4O1XA

Crystal structure of human thymidylate synthase double mutant c195s-y202c
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
288
structure length
285
Chain Sequence
PRPPHGELQYLGQIQHILRGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPSHALQFVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase
publication title Tethering the dimer-dimer interface of human thymidylate synthase
rcsb
source organism Homo sapiens
total genus 87
structure length 285
sequence length 288
chains with identical sequence B, C
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4o1xA00
3NRRA 1EV5A 4Q0EA 3IRMA 4E5OA 4EZ8A 4FOAA 4IRRA 1DDUA 1NJAA 3QJ7A 1QQQA 1NCEA 1JMFA 4FOXA 1AXWA 3ED7A 1SYNA 1J3KC 1BP0A 4PSGA 4LRRA 1HW4A 1TDUA 1BQ2A 1CI7A 3EHIX 4DPDA 1TSZA 1TISA 1TSDA 3BFIA 1F4BA 2H2QA 1TSXA 1YPVA 2ONBA 1J3IC 2A9WA 4G6WX 4IQBA 4XSEA 1TLCA 1TVWA 3INVA 3DL5A 1VZAA 3CLBA 1TSYA 1SEJA 5J7WA 1BO8A 5H3AA 1JMHA 3EBUA 3QGTA 4FGTA 3B9HA 4G2OX 4KPWA 4GYHA 1KZJA 4O1XA 4UP1A 5BY6A 3UM5A 1B5DA 5WRNA 1TSLA 4ISWA 4KYAA 3TMSA 1B02A 1TVVA 1JUTA 1LCEA 1LCAA 3GH2X 1TYSA 4GD7A 3JSUA 4H0RA 1JMGA 1JG0A 2G89A 2VF0A 4KY4A 1EV8A 3UM8A 1NJCA 1NJBA 3BHLA 2TDDA 1B49A 2G86A 3IK1A 3DL6A 3BYXA 1BDUA 4H1IA 1BSPA 4KY8A 1THYA 1HW3A 1BQ1A 3EAWX 4DP3A 1FFLA 1RTSA 1TLSA 1BPJA 1JMIA 2FTQA 3HBBA 5HS3A 3IK0A 3V8HA 1TRGA 4EB4A 2G8XA 1KZIA 1VZCA 3QG2A 5H39A 1TDBA 4O7UA 4Q0DA 4FOGA 4F2VA 1TSNA 3KJRA 4O1UA 4ECKA 2KCEA 4XSCA 1JU6A 3DGAC 3UWLA 4E28A 2FTOX 2G8DA 3H9KA 2G8AA 1BJGA 2TSRA 1AOBA 1J3JC 1TSWA 3EF9A 1F4CA 1AJMA 1F4EA 1HZWA 1JTUA 3HJ3A 3IRNA 4TMSA 1TDCA 1F4DA 3BNZA 1JUJA 3KGBA 3GG5A 4GEVA 1TVUA 4H0UA 1AN5A 2BBQA 1I00A 4EINA 4EILA 1F4GA 1VZEA 4DQ1A 1F4FA 1BP6A 1VZDA 3IJZA 4XSDA 3EDWX 1EVFA 1TDAA 3CL9A 1LCBA 1QZFA 3DG8C 1AIQA 3K2HA 2RD8B 3N5EB 3UWLB 1FWMA 1VZBA 1B5EA 2TDMA 1TJSA 1BO7A 1DNAA 3OB7A 5H38A 1JTQA 3BZ0A 2FTNA 4DPHA 1KCEA 4IQQA 3EGYX 4O1XD 1BSFA 1NJDA 3N5GA 1TSMA 2RD8A 3C06A 3HB8A 3BGXA 3N5EA 1BKOA 1BKPA 1TSVA 1EVGA 2RDAA 3IX6A 3GH0A 2AAZA 1ZPRA 4ISKA 3BHRA 3I3RA 1HVYA 1NJEA 4JEFA 1F28A 3IHIA 3KJSA 1BIDA 2TSCA 3C0AA 2VETA 3IROA 4FQSA 3EJLA 5FCTA 4KNZA 3UM6A 3B5BA 2OIPA
