4O7UA

Etherocomplex of enteroccocus faecalis thymidylate synthase with 5-hydroxymethilene-6-hydrofolic acid and the phtalimidic inhibitor ss7
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
313
structure length
290
Chain Sequence
MEEAYLALGKKILEEGHFKEDRTGTGTYSLFGYQMRFDLAKGFPLLTTKRVPFGLIKSELLWFLKGDTNIRYLLERNNHIWDEWAFERYVKSADYQYKEEHQKFCDAILNDAEFAEKYGELGNIYGAQWRHWETKDGSFIDQLANVIEMIKTNPDSRRLIVSAWNPEDVPSMALPPCHTMFQFYVNEGKLSCQLYQRSADVFLGVPFNIASYALLTHLIAHETGLEVGEFVHTLGDAHLYQNHVEQMQEQLSREVRSFPTLVLNPSVFDFDMEDIKVEGYDPHPTIKAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate synthase
publication title X-ray crystal structures of Enterococcus faecalis thymidylate synthase with folate binding site inhibitors.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 84
structure length 290
sequence length 313
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4o7uA00
5H39A 1TLSA 1LCBA 1FWMA 1NJDA 2RD8A 3EHIX 3GG5A 4H1IA 4Q0EA 5BY6A 5H3AA 2VF0A 1BKPA 1DDUA 2RDAA 1TDCA 1BO8A 1J3IC 3UWLA 5WRNA 1F4BA 1NCEA 2OIPA 4PSGA 3N5EA 3KGBA 4H0UA 4O1XD 4O7UA 4KY8A 3HBBA 4KNZA 2TSRA 1TRGA 1BSPA 1JTQA 2BBQA 3CLBA 1BKOA 1F4CA 1YPVA 3C0AA 3BGXA 4EINA 2TSCA 4O1XA 1HVYA 2H2QA 3EAWX 1TVUA 4E5OA 3JSUA 1CI7A 3IROA 4XSCA 1TSXA 3K2HA 2G8AA 1TSDA 3IRNA 3IK0A 4O1UA 4EZ8A 5J7WA 3B9HA 1SYNA 4UP1A 3HJ3A 3HB8A 3N5EB 3BYXA 3BZ0A 1NJEA 1EVGA 4FQSA 3I3RA 4Q0DA 1HW4A 1LCAA 4G2OX 1BSFA 2FTNA 3BNZA 3EDWX 4EILA 4FGTA 1F4GA 1QQQA 1VZDA 3OB7A 4DPHA 1QZFA 1BQ1A 1ZPRA 1RTSA 1JUJA 4DP3A 4GYHA 4JEFA 1VZEA 3BFIA 2TDDA 3UM6A 1BO7A 3IK1A 4ISWA 2AAZA 2FTOX 1HZWA 4GD7A 2G8DA 1AN5A 1TDAA 1VZCA 2A9WA 3IJZA 2RD8B 4KPWA 4KYAA 2KCEA 4FOXA 5FCTA 1F4DA 5HS3A 1NJAA 1EVFA 3B5BA 3GH2X 4FOAA 2G8XA 3QGTA 4XSEA 3QJ7A 4G6WX 3UWLB 4DQ1A 3BHRA 1JG0A 3EGYX 1SEJA 4IQBA 3IRMA 2VETA 3N5GA 1AJMA 3TMSA 1BP0A 1TVVA 1B5DA 4LRRA 4ECKA 1THYA 2G86A 2ONBA 3C06A 3EBUA 1TDBA 1AXWA 1J3KC 3ED7A 3DGAC 4DPDA 3UM5A 1VZBA 1TJSA 1LCEA 4GEVA 4KY4A 1BQ2A 3DL5A 1TSZA 1JMFA 1KZIA 1KCEA 1NJBA 3NRRA 1BJGA 1JTUA 4FOGA 1VZAA 1HW3A 1TYSA 3UM8A 2G89A 4XSDA 4IRRA 1TDUA 1BPJA 1JU6A 3EF9A 1J3JC 1F28A 3KJRA 3QG2A 3BHLA 1NJCA 3IX6A 1TISA 1F4EA 1JUTA 3DG8C 4EB4A 5H38A 1BP6A 1EV8A 1JMHA 3KJSA 4E28A 1FFLA 3INVA 1TSVA 1DNAA 1JMGA 2TDMA 1BDUA 4F2VA 3CL9A 2FTQA 3V8HA 1EV5A 3EJLA 1TSNA 1JMIA 1TLCA 1KZJA 3H9KA 1I00A 1AIQA 1TSMA 4IQQA 1B02A 1AOBA 4H0RA 1TSWA 1TSYA 4ISKA 3DL6A 1BIDA 1B5EA 1TSLA 1TVWA 3GH0A 4TMSA 3IHIA 1F4FA 1B49A
