;  5HS3 A;  4DP3 A;  4KPW A;  1BP0 A;  1F4F A;  3I3R A;  1J3J C;  1AOB A;  1TSX A;  1BPJ A;  3BFI A;  1KCE A;  3IX6 A;  3N5E B;  1HW3 A;  3BZ0 A;  2H2Q A;  1EVG A;  1TIS A;  3IRM A;  4IRR A;  4XSD A;  1QZF A;  5H3A A;  3N5G A;  3HB8 A;  1JTQ A;  1BP6 A;  1AXW A;  2FTN A;  4Q0D A;  1B02 A;  1BKP A;  2G86 A;  3UWL A;  4IQQ A;  3QG2 A;  1TSZ A;  1HVY A;  3HJ3 A;  4EIN A;  1DNA A;  3C0A A;  5BY6 A;  1JTU A;  2FTO X;  4H1I A;  1ZPR A;  3JSU A;  4GYH A;  4ECK A;  1TDB A;  3GH2 X;  4Q0E A;  1JG0 A;  2TDM A;  5FCT A;  1VZB A;  3CLB A;  4UP1 A;  3GH0 A;  1JMH A;  4G6W X;  2TSR A;  3BGX A;  1AJM A;  1BID A;  1F4C A;  3DL5 A;  1NJA A;  3EDW X;  3ED7 A;  3IJZ A;  3IRO A;  3OB7 A;  4O1X D;  4O7U A;  3TMS A;  4E5O A;  4G2O X;  2TDD A;  4GD7 A;  3H9K A;  1EV8 A;  1TDA A;  1BDU A;  4FOA A;  1FWM A;  1TSL A;  4H0R A;  4XSE A;  2VF0 A;  3EAW X;  1BO7 A;  3IK1 A;  1BSP A;  3UM8 A;  1TSD A;  5WRN A;  1LCA A;  4KY4 A;  1TJS A;  1VZE A;  2G8X A;  4FOG A;  3IRN A;  4TMS A;  4JEF A;  1RTS A;  4F2V A;  1HW4 A;  1VZD A;  3BYX A;  1TLC A;  1NJC A;  1TSN A;  1HZW A;  1TDC A;  3HBB A;  4DQ1 A;  4ISW A;  3C06 A;  1JMG A;  1KZI A;  1TVW A;  2KCE A;  4LRR A;  3UWL B;  4DPH A;  1BO8 A;  2FTQ A;  3EHI X;  3UM5 A;  4H0U A;  5H39 A;  1NJB A;  1F4E A;  1NJE A;  1TSM A;  2RD8 A;  4FGT A;  1B5E A;  3QGT A;  4FQS A;  3KJR A;  2G8A A;  3EGY X;  1TDU A;  1AN5 A;  1SYN A;  1QQQ A;  4EIL A;  2G89 A;  3NRR A;  1BJG A;  1KZJ A;  1JMF A;  4XSC A;  3V8H A;  4DPD A;  4IQB A;  1THY A;  2RDA A;  1BSF A;  3EF9 A;  1I00 A;  4FOX A;  1NCE A;  1TSV A;  1BQ1 A;  1B5D A;  3INV A;  1EV5 A;  2RD8 B;  3BHL A;  3DGA C;  3GG5 A;  1TSW A;  1JMI A; 
#chains in the Genus database with same CATH topology
 3B9H A;  3N5E A;  4KY8 A;  1TRG A;  2A9W A;  3KJS A;  4ISK A;  1TSY A;  4EB4 A;  1F4D A;  3DG8 C;  1J3I C;  1JUT A;  1EVF A;  1BQ2 A;  4PSG A;  1VZC A;  1NJD A;  1BKO A;  1J3K C;  4KYA A;  3DL6 A;  4KNZ A;  1TYS A;  2BBQ A;  2OIP A;  4EZ8 A;  4E28 A;  1SEJ A;  3CL9 A;  2G8D A;  1F4B A;  1F4G A;  3UM6 A;  3B5B A;  1VZA A;  2TSC A;  1LCB A;  1TLS A;  3EBU A;  5J7W A;  1FFL A;  1DDU A;  3QJ7 A;  1LCE A;  