chains in the Genus database with same CATH superfamily
3NRRA 1EV5A 4Q0EA 3IRMA 4E5OA 4EZ8A 4FOAA 4IRRA 1DDUA 1NJAA 3QJ7A 1QQQA 1NCEA 1JMFA 4FOXA 1AXWA 3ED7A 1SYNA 1J3KC 1BP0A 4PSGA 4LRRA 1HW4A 1TDUA 1BQ2A 1CI7A 3EHIX 4DPDA 1TSZA 1TISA 1TSDA 3BFIA 1F4BA 2H2QA 1TSXA 1YPVA 2ONBA 1J3IC 2A9WA 4G6WX 4IQBA 4XSEA 1TLCA 1TVWA 3INVA 3DL5A 1VZAA 3CLBA 1TSYA 1SEJA 5J7WA 1BO8A 5H3AA 1JMHA 3EBUA 3QGTA 4FGTA 3B9HA 4G2OX 4KPWA 4GYHA 1KZJA 4O1XA 4UP1A 5BY6A 3UM5A 1B5DA 5WRNA 1TSLA 4ISWA 4KYAA 3TMSA 1B02A 1TVVA 1JUTA 1LCEA 1LCAA 3GH2X 1TYSA 4GD7A 3JSUA 4H0RA 1JMGA 1JG0A 2G89A 2VF0A 4KY4A 1EV8A 3UM8A 1NJCA 1NJBA 3BHLA 2TDDA 1B49A 2G86A 3IK1A 3DL6A 3BYXA 1BDUA 4H1IA 1BSPA 4KY8A 1THYA 1HW3A 1BQ1A 3EAWX 4DP3A 1FFLA 1RTSA 1TLSA 1BPJA 1JMIA 2FTQA 3HBBA 5HS3A 3IK0A 3V8HA 1TRGA 4EB4A 2G8XA 1KZIA 1VZCA 3QG2A 5H39A 1TDBA 4O7UA 4Q0DA 4FOGA 4F2VA 1TSNA 3KJRA 4O1UA 4ECKA 2KCEA 4XSCA 1JU6A 3DGAC 3UWLA 4E28A 2FTOX 2G8DA 3H9KA 2G8AA 1BJGA 2TSRA 1AOBA 1J3JC 1TSWA 3EF9A 1F4CA 1AJMA 1F4EA 1HZWA 1JTUA 3HJ3A 3IRNA 4TMSA 1TDCA 1F4DA 3BNZA 1JUJA 3KGBA 3GG5A 4GEVA 1TVUA 4H0UA 1AN5A 2BBQA 1I00A 4EINA 4EILA 1F4GA 1VZEA 4DQ1A 1F4FA 1BP6A 1VZDA 3IJZA 4XSDA 3EDWX 1EVFA 1TDAA 3CL9A 1LCBA 1QZFA 3DG8C 1AIQA 3K2HA 2RD8B 3N5EB 3UWLB 1FWMA 1VZBA 1B5EA 2TDMA 1TJSA 1BO7A 1DNAA 3OB7A 5H38A 1JTQA 3BZ0A 2FTNA 4DPHA 1KCEA 4IQQA 3EGYX 4O1XD 1BSFA 1NJDA 3N5GA 1TSMA 2RD8A 3C06A 3HB8A 3BGXA 3N5EA 1BKOA 1BKPA 1TSVA 1EVGA 2RDAA 3IX6A 3GH0A 2AAZA 1ZPRA 4ISKA 3BHRA 3I3RA 1HVYA 1NJEA 4JEFA 1F28A 3IHIA 3KJSA 1BIDA 2TSCA 3C0AA 2VETA 3IROA 4FQSA 3EJLA 5FCTA 4KNZA 3UM6A 3B5BA 2OIPA
chains in the Genus database with same CATH topology
3NRRA 1EV5A 4Q0EA 3IRMA 4E5OA 4EZ8A 4FOAA 4IRRA 1DDUA 1NJAA 3QJ7A 1QQQA 1NCEA 1JMFA 4FOXA 1AXWA 3ED7A 1SYNA 1J3KC 1BP0A 4PSGA 4LRRA 1HW4A 1TDUA 1BQ2A 1CI7A 3EHIX 4DPDA 1TSZA 1TISA 1TSDA 3BFIA 1F4BA 2H2QA 1TSXA 1YPVA 2ONBA 1J3IC 2A9WA 4G6WX 4IQBA 4XSEA 1TLCA 1TVWA 3INVA 3DL5A 1VZAA 3CLBA 1TSYA 1SEJA 5J7WA 1BO8A 5H3AA 1JMHA 3EBUA 3QGTA 4FGTA 3B9HA 