4O1XD

Crystal structure of human thymidylate synthase double mutant c195s-y202c
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
282
structure length
274
Chain Sequence
GELQYLGQIQHILRGVRKDDGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMAWNPRDLPLMALPPSHALQFVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase
publication title Tethering the dimer-dimer interface of human thymidylate synthase
rcsb
source organism Homo sapiens
total genus 92
structure length 274
sequence length 282
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4o1xD00
3UM5A 3EDWX 3EJLA 3N5GA 1NCEA 4XSEA 5H38A 1JU6A 4IRRA 4EZ8A 1VZDA 1KZIA 3IHIA 3IK0A 3KGBA 4ISWA 5H39A 1TYSA 1B5DA 3HB8A 3GG5A 3NRRA 1TVVA 1LCAA 4G2OX 1VZAA 1TSYA 2FTOX 1AXWA 3BFIA 2FTQA 1TISA 4H0RA 1BPJA 1JMGA 4KYAA 4H1IA 1JMFA 1YPVA 1AN5A 1TSMA 1KCEA 2AAZA 2FTNA 3CLBA 4KNZA 2A9WA 4LRRA 3BGXA 2G89A 1BQ1A 1BSPA 1TSLA 1BQ2A 2G8AA 1TSWA 1SEJA 4GEVA 1HVYA 1EVGA 2OIPA 3IJZA 1BO7A 3EGYX 4FQSA 4E28A 4EINA 1TDCA 1TSVA 3UM6A 1BDUA 1B49A 4O1XA 3H9KA 4O7UA 4GD7A 5BY6A 1F4GA 5WRNA 1BIDA 1TVWA 1TSDA 4DPDA 1TDUA 1VZCA 1BKPA 3C06A 4UP1A 2RDAA 2VETA 1BP0A 1F28A 1F4FA 1LCEA 1I00A 1AIQA 2G8XA 3GH0A 1NJDA 4XSCA 1JUJA 1F4BA 1FFLA 3BZ0A 4IQQA 2TSCA 1CI7A 3EBUA 3V8HA 1VZBA 1TDAA 1SYNA 3DGAC 1TLSA 3IRNA 3OB7A 4EILA 1VZEA 1JTQA 3BNZA 3B5BA 3UM8A 4DQ1A 3KJSA 2BBQA 1ZPRA 1F4EA 1NJEA 3EAWX 3IROA 4KY4A 4FGTA 1DDUA 1NJCA 3QJ7A 1AJMA 1J3KC 2VF0A 1EV8A 1BKOA 1J3IC 2G8DA 3HJ3A 3QGTA 1TSZA 1NJBA 3KJRA 1HW3A 4KY8A 1HZWA 4Q0EA 1QQQA 1EV5A 1BSFA 4FOAA 1AOBA 1B5EA 3BHRA 4IQBA 1TLCA 4JEFA 2TDMA 4XSDA 1B02A 3N5EA 3K2HA 4GYHA 1JMIA 4PSGA 1JTUA 1THYA 3HBBA 3IK1A 3EHIX 4ISKA 3GH2X 4KPWA 1BJGA 2H2QA 3N5EB 4FOGA 2KCEA 3UWLA 4DP3A 3UWLB 4O1XD 1TJSA 1J3JC 1LCBA 4TMSA 4H0UA 2ONBA 1KZJA 3I3RA 1TVUA 1HW4A 4FOXA 1FWMA 3ED7A 1TSXA 1F4DA 3C0AA 4DPHA 1F4CA 2TDDA 5J7WA 3JSUA 1TSNA 2RD8A 1RTSA 3DL5A 1JUTA 4F2VA 5HS3A 1BO8A 2RD8B 1NJAA 3BYXA 4EB4A 3TMSA 2G86A 3BHLA 3CL9A 3INVA 1DNAA 3DG8C 5FCTA 4E5OA 1EVFA 1JG0A 3EF9A 4Q0DA 4O1UA 1TRGA 1QZFA 2TSRA 4ECKA 1JMHA 5H3AA 3IX6A 3B9HA 3IRMA 3DL6A 3QG2A 1BP6A 4G6WX 1TDBA