2AAZ A;  4O1U A;  2VET A;  3K2H A;  1YPV A;  3BHR A;  1JUJ A;  3IHI A;  3EJL A;  3KGB A;  4GEV A;  5H38 A;  1TVV A;  1B49 A;  1JU6 A;  1AIQ A;  1TVU A;  1F28 A;  3BNZ A;  2ONB A;  4O1X A;  1CI7 A;  3IK0 A;  5HS3 A;  4DP3 A;  4KPW A;  1BP0 A;  1F4F A;  3I3R A;  1J3J C;  1AOB A;  1TSX A;  1BPJ A;  3BFI A;  1KCE A;  3IX6 A;  3N5E B;  1HW3 A;  3BZ0 A;  2H2Q A;  1EVG A;  1TIS A;  3IRM A;  4IRR A;  4XSD A;  1QZF A;  5H3A A;  3N5G A;  3HB8 A;  1JTQ A;  1BP6 A;  1AXW A;  2FTN A;  4Q0D A;  1B02 A;  1BKP A;  2G86 A;  3UWL A;  4IQQ A;  3QG2 A;  1TSZ A;  1HVY A;  3HJ3 A;  4EIN A;  1DNA A;  3C0A A;  5BY6 A;  1JTU A;  2FTO X;  4H1I A;  1ZPR A;  3JSU A;  4GYH A;  4ECK A;  1TDB A;  3GH2 X;  4Q0E A;  1JG0 A;  2TDM A;  5FCT A;  1VZB A;  3CLB A;  4UP1 A;  3GH0 A;  1JMH A;  4G6W X;  2TSR A;  3BGX A;  1AJM A;  1BID A;  1F4C A;  3DL5 A;  1NJA A;  3EDW X;  3ED7 A;  3IJZ A;  3IRO A;  3OB7 A;  4O1X D;  4O7U A;  3TMS A;  4E5O A;  4G2O X;  2TDD A;  4GD7 A;  3H9K A;  1EV8 A;  1TDA A;  1BDU A;  4FOA A;  1FWM A;  1TSL A;  4H0R A;  4XSE A;  2VF0 A;  3EAW X;  1BO7 A;  3IK1 A;  1BSP A;  3UM8 A;  1TSD A;  5WRN A;  1LCA A;  4KY4 A;  1TJS A;  1VZE A;  2G8X A;  4FOG A;  3IRN A;  4TMS A;  4JEF A;  1RTS A;  4F2V A;  1HW4 A;  1VZD A;  3BYX A;  1TLC A;  1NJC A;  1TSN A;  1HZW A;  1TDC A;  3HBB A;  4DQ1 A;  4ISW A;  3C06 A;  1JMG A;  1KZI A;  1TVW A;  2KCE A;  4LRR A;  3UWL B;  4DPH A;  1BO8 A;  2FTQ A;  3EHI X;  3UM5 A;  4H0U A;  5H39 A;  1NJB A;  1F4E A;  1NJE A;  1TSM A;  2RD8 A;  4FGT A;  1B5E A;  3QGT A;  4FQS A;  3KJR A;  2G8A A;  3EGY X;  1TDU A;  1AN5 A;  1SYN A;  1QQQ A;  4EIL A;  2G89 A;  3NRR A;  1BJG A;  1KZJ A;  1JMF A;  4XSC A;  3V8H A;  4DPD A;  4IQB A;  1THY A;  2RDA A;  1BSF A;  3EF9 A;  1I00 A;  4FOX A;  1NCE A;  1TSV A;  1BQ1 A;  1B5D A;  3INV A;  1EV5 A;  2RD8 B;  3BHL A;  3DGA C;  3GG5 A;  1TSW A;  1JMI A; 
#chains in the Genus database with same CATH homology