4G2OX 4KPWA 4GYHA 1KZJA 4O1XA 4UP1A 5BY6A 3UM5A 1B5DA 5WRNA 1TSLA 4ISWA 4KYAA 3TMSA 1B02A 1TVVA 1JUTA 1LCEA 1LCAA 3GH2X 1TYSA 4GD7A 3JSUA 4H0RA 1JMGA 1JG0A 2G89A 2VF0A 4KY4A 1EV8A 3UM8A 1NJCA 1NJBA 3BHLA 2TDDA 1B49A 2G86A 3IK1A 3DL6A 3BYXA 1BDUA 4H1IA 1BSPA 4KY8A 1THYA 1HW3A 1BQ1A 3EAWX 4DP3A 1FFLA 1RTSA 1TLSA 1BPJA 1JMIA 2FTQA 3HBBA 5HS3A 3IK0A 3V8HA 1TRGA 4EB4A 2G8XA 1KZIA 1VZCA 3QG2A 5H39A 1TDBA 4O7UA 4Q0DA 4FOGA 4F2VA 1TSNA 3KJRA 4O1UA 4ECKA 2KCEA 4XSCA 1JU6A 3DGAC 3UWLA 4E28A 2FTOX 2G8DA 3H9KA 2G8AA 1BJGA 2TSRA 1AOBA 1J3JC 1TSWA 3EF9A 1F4CA 1AJMA 1F4EA 1HZWA 1JTUA 3HJ3A 3IRNA 4TMSA 1TDCA 1F4DA 3BNZA 1JUJA 3KGBA 3GG5A 4GEVA 1TVUA 4H0UA 1AN5A 2BBQA 1I00A 4EINA 4EILA 1F4GA 1VZEA 4DQ1A 1F4FA 1BP6A 1VZDA 3IJZA 4XSDA 3EDWX 1EVFA 1TDAA 3CL9A 1LCBA 1QZFA 3DG8C 1AIQA 3K2HA 2RD8B 3N5EB 3UWLB 1FWMA 1VZBA 1B5EA 2TDMA 1TJSA 1BO7A 1DNAA 3OB7A 5H38A 1JTQA 3BZ0A 2FTNA 4DPHA 1KCEA 4IQQA 3EGYX 4O1XD 1BSFA 1NJDA 3N5GA 1TSMA 2RD8A 3C06A 3HB8A 3BGXA 3N5EA 1BKOA 1BKPA 1TSVA 1EVGA 2RDAA 3IX6A 3GH0A 2AAZA 1ZPRA 4ISKA 3BHRA 3I3RA 1HVYA 1NJEA 4JEFA 1F28A 3IHIA 3KJSA 1BIDA 2TSCA 3C0AA 2VETA 3IROA 4FQSA 3EJLA 5FCTA 4KNZA 3UM6A 3B5BA 2OIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRR A;  1EV5 A;  4Q0E A;  3IRM A;  4E5O A;  4EZ8 A;  4FOA A;  4IRR A;  1DDU A;  1NJA A;  3QJ7 A;  1QQQ A;  1NCE A;  1JMF A;  4FOX A;  1AXW A;  3ED7 A;  1SYN A;  1J3K C;  1BP0 A;  4PSG A;  4LRR A;  1HW4 A;  1TDU A;  1BQ2 A;  1CI7 A;  3EHI X;  4DPD A;  1TSZ A;  1TIS A;  1TSD A;  3BFI A;  1F4B A;  2H2Q A;  1TSX A;  1YPV A;  2ONB A;  1J3I C;  2A9W A;  4G6W X;  4IQB A;  4XSE A;  1TLC A;  1TVW A;  3INV A;  3DL5 A;  1VZA A;  3CLB A;  1TSY A;  1SEJ A;  5J7W A;  1BO8 A;  5H3A A;  1JMH A;  3EBU A;  3QGT A;  4FGT A;  3B9H A;  4G2O X;  4KPW A;  4GYH A;  1KZJ A;  4O1X A;  4UP1 A;  5BY6 A;  3UM5 A;  1B5D A;  5WRN A;  1TSL A;  4ISW A;  4KYA A;  3TMS A;  1B02 A;  1TVV A;  1JUT A;  1LCE A;  1LCA A;  3GH2 X;  1TYS A;  4GD7 A;  3JSU A;  4H0R A;  1JMG A;  1JG0 A;  2G89 A;  2VF0 A;  4KY4 A;  1EV8 A;  3UM8 A;  1NJC A;  1NJB A;  3BHL A;  2TDD A;  1B49 A;  2G86 A;  3IK1 A;  3DL6 A;  3BYX A;  1BDU A;  4H1I A;  1BSP A;  4KY8 A;  1THY A;  1HW3 A;  1BQ1 A;  3EAW X;  4DP3 A;  1FFL A;  1RTS A;  1TLS A;  1BPJ A;  1JMI A;  2FTQ A;  3HBB A;  5HS3 A;  3IK0 A;  3V8H A;  1TRG A;  4EB4 A;  2G8X A;  1KZI A;  1VZC A;  3QG2 A;  5H39 A;  1TDB A;  4O7U A;  4Q0D A;  4FOG A;  4F2V A;  1TSN A;  3KJR A;  4O1U A;  4ECK A;  2KCE A;  4XSC A;  1JU6 A;  3DGA C;  3UWL A;  4E28 A;  2FTO X;  2G8D A;  3H9K A;  2G8A A;  1BJG A;  2TSR A;  1AOB A;  1J3J C;  1TSW A;  3EF9 A;  1F4C A;  1AJM A;  1F4E A;  1HZW A;  1JTU A;  3HJ3 A;  3IRN A;  4TMS A;  1TDC A;  1F4D A;  3BNZ A;  1JUJ A;  3KGB A;  3GG5 A;  4GEV A;  1TVU A;  4H0U A;  1AN5 A;  2BBQ A;  1I00 A;  4EIN A;  4EIL A;  1F4G A;  1VZE A;  4DQ1 A;  1F4F A;  1BP6 A;  1VZD A;  3IJZ A;  4XSD A;  3EDW X;  1EVF A;  1TDA A;  3CL9 A;  1LCB A;  1QZF A;  3DG8 C;  1AIQ A;  3K2H A;  2RD8 B;  3N5E B;  3UWL B;  1FWM A;  1VZB A;  1B5E A;  2TDM A;  1TJS A;  1BO7 A;  1DNA A;  3OB7 A;  5H38 A;  1JTQ A;  3BZ0 A;  2FTN A;  4DPH A;  1KCE A;  4IQQ A;  3EGY X;  4O1X D;  1BSF A;  1NJD A;  3N5G A;  1TSM A;  2RD8 A;  3C06 A;  3HB8 A;  3BGX A;  3N5E A;  1BKO A;  1BKP A;  1TSV A;  1EVG A;  2RDA A;  3IX6 A;  3GH0 A;  2AAZ A;  1ZPR A;  4ISK A;  3BHR A;  3I3R A;  1HVY A;  1NJE A;  4JEF A;  1F28 A;  3IHI A;  3KJS A;  1BID A;  2TSC A;  3C0A A;  2VET A;  3IRO A;  4FQS A;  3EJL A;  5FCT A;  4KNZ A;  3UM6 A;  3B5B A;  2OIP A; 
#chains in the Genus database with same CATH topology
 3NRR A;  1EV5 A;  4Q0E A;  3IRM A;  4E5O A;  4EZ8 A;  4FOA A;  4IRR A;  1DDU A;  1NJA A;  3QJ7 A;  1QQQ A;  1NCE A;  1JMF A;  4FOX A;  1AXW A;  3ED7 A;  1SYN A;  1J3K C;  1BP0 A;  4PSG A;  4LRR A;  1HW4 A;  1TDU A;  1BQ2 A;  1CI7 A;  3EHI X;  4DPD A;  1TSZ A;  1TIS A;  1TSD A;  3BFI A;  1F4B A;  2H2Q A;  1TSX A;  1YPV A;  2ONB A;  1J3I C;  2A9W A;  4G6W X;  4IQB A;  4XSE A;  1TLC A;  1TVW A;  3INV A;  3DL5 A;  1VZA A;  3CLB A;  1TSY A;  1SEJ A;  5J7W A;  1BO8 A;  5H3A A;  1JMH A;  3EBU A;  3QGT A;  4FGT A;  3B9H A;  4G2O X;  4KPW A;  4GYH