chains in the Genus database with same CATH superfamily
5H39A 1TLSA 1LCBA 1FWMA 1NJDA 2RD8A 3EHIX 3GG5A 4H1IA 4Q0EA 5BY6A 5H3AA 2VF0A 1BKPA 1DDUA 2RDAA 1TDCA 1BO8A 1J3IC 3UWLA 5WRNA 1F4BA 1NCEA 2OIPA 4PSGA 3N5EA 3KGBA 4H0UA 4O1XD 4O7UA 4KY8A 3HBBA 4KNZA 2TSRA 1TRGA 1BSPA 1JTQA 2BBQA 3CLBA 1BKOA 1F4CA 1YPVA 3C0AA 3BGXA 4EINA 2TSCA 4O1XA 1HVYA 2H2QA 3EAWX 1TVUA 4E5OA 3JSUA 1CI7A 3IROA 4XSCA 1TSXA 3K2HA 2G8AA 1TSDA 3IRNA 3IK0A 4O1UA 4EZ8A 5J7WA 3B9HA 1SYNA 4UP1A 3HJ3A 3HB8A 3N5EB 3BYXA 3BZ0A 1NJEA 1EVGA 4FQSA 3I3RA 4Q0DA 1HW4A 1LCAA 4G2OX 1BSFA 2FTNA 3BNZA 3EDWX 4EILA 4FGTA 1F4GA 1QQQA 1VZDA 3OB7A 4DPHA 1QZFA 1BQ1A 1ZPRA 1RTSA 1JUJA 4DP3A 4GYHA 4JEFA 1VZEA 3BFIA 2TDDA 3UM6A 1BO7A 3IK1A 4ISWA 2AAZA 2FTOX 1HZWA 4GD7A 2G8DA 1AN5A 1TDAA 1VZCA 2A9WA 3IJZA 2RD8B 4KPWA 4KYAA 2KCEA 4FOXA 5FCTA 1F4DA 5HS3A 1NJAA 1EVFA 3B5BA 3GH2X 4FOAA 2G8XA 3QGTA 4XSEA 3QJ7A 4G6WX 3UWLB 4DQ1A 3BHRA 1JG0A 3EGYX 1SEJA 4IQBA 3IRMA 2VETA 3N5GA 1AJMA 3TMSA 1BP0A 1TVVA 1B5DA 4LRRA 4ECKA 1THYA 2G86A 2ONBA 3C06A 3EBUA 1TDBA 1AXWA 1J3KC 3ED7A 3DGAC 4DPDA 3UM5A 1VZBA 1TJSA 1LCEA 4GEVA 4KY4A 1BQ2A 3DL5A 1TSZA 1JMFA 1KZIA 1KCEA 1NJBA 3NRRA 1BJGA 1JTUA 4FOGA 1VZAA 1HW3A 1TYSA 3UM8A 2G89A 4XSDA 4IRRA 1TDUA 1BPJA 1JU6A 3EF9A 1J3JC 1F28A 3KJRA 3QG2A 3BHLA 1NJCA 3IX6A 1TISA 1F4EA 1JUTA 3DG8C 4EB4A 5H38A 1BP6A 1EV8A 1JMHA 3KJSA 4E28A 1FFLA 3INVA 1TSVA 1DNAA 1JMGA 2TDMA 1BDUA 4F2VA 3CL9A 2FTQA 3V8HA 1EV5A 3EJLA 1TSNA 1JMIA 1TLCA 1KZJA 3H9KA 1I00A 1AIQA 1TSMA 4IQQA 1B02A 1AOBA 4H0RA 1TSWA 1TSYA 4ISKA 3DL6A 1BIDA 1B5EA 1TSLA 1TVWA 3GH0A 4TMSA 3IHIA 1F4FA 1B49A
chains in the Genus database with same CATH topology