 3B9H A;  3N5E A;  4KY8 A;  1TRG A;  2A9W A;  3KJS A;  4ISK A;  1TSY A;  4EB4 A;  1F4D A;  3DG8 C;  1J3I C;  1JUT A;  1EVF A;  1BQ2 A;  4PSG A;  1VZC A;  1NJD A;  1BKO A;  1J3K C;  4KYA A;  3DL6 A;  4KNZ A;  1TYS A;  2BBQ A;  2OIP A;  4EZ8 A;  4E28 A;  1SEJ A;  3CL9 A;  2G8D A;  1F4B A;  1F4G A;  3UM6 A;  3B5B A;  1VZA A;  2TSC A;  1LCB A;  1TLS A;  3EBU A;  5J7W A;  1FFL A;  1DDU A;  3QJ7 A;  1LCE A;  2AAZ A;  4O1U A;  2VET A;  3K2H A;  1YPV A;  3BHR A;  1JUJ A;  3IHI A;  3EJL A;  3KGB A;  4GEV A;  5H38 A;  1TVV A;  1B49 A;  1JU6 A;  1AIQ A;  1TVU A;  1F28 A;  3BNZ A;  2ONB A;  4O1X A;  1CI7 A;  3IK0 A;  5HS3 A;  4DP3 A;  4KPW A;  1BP0 A;  1F4F A;  3I3R A;  1J3J C;  1AOB A;  1TSX A;  1BPJ A;  3BFI A;  1KCE A;  3IX6 A;  3N5E B;  1HW3 A;  3BZ0 A;  2H2Q A;  1EVG A;  1TIS A;  3IRM A;  4IRR A;  4XSD A;  1QZF A;  5H3A A;  3N5G A;  3HB8 A;  1JTQ A;  1BP6 A;  1AXW A;  2FTN A;  4Q0D A;  1B02 A;  1BKP A;  2G86 A;  3UWL A;  4IQQ A;  3QG2 A;  1TSZ A;  1HVY A;  3HJ3 A;  4EIN A;  1DNA A;  3C0A A;  5BY6 A;  1JTU A;  2FTO X;  4H1I A;  1ZPR A;  3JSU A;  4GYH A;  4ECK A;  1TDB A;  3GH2 X;  4Q0E A;  1JG0 A;  2TDM A;  5FCT A;  1VZB A;  3CLB A;  4UP1 A;  3GH0 A;  1JMH A;  4G6W X;  2TSR A;  3BGX A;  1AJM A;  1BID A;  1F4C A;  3DL5 A;  1NJA A;  3EDW X;  3ED7 A;  3IJZ A;  3IRO A;  3OB7 A;  4O1X D;  4O7U A;  3TMS A;  4E5O A;  4G2O X;  2TDD A;  4GD7 A;  3H9K A;  1EV8 A;  1TDA A;  1BDU A;  4FOA A;  1FWM A;  1TSL A;  4H0R A;  4XSE A;  2VF0 A;  3EAW X;  1BO7 A;  3IK1 A;  1BSP A;  3UM8 A;  1TSD A;  5WRN A;  1LCA A;  4KY4 A;  1TJS A;  1VZE A;  2G8X A;  4FOG A;  3IRN A;  4TMS A;  4JEF A;  1RTS A;  4F2V A;  1HW4 A;  1VZD A;  3BYX A;  1TLC A;  1NJC A;  1TSN A;  1HZW A;  1TDC A;  3HBB A;  4DQ1 A;  4ISW A;  3C06 A;  1JMG A;  1KZI A;  1TVW A;  2KCE A;  4LRR A;  3UWL B;  4DPH A;  1BO8 A;  2FTQ A;  3EHI X;  3UM5 A;  4H0U A;  5H39 A;  1NJB A;  1F4E A;  1NJE A;  1TSM A;  2RD8 A;  4FGT A;  1B5E A;  3QGT A;  4FQS A;  3KJR A;  2G8A A;  3EGY X;  1TDU A;  1AN5 A;  1SYN A;  1QQQ A;  4EIL A;  2G89 A;  3NRR A;  1BJG A;  1KZJ A;  1JMF A;  4XSC A;  3V8H A;  4DPD A;  4IQB A;  1THY A;  2RDA A;  1BSF A;  3EF9 A;  1I00 A;  4FOX A;  1NCE A;  1TSV A;  1BQ1 A;  1B5D A;  3INV A;  1EV5 A;  2RD8 B;  3BHL A;  3DGA C;  3GG5 A;  1TSW A;  1JMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...