A;  1KZJ A;  4O1X A;  4UP1 A;  5BY6 A;  3UM5 A;  1B5D A;  5WRN A;  1TSL A;  4ISW A;  4KYA A;  3TMS A;  1B02 A;  1TVV A;  1JUT A;  1LCE A;  1LCA A;  3GH2 X;  1TYS A;  4GD7 A;  3JSU A;  4H0R A;  1JMG A;  1JG0 A;  2G89 A;  2VF0 A;  4KY4 A;  1EV8 A;  3UM8 A;  1NJC A;  1NJB A;  3BHL A;  2TDD A;  1B49 A;  2G86 A;  3IK1 A;  3DL6 A;  3BYX A;  1BDU A;  4H1I A;  1BSP A;  4KY8 A;  1THY A;  1HW3 A;  1BQ1 A;  3EAW X;  4DP3 A;  1FFL A;  1RTS A;  1TLS A;  1BPJ A;  1JMI A;  2FTQ A;  3HBB A;  5HS3 A;  3IK0 A;  3V8H A;  1TRG A;  4EB4 A;  2G8X A;  1KZI A;  1VZC A;  3QG2 A;  5H39 A;  1TDB A;  4O7U A;  4Q0D A;  4FOG A;  4F2V A;  1TSN A;  3KJR A;  4O1U A;  4ECK A;  2KCE A;  4XSC A;  1JU6 A;  3DGA C;  3UWL A;  4E28 A;  2FTO X;  2G8D A;  3H9K A;  2G8A A;  1BJG A;  2TSR A;  1AOB A;  1J3J C;  1TSW A;  3EF9 A;  1F4C A;  1AJM A;  1F4E A;  1HZW A;  1JTU A;  3HJ3 A;  3IRN A;  4TMS A;  1TDC A;  1F4D A;  3BNZ A;  1JUJ A;  3KGB A;  3GG5 A;  4GEV A;  1TVU A;  4H0U A;  1AN5 A;  2BBQ A;  1I00 A;  4EIN A;  4EIL A;  1F4G A;  1VZE A;  4DQ1 A;  1F4F A;  1BP6 A;  1VZD A;  3IJZ A;  4XSD A;  3EDW X;  1EVF A;  1TDA A;  3CL9 A;  1LCB A;  1QZF A;  3DG8 C;  1AIQ A;  3K2H A;  2RD8 B;  3N5E B;  3UWL B;  1FWM A;  1VZB A;  1B5E A;  2TDM A;  1TJS A;  1BO7 A;  1DNA A;  3OB7 A;  5H38 A;  1JTQ A;  3BZ0 A;  2FTN A;  4DPH A;  1KCE A;  4IQQ A;  3EGY X;  4O1X D;  1BSF A;  1NJD A;  3N5G A;  1TSM A;  2RD8 A;  3C06 A;  3HB8 A;  3BGX A;  3N5E A;  1BKO A;  1BKP A;  1TSV A;  1EVG A;  2RDA A;  3IX6 A;  3GH0 A;  2AAZ A;  1ZPR A;  4ISK A;  3BHR A;  3I3R A;  1HVY A;  1NJE A;  4JEF A;  1F28 A;  3IHI A;  3KJS A;  1BID A;  2TSC A;  3C0A A;  2VET A;  3IRO A;  4FQS A;  3EJL A;  5FCT A;  4KNZ A;  3UM6 A;  3B5B A;  2OIP A; 
#chains in the Genus database with same CATH homology