5H39A 1TLSA 1LCBA 1FWMA 1NJDA 2RD8A 3EHIX 3GG5A 4H1IA 4Q0EA 5BY6A 5H3AA 2VF0A 1BKPA 1DDUA 2RDAA 1TDCA 1BO8A 1J3IC 3UWLA 5WRNA 1F4BA 1NCEA 2OIPA 4PSGA 3N5EA 3KGBA 4H0UA 4O1XD 4O7UA 4KY8A 3HBBA 4KNZA 2TSRA 1TRGA 1BSPA 1JTQA 2BBQA 3CLBA 1BKOA 1F4CA 1YPVA 3C0AA 3BGXA 4EINA 2TSCA 4O1XA 1HVYA 2H2QA 3EAWX 1TVUA 4E5OA 3JSUA 1CI7A 3IROA 4XSCA 1TSXA 3K2HA 2G8AA 1TSDA 3IRNA 3IK0A 4O1UA 4EZ8A 5J7WA 3B9HA 1SYNA 4UP1A 3HJ3A 3HB8A 3N5EB 3BYXA 3BZ0A 1NJEA 1EVGA 4FQSA 3I3RA 4Q0DA 1HW4A 1LCAA 4G2OX 1BSFA 2FTNA 3BNZA 3EDWX 4EILA 4FGTA 1F4GA 1QQQA 1VZDA 3OB7A 4DPHA 1QZFA 1BQ1A 1ZPRA 1RTSA 1JUJA 4DP3A 4GYHA 4JEFA 1VZEA 3BFIA 2TDDA 3UM6A 1BO7A 3IK1A 4ISWA 2AAZA 2FTOX 1HZWA 4GD7A 2G8DA 1AN5A 1TDAA 1VZCA 2A9WA 3IJZA 2RD8B 4KPWA 4KYAA 2KCEA 4FOXA 5FCTA 1F4DA 5HS3A 1NJAA 1EVFA 3B5BA 3GH2X 4FOAA 2G8XA 3QGTA 4XSEA 3QJ7A 4G6WX 3UWLB 4DQ1A 3BHRA 1JG0A 3EGYX 1SEJA 4IQBA 3IRMA 2VETA 3N5GA 1AJMA 3TMSA 1BP0A 1TVVA 1B5DA 4LRRA 4ECKA 1THYA 2G86A 2ONBA 3C06A 3EBUA 1TDBA 1AXWA 1J3KC 3ED7A 3DGAC 4DPDA 3UM5A 1VZBA 1TJSA 1LCEA 4GEVA 4KY4A 1BQ2A 3DL5A 1TSZA 1JMFA 1KZIA 1KCEA 1NJBA 3NRRA 1BJGA 1JTUA 4FOGA 1VZAA 1HW3A 1TYSA 3UM8A 2G89A 4XSDA 4IRRA 1TDUA 1BPJA 1JU6A 3EF9A 1J3JC 1F28A 3KJRA 3QG2A 3BHLA 1NJCA 3IX6A 1TISA 1F4EA 1JUTA 3DG8C 4EB4A 5H38A 1BP6A 1EV8A 1JMHA 3KJSA 4E28A 1FFLA 3INVA 1TSVA 1DNAA 1JMGA 2TDMA 1BDUA 4F2VA 3CL9A 2FTQA 3V8HA 1EV5A 3EJLA 1TSNA 1JMIA 1TLCA 1KZJA 3H9KA 1I00A 1AIQA 1TSMA 4IQQA 1B02A 1AOBA 4H0RA 1TSWA 1TSYA 4ISKA 3DL6A 1BIDA 1B5EA 1TSLA 1TVWA 3GH0A 4TMSA 3IHIA 1F4FA 1B49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H39 A;  1TLS A;  1LCB A;  1FWM A;  1NJD A;  2RD8 A;  3EHI X;  3GG5 A;  4H1I A;  4Q0E A;  5BY6 A;  5H3A A;  2VF0 A;  1BKP A;  1DDU A;  2RDA A;  1TDC A;  1BO8 A;  1J3I C;  3UWL A;  5WRN A;  1F4B A;  1NCE A;  2OIP A;  4PSG A;  3N5E A;  3KGB A;  4H0U A;  4O1X D;  4O7U A;  4KY8 A;  3HBB A;  4KNZ A;  2TSR A;  1TRG A;  1BSP A;  1JTQ A;  2BBQ A;  3CLB A;  1BKO A;  1F4C A;  1YPV A;  3C0A A;  3BGX A;  4EIN A;  2TSC A;  4O1X A;  1HVY A;  2H2Q A;  3EAW X;  1TVU A;  4E5O A;  3JSU A;  1CI7 A;  3IRO A;  4XSC A;  1TSX A;  3K2H A;  2G8A A;  1TSD A;  3IRN A;  3IK0 A;  4O1U A;  4EZ8 A;  5J7W A;  3B9H A;  1SYN A;  4UP1 A;  3HJ3 A;  3HB8 A;  3N5E B;  3BYX A;  3BZ0 A;  1NJE A;  1EVG A;  