chains in the Genus database with same CATH superfamily
3UM5A 3EDWX 3EJLA 3N5GA 1NCEA 4XSEA 5H38A 1JU6A 4IRRA 4EZ8A 1VZDA 1KZIA 3IHIA 3IK0A 3KGBA 4ISWA 5H39A 1TYSA 1B5DA 3HB8A 3GG5A 3NRRA 1TVVA 1LCAA 4G2OX 1VZAA 1TSYA 2FTOX 1AXWA 3BFIA 2FTQA 1TISA 4H0RA 1BPJA 1JMGA 4KYAA 4H1IA 1JMFA 1YPVA 1AN5A 1TSMA 1KCEA 2AAZA 2FTNA 3CLBA 4KNZA 2A9WA 4LRRA 3BGXA 2G89A 1BQ1A 1BSPA 1TSLA 1BQ2A 2G8AA 1TSWA 1SEJA 4GEVA 1HVYA 1EVGA 2OIPA 3IJZA 1BO7A 3EGYX 4FQSA 4E28A 4EINA 1TDCA 1TSVA 3UM6A 1BDUA 1B49A 4O1XA 3H9KA 4O7UA 4GD7A 5BY6A 1F4GA 5WRNA 1BIDA 1TVWA 1TSDA 4DPDA 1TDUA 1VZCA 1BKPA 3C06A 4UP1A 2RDAA 2VETA 1BP0A 1F28A 1F4FA 1LCEA 1I00A 1AIQA 2G8XA 3GH0A 1NJDA 4XSCA 1JUJA 1F4BA 1FFLA 3BZ0A 4IQQA 2TSCA 1CI7A 3EBUA 3V8HA 1VZBA 1TDAA 1SYNA 3DGAC 1TLSA 3IRNA 3OB7A 4EILA 1VZEA 1JTQA 3BNZA 3B5BA 3UM8A 4DQ1A 3KJSA 2BBQA 1ZPRA 1F4EA 1NJEA 3EAWX 3IROA 4KY4A 4FGTA 1DDUA 1NJCA 3QJ7A 1AJMA 1J3KC 2VF0A 1EV8A 1BKOA 1J3IC 2G8DA 3HJ3A 3QGTA 1TSZA 1NJBA 3KJRA 1HW3A 4KY8A 1HZWA 4Q0EA 1QQQA 1EV5A 1BSFA 4FOAA 1AOBA 1B5EA 3BHRA 4IQBA 1TLCA 4JEFA 2TDMA 4XSDA 1B02A 3N5EA 3K2HA 4GYHA 1JMIA 4PSGA 1JTUA 1THYA 3HBBA 3IK1A 3EHIX 4ISKA 3GH2X 4KPWA 1BJGA 2H2QA 3N5EB 4FOGA 2KCEA 3UWLA 4DP3A 3UWLB 4O1XD 1TJSA 1J3JC 1LCBA 4TMSA 4H0UA 2ONBA 1KZJA 3I3RA 1TVUA 1HW4A 4FOXA 1FWMA 3ED7A 1TSXA 1F4DA 3C0AA 4DPHA 1F4CA 2TDDA 5J7WA 3JSUA 1TSNA 2RD8A 1RTSA 3DL5A 1JUTA 4F2VA 5HS3A 1BO8A 2RD8B 1NJAA 3BYXA 4EB4A 3TMSA 2G86A 3BHLA 3CL9A 3INVA 1DNAA 3DG8C 5FCTA 4E5OA 1EVFA 1JG0A 3EF9A 4Q0DA 4O1UA 1TRGA 1QZFA 2TSRA 4ECKA 1JMHA 5H3AA 3IX6A 3B9HA 3IRMA 3DL6A 3QG2A 1BP6A 4G6WX 1TDBA
chains in the Genus database with same CATH topology
3UM5A 3EDWX 3EJLA 3N5GA 1NCEA 4XSEA 5H38A 1JU6A 4IRRA 4EZ8A 1VZDA 1KZIA 3IHIA 3IK0A 3KGBA 4ISWA 5H39A 1TYSA 1B5DA 3HB8A 3GG5A 3NRRA 1TVVA 1LCAA 4G2OX 1VZAA 1TSYA 2FTOX 1AXWA 3BFIA 2FTQA 1TISA 4H0RA 1BPJA 1JMGA 4KYAA 4H1IA 1JMFA 1YPVA 1AN5A 1TSMA 1KCEA 2AAZA 2FTNA 3CLBA 4KNZA 2A9WA 4LRRA 3BGXA 2G89A 1BQ1A 1BSPA 1TSLA 1BQ2A 2G8AA 1TSWA 1SEJA 4GEVA 1HVYA 1EVGA 