 3NRR A;  1EV5 A;  4Q0E A;  3IRM A;  4E5O A;  4EZ8 A;  4FOA A;  4IRR A;  1DDU A;  1NJA A;  3QJ7 A;  1QQQ A;  1NCE A;  1JMF A;  4FOX A;  1AXW A;  3ED7 A;  1SYN A;  1J3K C;  1BP0 A;  4PSG A;  4LRR A;  1HW4 A;  1TDU A;  1BQ2 A;  1CI7 A;  3EHI X;  4DPD A;  1TSZ A;  1TIS A;  1TSD A;  3BFI A;  1F4B A;  2H2Q A;  1TSX A;  1YPV A;  2ONB A;  1J3I C;  2A9W A;  4G6W X;  4IQB A;  4XSE A;  1TLC A;  1TVW A;  3INV A;  3DL5 A;  1VZA A;  3CLB A;  1TSY A;  1SEJ A;  5J7W A;  1BO8 A;  5H3A A;  1JMH A;  3EBU A;  3QGT A;  4FGT A;  3B9H A;  4G2O X;  4KPW A;  4GYH A;  1KZJ A;  4O1X A;  4UP1 A;  5BY6 A;  3UM5 A;  1B5D A;  5WRN A;  1TSL A;  4ISW A;  4KYA A;  3TMS A;  1B02 A;  1TVV A;  1JUT A;  1LCE A;  1LCA A;  3GH2 X;  1TYS A;  4GD7 A;  3JSU A;  4H0R A;  1JMG A;  1JG0 A;  2G89 A;  2VF0 A;  4KY4 A;  1EV8 A;  3UM8 A;  1NJC A;  1NJB A;  3BHL A;  2TDD A;  1B49 A;  2G86 A;  3IK1 A;  3DL6 A;  3BYX A;  1BDU A;  4H1I A;  1BSP A;  4KY8 A;  1THY A;  1HW3 A;  1BQ1 A;  3EAW X;  4DP3 A;  1FFL A;  1RTS A;  1TLS A;  1BPJ A;  1JMI A;  2FTQ A;  3HBB A;  5HS3 A;  3IK0 A;  3V8H A;  1TRG A;  4EB4 A;  2G8X A;  1KZI A;  1VZC A;  3QG2 A;  5H39 A;  1TDB A;  4O7U A;  4Q0D A;  4FOG A;  4F2V A;  1TSN A;  3KJR A;  4O1U A;  4ECK A;  2KCE A;  4XSC A;  1JU6 A;  3DGA C;  3UWL A;  4E28 A;  2FTO X;  2G8D A;  3H9K A;  2G8A A;  1BJG A;  2TSR A;  1AOB A;  1J3J C;  1TSW A;  3EF9 A;  1F4C A;  1AJM A;  1F4E A;  1HZW A;  1JTU A;  3HJ3 A;  3IRN A;  4TMS A;  1TDC A;  1F4D A;  3BNZ A;  1JUJ A;  3KGB A;  3GG5 A;  4GEV A;  1TVU A;  4H0U A;  1AN5 A;  2BBQ A;  1I00 A;  4EIN A;  4EIL A;  1F4G A;  1VZE A;  4DQ1 A;  1F4F A;  1BP6 A;  1VZD A;  3IJZ A;  4XSD A;  3EDW X;  1EVF A;  1TDA A;  3CL9 A;  1LCB A;  1QZF A;  3DG8 C;  1AIQ A;  3K2H A;  2RD8 B;  3N5E B;  3UWL B;  1FWM A;  1VZB A;  1B5E A;  2TDM A;  1TJS A;  1BO7 A;  1DNA A;  3OB7 A;  5H38 A;  1JTQ A;  3BZ0 A;  2FTN A;  4DPH A;  1KCE A;  4IQQ A;  3EGY X;  4O1X D;  1BSF A;  1NJD A;  3N5G A;  1TSM A;  2RD8 A;  3C06 A;  3HB8 A;  3BGX A;  3N5E A;  1BKO A;  1BKP A;  1TSV A;  1EVG A;  2RDA A;  3IX6 A;  3GH0 A;  2AAZ A;  1ZPR A;  4ISK A;  3BHR A;  3I3R A;  1HVY A;  1NJE A;  4JEF A;  1F28 A;  3IHI A;  3KJS A;  1BID A;  2TSC A;  3C0A A;  2VET A;  3IRO A;  4FQS A;  3EJL A;  5FCT A;  4KNZ A;  3UM6 A;  3B5B A;  2OIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...