4FQS A;  3I3R A;  4Q0D A;  1HW4 A;  1LCA A;  4G2O X;  1BSF A;  2FTN A;  3BNZ A;  3EDW X;  4EIL A;  4FGT A;  1F4G A;  1QQQ A;  1VZD A;  3OB7 A;  4DPH A;  1QZF A;  1BQ1 A;  1ZPR A;  1RTS A;  1JUJ A;  4DP3 A;  4GYH A;  4JEF A;  1VZE A;  3BFI A;  2TDD A;  3UM6 A;  1BO7 A;  3IK1 A;  4ISW A;  2AAZ A;  2FTO X;  1HZW A;  4GD7 A;  2G8D A;  1AN5 A;  1TDA A;  1VZC A;  2A9W A;  3IJZ A;  2RD8 B;  4KPW A;  4KYA A;  2KCE A;  4FOX A;  5FCT A;  1F4D A;  5HS3 A;  1NJA A;  1EVF A;  3B5B A;  3GH2 X;  4FOA A;  2G8X A;  3QGT A;  4XSE A;  3QJ7 A;  4G6W X;  3UWL B;  4DQ1 A;  3BHR A;  1JG0 A;  3EGY X;  1SEJ A;  4IQB A;  3IRM A;  2VET A;  3N5G A;  1AJM A;  3TMS A;  1BP0 A;  1TVV A;  1B5D A;  4LRR A;  4ECK A;  1THY A;  2G86 A;  2ONB A;  3C06 A;  3EBU A;  1TDB A;  1AXW A;  1J3K C;  3ED7 A;  3DGA C;  4DPD A;  3UM5 A;  1VZB A;  1TJS A;  1LCE A;  4GEV A;  4KY4 A;  1BQ2 A;  3DL5 A;  1TSZ A;  1JMF A;  1KZI A;  1KCE A;  1NJB A;  3NRR A;  1BJG A;  1JTU A;  4FOG A;  1VZA A;  1HW3 A;  1TYS A;  3UM8 A;  2G89 A;  4XSD A;  4IRR A;  1TDU A;  1BPJ A;  1JU6 A;  3EF9 A;  1J3J C;  1F28 A;  3KJR A;  3QG2 A;  3BHL A;  1NJC A;  3IX6 A;  1TIS A;  1F4E A;  1JUT A;  3DG8 C;  4EB4 A;  5H38 A;  1BP6 A;  1EV8 A;  1JMH A;  3KJS A;  4E28 A;  1FFL A;  3INV A;  1TSV A;  1DNA A;  1JMG A;  2TDM A;  1BDU A;  4F2V A;  3CL9 A;  2FTQ A;  3V8H A;  1EV5 A;  3EJL A;  1TSN A;  1JMI A;  1TLC A;  1KZJ A;  3H9K A;  1I00 A;  1AIQ A;  1TSM A;  4IQQ A;  1B02 A;  1AOB A;  4H0R A;  1TSW A;  1TSY A;  4ISK A;  3DL6 A;  1BID A;  1B5E A;  1TSL A;  1TVW A;  3GH0 A;  4TMS A;  3IHI A;  1F4F A;  1B49 A; 
#chains in the Genus database with same CATH topology
 5H39 A;  1TLS A;  1LCB A;  1FWM A;  1NJD A;  2RD8 A;  3EHI X;  3GG5 A;  4H1I A;  4Q0E A;  5BY6 A;  5H3A A;  2VF0 A;  1BKP A;  1DDU A;  2RDA A;  1TDC A;  1BO8 A;  1J3I C;  3UWL A;  5WRN A;  1F4B A;  1NCE A;  2OIP A;  4PSG A;  3N5E A;  3KGB A;  4H0U A;  4O1X D;  4O7U A;  4KY8 A;  3HBB A;  4KNZ A;  2TSR A;  1TRG A;  1BSP A;  1JTQ A;  2BBQ A;  3CLB A;  1BKO A;  1F4C A;  1YPV A;  3C0A A;  3BGX A;  4EIN A;  2TSC A;  4O1X A;  1HVY A;  2H2Q A;  3EAW X;  