2OIPA 3IJZA 1BO7A 3EGYX 4FQSA 4E28A 4EINA 1TDCA 1TSVA 3UM6A 1BDUA 1B49A 4O1XA 3H9KA 4O7UA 4GD7A 5BY6A 1F4GA 5WRNA 1BIDA 1TVWA 1TSDA 4DPDA 1TDUA 1VZCA 1BKPA 3C06A 4UP1A 2RDAA 2VETA 1BP0A 1F28A 1F4FA 1LCEA 1I00A 1AIQA 2G8XA 3GH0A 1NJDA 4XSCA 1JUJA 1F4BA 1FFLA 3BZ0A 4IQQA 2TSCA 1CI7A 3EBUA 3V8HA 1VZBA 1TDAA 1SYNA 3DGAC 1TLSA 3IRNA 3OB7A 4EILA 1VZEA 1JTQA 3BNZA 3B5BA 3UM8A 4DQ1A 3KJSA 2BBQA 1ZPRA 1F4EA 1NJEA 3EAWX 3IROA 4KY4A 4FGTA 1DDUA 1NJCA 3QJ7A 1AJMA 1J3KC 2VF0A 1EV8A 1BKOA 1J3IC 2G8DA 3HJ3A 3QGTA 1TSZA 1NJBA 3KJRA 1HW3A 4KY8A 1HZWA 4Q0EA 1QQQA 1EV5A 1BSFA 4FOAA 1AOBA 1B5EA 3BHRA 4IQBA 1TLCA 4JEFA 2TDMA 4XSDA 1B02A 3N5EA 3K2HA 4GYHA 1JMIA 4PSGA 1JTUA 1THYA 3HBBA 3IK1A 3EHIX 4ISKA 3GH2X 4KPWA 1BJGA 2H2QA 3N5EB 4FOGA 2KCEA 3UWLA 4DP3A 3UWLB 4O1XD 1TJSA 1J3JC 1LCBA 4TMSA 4H0UA 2ONBA 1KZJA 3I3RA 1TVUA 1HW4A 4FOXA 1FWMA 3ED7A 1TSXA 1F4DA 3C0AA 4DPHA 1F4CA 2TDDA 5J7WA 3JSUA 1TSNA 2RD8A 1RTSA 3DL5A 1JUTA 4F2VA 5HS3A 1BO8A 2RD8B 1NJAA 3BYXA 4EB4A 3TMSA 2G86A 3BHLA 3CL9A 3INVA 1DNAA 3DG8C 5FCTA 4E5OA 1EVFA 1JG0A 3EF9A 4Q0DA 4O1UA 1TRGA 1QZFA 2TSRA 4ECKA 1JMHA 5H3AA 3IX6A 3B9HA 3IRMA 3DL6A 3QG2A 1BP6A 4G6WX 1TDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UM5 A;  3EDW X;  3EJL A;  3N5G A;  1NCE A;  4XSE A;  5H38 A;  1JU6 A;  4IRR A;  4EZ8 A;  1VZD A;  1KZI A;  3IHI A;  3IK0 A;  3KGB A;  4ISW A;  5H39 A;  1TYS A;  1B5D A;  3HB8 A;  3GG5 A;  3NRR A;  1TVV A;  1LCA A;  4G2O X;  1VZA A;  1TSY A;  2FTO X;  1AXW A;  3BFI A;  2FTQ A;  1TIS A;  4H0R A;  1BPJ A;  1JMG A;  4KYA A;  4H1I A;  1JMF A;  1YPV A;  1AN5 A;  1TSM A;  1KCE A;  2AAZ A;  2FTN A;  3CLB A;  4KNZ A;  2A9W A;  4LRR A;  3BGX A;  2G89 A;  1BQ1 A;  1BSP A;  1TSL A;  1BQ2 A;  2G8A A;  1TSW A;  1SEJ A;  4GEV A;  1HVY A;  1EVG A;  2OIP A;  3IJZ A;  1BO7 A;  3EGY X;  4FQS A;  4E28 A;  4EIN A;  1TDC A;  1TSV A;  3UM6 A;  1BDU A;  1B49 A;  4O1X A;  3H9K A;  4O7U A;  4GD7 A;  5BY6 A;  1F4G A;  5WRN A;  1BID A;  1TVW A;  1TSD A;  4DPD A;  1TDU A;  1VZC A;  1BKP A;  3C06 A;  4UP1 A;  2RDA A;  2VET A;  1BP0 A;  1F28 A;  1F4F