1TVU A;  4E5O A;  3JSU A;  1CI7 A;  3IRO A;  4XSC A;  1TSX A;  3K2H A;  2G8A A;  1TSD A;  3IRN A;  3IK0 A;  4O1U A;  4EZ8 A;  5J7W A;  3B9H A;  1SYN A;  4UP1 A;  3HJ3 A;  3HB8 A;  3N5E B;  3BYX A;  3BZ0 A;  1NJE A;  1EVG A;  4FQS A;  3I3R A;  4Q0D A;  1HW4 A;  1LCA A;  4G2O X;  1BSF A;  2FTN A;  3BNZ A;  3EDW X;  4EIL A;  4FGT A;  1F4G A;  1QQQ A;  1VZD A;  3OB7 A;  4DPH A;  1QZF A;  1BQ1 A;  1ZPR A;  1RTS A;  1JUJ A;  4DP3 A;  4GYH A;  4JEF A;  1VZE A;  3BFI A;  2TDD A;  3UM6 A;  1BO7 A;  3IK1 A;  4ISW A;  2AAZ A;  2FTO X;  1HZW A;  4GD7 A;  2G8D A;  1AN5 A;  1TDA A;  1VZC A;  2A9W A;  3IJZ A;  2RD8 B;  4KPW A;  4KYA A;  2KCE A;  4FOX A;  5FCT A;  1F4D A;  5HS3 A;  1NJA A;  1EVF A;  3B5B A;  3GH2 X;  4FOA A;  2G8X A;  3QGT A;  4XSE A;  3QJ7 A;  4G6W X;  3UWL B;  4DQ1 A;  3BHR A;  1JG0 A;  3EGY X;  1SEJ A;  4IQB A;  3IRM A;  2VET A;  3N5G A;  1AJM A;  3TMS A;  1BP0 A;  1TVV A;  1B5D A;  4LRR A;  4ECK A;  1THY A;  2G86 A;  2ONB A;  3C06 A;  3EBU A;  1TDB A;  1AXW A;  1J3K C;  3ED7 A;  3DGA C;  4DPD A;  3UM5 A;  1VZB A;  1TJS A;  1LCE A;  4GEV A;  4KY4 A;  1BQ2 A;  3DL5 A;  1TSZ A;  1JMF A;  1KZI A;  1KCE A;  1NJB A;  3NRR A;  1BJG A;  1JTU A;  4FOG A;  1VZA A;  1HW3 A;  1TYS A;  3UM8 A;  2G89 A;  4XSD A;  4IRR A;  1TDU A;  1BPJ A;  1JU6 A;  3EF9 A;  1J3J C;  1F28 A;  3KJR A;  3QG2 A;  3BHL A;  1NJC A;  3IX6 A;  1TIS A;  1F4E A;  1JUT A;  3DG8 C;  4EB4 A;  5H38 A;  1BP6 A;  1EV8 A;  1JMH A;  3KJS A;  4E28 A;  1FFL A;  3INV A;  1TSV A;  1DNA A;  1JMG A;  2TDM A;  1BDU A;  4F2V A;  3CL9 A;  2FTQ A;  3V8H A;  1EV5 A;  3EJL A;  1TSN A;  1JMI A;  1TLC A;  1KZJ A;  3H9K A;  1I00 A;  1AIQ A;  1TSM A;  4IQQ A;  1B02 A;  1AOB A;  4H0R A;  1TSW A;  1TSY A;  4ISK A;  3DL6 A;  1BID A;  1B5E A;  1TSL A;  1TVW A;  3GH0 A;  4TMS A;  3IHI A;  1F4F A;  1B49 A; 
#chains in the Genus database with same CATH homology
 5H39 A;  1TLS A;  1LCB A;  1FWM A;  1NJD A;  2RD8 A;  3EHI X;  3GG5 A;  4H1I A;  4Q0E A;  5BY6 A;  5H3A A;  2VF0 A;  1BKP A;  1DDU A;  2RDA A;  1TDC A;  1BO8 A;  1J3I C;  3UWL A;  5WRN A;  1F4B A;  1NCE A;  2OIP A;  4PSG A;  3N5E A;  3KGB A;  4H0U A;  4O1X D;  4O7U A;  4KY8 A;  3HBB A;  4KNZ A;  2TSR A;  1TRG A;  1BSP A;  1JTQ A;  2BBQ A;  3CLB A;  1BKO A;  1F4C A;  1YPV A;  3C0A A;  3BGX A;  4EIN A;  2TSC A;  4O1X A;  1HVY A;  2H2Q A;  3EAW X;  1TVU A;  4E5O A;  3JSU A;  1CI7 A;  3IRO A;  4XSC A;  1TSX A;  3K2H A;  2G8A A;  1TSD A;  3IRN A;  3IK0 A;  4O1U A;  4EZ8 A;  5J7W A;  3B9H A;  1SYN A;  4UP1 A;  3HJ3 A;  3HB8 A;  3N5E B;  3BYX A;  3BZ0 A;  1NJE A;  1EVG A;  4FQS A;  3I3R A;  4Q0D A;  1HW4 A;  1LCA A;  4G2O X;  1BSF A;  2FTN A;  3BNZ A;  3EDW X;  4EIL A;  4FGT A;  1F4G A;  1QQQ A;  1VZD A;  3OB7 A;  4DPH A;  1QZF A;  1BQ1 A;  1ZPR A;  1RTS A;  1JUJ A;  4DP3 A;  4GYH A;  4JEF A;  1VZE A;  3BFI A;  2TDD A;  3UM6 A;  1BO7 A;  3IK1 A;  4ISW A;  2AAZ A;  2FTO X;  1HZW A;  4GD7 A;  2G8D A;  1AN5 A;  1TDA A;  1VZC A;  2A9W A;  3IJZ A;  2RD8 B;  4KPW A;  4KYA A;  2KCE A;  4FOX A;  5FCT A;  1F4D A;  5HS3 A;  1NJA A;  1EVF A;  3B5B A;  3GH2 X;  4FOA A;  2G8X A;  3QGT A;  4XSE A;  3QJ7 A;  4G6W X;  3UWL B;  4DQ1 A;  3BHR A;  1JG0 A;  3EGY X;  1SEJ A;  4IQB A;  3IRM A;  2VET A;  3N5G A;  1AJM A;  3TMS A;  1BP0 A;  1TVV A;  1B5D A;  4LRR A;  4ECK A;  1THY A;  2G86 A;  2ONB A;  3C06 A;  3EBU A;  1TDB A;  1AXW A;  1J3K C;  3ED7 A;  3DGA C;  4DPD A;  3UM5 A;  1VZB A;  1TJS A;  1LCE A;  4GEV A;  4KY4 A;  1BQ2 A;  3DL5 A;  1TSZ A;  1JMF A;  1KZI A;  1KCE A;  1NJB A;  3NRR A;  1BJG A;  1JTU A;  4FOG A;  1VZA A;  1HW3 A;  1TYS A;  3UM8 A;  2G89 A;  4XSD A;  4IRR A;  1TDU A;  1BPJ A;  1JU6 A;  3EF9 A;  1J3J C;  1F28 A;  3KJR A;  3QG2 A;  3BHL A;  1NJC A;  3IX6 A;  1TIS A;  1F4E A;  1JUT A;  3DG8 C;  4EB4 A;  5H38 A;  1BP6 A;  1EV8 A;  1JMH A;  3KJS A;  4E28 A;  1FFL A;  3INV A;  1TSV A;  1DNA A;  1JMG A;  2TDM A;  1BDU A;  4F2V A;  3CL9 A;  2FTQ A;  3V8H A;  1EV5 A;  3EJL A;  1TSN A;  1JMI A;  1TLC A;  1KZJ A;  3H9K A;  1I00 A;  1AIQ A;  1TSM A;  4IQQ A;  1B02 A;  1AOB A;  4H0R A;  1TSW A;  1TSY A;  4ISK A;  3DL6 A;  1BID A;  1B5E A;  1TSL A;  1TVW A;  3GH0 A;  4TMS A;  3IHI A;  1F4F A;  1B49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...