A;  1LCE A;  1I00 A;  1AIQ A;  2G8X A;  3GH0 A;  1NJD A;  4XSC A;  1JUJ A;  1F4B A;  1FFL A;  3BZ0 A;  4IQQ A;  2TSC A;  1CI7 A;  3EBU A;  3V8H A;  1VZB A;  1TDA A;  1SYN A;  3DGA C;  1TLS A;  3IRN A;  3OB7 A;  4EIL A;  1VZE A;  1JTQ A;  3BNZ A;  3B5B A;  3UM8 A;  4DQ1 A;  3KJS A;  2BBQ A;  1ZPR A;  1F4E A;  1NJE A;  3EAW X;  3IRO A;  4KY4 A;  4FGT A;  1DDU A;  1NJC A;  3QJ7 A;  1AJM A;  1J3K C;  2VF0 A;  1EV8 A;  1BKO A;  1J3I C;  2G8D A;  3HJ3 A;  3QGT A;  1TSZ A;  1NJB A;  3KJR A;  1HW3 A;  4KY8 A;  1HZW A;  4Q0E A;  1QQQ A;  1EV5 A;  1BSF A;  4FOA A;  1AOB A;  1B5E A;  3BHR A;  4IQB A;  1TLC A;  4JEF A;  2TDM A;  4XSD A;  1B02 A;  3N5E A;  3K2H A;  4GYH A;  1JMI A;  4PSG A;  1JTU A;  1THY A;  3HBB A;  3IK1 A;  3EHI X;  4ISK A;  3GH2 X;  4KPW A;  1BJG A;  2H2Q A;  3N5E B;  4FOG A;  2KCE A;  3UWL A;  4DP3 A;  3UWL B;  4O1X D;  1TJS A;  1J3J C;  1LCB A;  4TMS A;  4H0U A;  2ONB A;  1KZJ A;  3I3R A;  1TVU A;  1HW4 A;  4FOX A;  1FWM A;  3ED7 A;  1TSX A;  1F4D A;  3C0A A;  4DPH A;  1F4C A;  2TDD A;  5J7W A;  3JSU A;  1TSN A;  2RD8 A;  1RTS A;  3DL5 A;  1JUT A;  4F2V A;  5HS3 A;  1BO8 A;  2RD8 B;  1NJA A;  3BYX A;  4EB4 A;  3TMS A;  2G86 A;  3BHL A;  3CL9 A;  3INV A;  1DNA A;  3DG8 C;  5FCT A;  4E5O A;  1EVF A;  1JG0 A;  3EF9 A;  4Q0D A;  4O1U A;  1TRG A;  1QZF A;  2TSR A;  4ECK A;  1JMH A;  5H3A A;  3IX6 A;  3B9H A;  3IRM A;  3DL6 A;  3QG2 A;  1BP6 A;  4G6W X;  1TDB A; 
#chains in the Genus database with same CATH topology
 3UM5 A;  3EDW X;  3EJL A;  3N5G A;  1NCE A;  4XSE A;  5H38 A;  1JU6 A;  4IRR A;  4EZ8 A;  1VZD A;  1KZI A;  3IHI A;  3IK0 A;  3KGB A;  4ISW A;  5H39 A;  1TYS A;  1B5D A;  3HB8 A;  3GG5 A;  3NRR A;  1TVV A;  1LCA A;  4G2O X;  1VZA A;  1TSY A;  2FTO X;  1AXW A;  3BFI A;  2FTQ A;  1TIS A;  4H0R A;  1BPJ A;  1JMG A;  4KYA A;  4H1I A;  1JMF A;  1YPV A;  1AN5 A;  1TSM A;  1KCE A;  2AAZ A;  2FTN A;  3CLB A;  4KNZ A;  2A9W A;  4LRR A;  3BGX A;  2G89 A;  1BQ1 A;  1BSP A;  1TSL A;  1BQ2 A;  2G8A A;  1TSW A;  1SEJ A;  4GEV A;  1HVY A;  1EVG A;  2OIP A;  3IJZ A;  1BO7 A;  3EGY X;  4FQS A;  4E28 A;  4EIN A;  1TDC A;  1TSV A;  3UM6 A;  1BDU A;  1B49 A;  4O1X A;  3H9K A;  4O7U A;  4GD7 A;  5BY6 A;  1F4G A;  5WRN A;  1BID A;  1TVW A;  1TSD A;  4DPD A;  1TDU A;  1VZC A;  1BKP A;  3C06 A;  4UP1 A;  2RDA A;  2VET A;  1BP0 A;  1F28 A;  1F4F A;  1LCE A;  1I00 A;  1AIQ A;  2G8X A;  3GH0 A;  1NJD A;  4XSC A;  1JUJ A;  1F4B A;  1FFL A;  3BZ0 A;  4IQQ A;  2TSC A;  1CI7 A;  3EBU A;  3V8H A;  1VZB A;  1TDA A;  1SYN A;  3DGA C;  1TLS A;  3IRN A;  3OB7 A;  4EIL A;  1VZE A;  1JTQ A;  3BNZ A;  3B5B A;  3UM8 A;  4DQ1 A;  3KJS A;  2BBQ A;  1ZPR A;  1F4E A;  1NJE A;  3EAW X;  3IRO A;  4KY4 A;  4FGT A;  1DDU A;  1NJC A;  3QJ7 A;  1AJM A;  1J3K C;  2VF0 A;  1EV8 A;  1BKO A;  1J3I C;  2G8D A;  3HJ3 A;  3QGT A;  1TSZ A;  1NJB A;  3KJR A;  1HW3 A;  4KY8 A;  1HZW A;  4Q0E A;  1QQQ A;  1EV5 A;  1BSF A;  4FOA A;  1AOB A;  1B5E A;  3BHR A;  4IQB A;  1TLC A;  4JEF A;  2TDM A;  4XSD A;  1B02 A;  3N5E A;  3K2H A;  4GYH A;  1JMI A;  4PSG A;  1JTU A;  1THY A;  3HBB A;  3IK1 A;  3EHI X;  4ISK A;  3GH2 X;  4KPW A;  1BJG A;  2H2Q A;  3N5E B;  4FOG A;  2KCE A;  3UWL A;  4DP3 A;  3UWL B;  4O1X D;  1TJS A;  1J3J C;  1LCB A;  4TMS A;  4H0U A;  2ONB A;  1KZJ A;  3I3R A;  1TVU A;  1HW4 A;  4FOX A;  1FWM A;  3ED7 A;  1TSX A;  1F4D A;  3C0A A;  4DPH A;  1F4C A;  2TDD A;  5J7W A;  3JSU A;  1TSN A;  2RD8 A;  1RTS A;  3DL5 A;  1JUT A;  4F2V A;  5HS3 A;  1BO8 A;  2RD8 B;  1NJA A;  3BYX A;  4EB4 A;  3TMS A;  2G86 A;  3BHL A;  3CL9 A;  3INV A;  1DNA A;  3DG8 C;  5FCT A;  4E5O A;  1EVF A;  1JG0 A;  3EF9 A;  4Q0D A;  4O1U A;  1TRG A;  1QZF A;  2TSR A;  4ECK A;  1JMH A;  5H3A A;  3IX6 A;  3B9H A;  3IRM A;  3DL6 A;  3QG2 A;  1BP6 A;  4G6W X;  1TDB A; 
#chains in the Genus database with same CATH homology
 3UM5 A;  3EDW X;  3EJL A;  3N5G A;  1NCE A;  4XSE A;  5H38 A;  1JU6 A;  4IRR A;  4EZ8 A;  1VZD A;  1KZI A;  3IHI A;  3IK0 A;  3KGB A;  4ISW A;  5H39 A;  1TYS A;  1B5D A;  3HB8 A;  3GG5 A;  3NRR A;  1TVV A;  1LCA A;  4G2O X;  1VZA A;  1TSY A;  2FTO X;  1AXW A;  3BFI A;  2FTQ A;  1TIS A;  4H0R A;  1BPJ A;  1JMG A;  4KYA A;  4H1I A;  1JMF A;  1YPV A;  1AN5 A;  1TSM A;  1KCE A;  2AAZ A;  2FTN A;  3CLB A;  4KNZ A;  2A9W A;  4LRR A;  3BGX A;  2G89 A;  1BQ1 A;  1BSP A;  1TSL A;  1BQ2 A;  2G8A A;  1TSW A;  1SEJ A;  4GEV A;  1HVY A;  1EVG A;  2OIP A;  3IJZ A;  1BO7 A;  3EGY X;  4FQS A;  4E28 A;  4EIN A;  1TDC A;  1TSV A;  3UM6 A;  1BDU A;  1B49 A;  4O1X A;  3H9K A;  4O7U A;  4GD7 A;  5BY6 A;  1F4G A;  5WRN A;  1BID A;  1TVW A;  1TSD A;  4DPD A;  1TDU A;  1VZC A;  1BKP A;  3C06 A;  4UP1 A;  2RDA A;  2VET A;  1BP0 A;  1F28 A;  1F4F A;  1LCE A;  1I00 A;  1AIQ A;  2G8X A;  3GH0 A;  1NJD A;  4XSC A;  1JUJ A;  1F4B A;  1FFL A;  3BZ0 A;  4IQQ A;  2TSC A;  1CI7 A;  3EBU A;  3V8H A;  1VZB A;  1TDA A;  1SYN A;  3DGA C;  1TLS A;  3IRN A;  3OB7 A;  4EIL A;  1VZE A;  1JTQ A;  3BNZ A;  3B5B A;  3UM8 A;  4DQ1 A;  3KJS A;  2BBQ A;  1ZPR A;  1F4E A;  1NJE A;  3EAW X;  3IRO A;  4KY4 A;  4FGT A;  1DDU A;  1NJC A;  3QJ7 A;  1AJM A;  1J3K C;  2VF0 A;  1EV8 A;  1BKO A;  1J3I C;  2G8D A;  3HJ3 A;  3QGT A;  1TSZ A;  1NJB A;  3KJR A;  1HW3 A;  4KY8 A;  1HZW A;  4Q0E A;  1QQQ A;  1EV5 A;  1BSF A;  4FOA A;  1AOB A;  1B5E A;  3BHR A;  4IQB A;  1TLC A;  4JEF A;  2TDM A;  4XSD A;  1B02 A;  3N5E A;  3K2H A;  4GYH A;  1JMI A;  4PSG A;  1JTU A;  1THY A;  3HBB A;  3IK1 A;  3EHI X;  4ISK A;  3GH2 X;  4KPW A;  1BJG A;  2H2Q A;  3N5E B;  4FOG A;  2KCE A;  3UWL A;  4DP3 A;  3UWL B;  4O1X D;  1TJS A;  1J3J C;  1LCB A;  4TMS A;  4H0U A;  2ONB A;  1KZJ A;  3I3R A;  1TVU A;  1HW4 A;  4FOX A;  1FWM A;  3ED7 A;  1TSX A;  1F4D A;  3C0A A;  4DPH A;  1F4C A;  2TDD A;  5J7W A;  3JSU A;  1TSN A;  2RD8 A;  1RTS A;  3DL5 A;  1JUT A;  4F2V A;  5HS3 A;  1BO8 A;  2RD8 B;  1NJA A;  3BYX A;  4EB4 A;  3TMS A;  2G86 A;  3BHL A;  3CL9 A;  3INV A;  1DNA A;  3DG8 C;  5FCT A;  4E5O A;  1EVF A;  1JG0 A;  3EF9 A;  4Q0D A;  4O1U A;  1TRG A;  1QZF A;  2TSR A;  4ECK A;  1JMH A;  5H3A A;  3IX6 A;  3B9H A;  3IRM A;  3DL6 A;  3QG2 A;  1BP6 A;  4G6W X;  1TDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...