4PSGA

Crystal structure of c.elegans thymidylate synthase in complex with an inhibitor n(4)ohdcmp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
289
structure length
289
Chain Sequence
QVHLNQDEYKYLKQVEQILREGTRRDDRTGTGTISIFGMQSKYCLRNGTIPLLTTKRVYWKGVLEELLWFISGSTDGKLLMEKNVKIWEKNGDRAFLDNLGFTSREEGDLGPVYGFQWRHFGAKYVDCHTDYSGQGVDQLAEVIRQIKEQPDSRRIIMSAWNPSDLGQMVLPPCHTMCQFYVDNGELSCQLYQRSGDMGLGVPFNLASYGLLTHMIAKVCGLKPGTLVHTLGDAHVYSNHVDALKIQLDREPYAFPKIRFTRDVASIDDFTSDMIALDDYKCHPKIPMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate synthase
publication title Crystal Structure of C.elegans Thymidylate Synthase in complex with an inhibitor N(4)OHdCMP
rcsb
source organism Caenorhabditis elegans
total genus 91
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2014-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4psgA00
5BY6A 1NJEA 3KJSA 2OIPA 1TSLA 3INVA 1EV5A 1ZPRA 1BP6A 1BPJA 1TSZA 4XSEA 4PSGA 1TRGA 2H2QA 1F28A 1VZEA 3C06A 4FOAA 1KZJA 1TSWA 2TDDA 3EAWX 3IROA 1B49A 1VZDA 3BFIA 5FCTA 1HZWA 1JMHA 1LCEA 2RDAA 3CLBA 4G6WX 1NJCA 5H38A 1B5DA 3UWLB 3EGYX 1JUTA 4EILA 4KY4A 1FWMA 1TDCA 4FGTA 1AOBA 3IK1A 4FOXA 4Q0EA 4EINA 1QZFA 1TSDA 2VETA 4EZ8A 3ED7A 3IK0A 1JTUA 1F4FA 4XSDA 4G2OX 3H9KA 4KYAA 5H39A 1KCEA 4FOGA 4IQQA 2TSCA 3HJ3A 3OB7A 1TVUA 1F4DA 2A9WA 1JMFA 1BKOA 2G89A 4DQ1A 3UM5A 1I00A 1BQ1A 5J7WA 1TJSA 2BBQA 1AIQA 1J3JC 4KY8A 4O1XA 1BO7A 1TSMA 1CI7A 1NCEA 1HW3A 1TVVA 3NRRA 4DPHA 5H3AA 1TSVA 4E5OA 4EB4A 4JEFA 2G86A 2TDMA 4ISWA 4Q0DA 4LRRA 3BGXA 4O7UA 1DDUA 3DL5A 3B9HA 2RD8A 1BQ2A 3QG2A 1NJAA 5HS3A 2TSRA 3K2HA 4GYHA 2KCEA 2RD8B 1TSNA 3GH2X 1BDUA 1VZAA 3N5EA 1J3KC 1QQQA 1TLCA 4H0RA 1VZBA 1F4CA 3N5EB 1DNAA 2FTNA 1JTQA 1SYNA 4ISKA 4DP3A 3IHIA 3C0AA 1TSYA 3IJZA 3BNZA 1SEJA 3QJ7A 1BO8A 3TMSA 1LCAA 4H0UA 2FTQA 3CL9A 1YPVA 1AN5A 1TSXA 1BSPA 3HB8A 3UM8A 1EVFA 1BSFA 1EVGA 4ECKA 4O1UA 2VF0A 3BHRA 3GH0A 3QGTA 1BJGA 1JG0A 1TLSA 1JMGA 4IQBA 3UM6A 1BKPA 4KPWA 3KJRA 3IRNA 1F4BA 1AJMA 1HW4A 2AAZA 4GEVA 1B5EA 1TDAA 1J3IC 3V8HA 1EV8A 3BHLA 4GD7A 4IRRA 3DL6A 4O1XD 1NJBA 1AXWA 2G8AA 3BYXA 3IX6A 3EF9A 1TVWA 1TDUA 4FQSA 3EHIX 3N5GA 3HBBA 1JMIA 2FTOX 3EBUA 2ONBA 4TMSA 3BZ0A 1JUJA 3EDWX 1NJDA 1THYA 3JSUA 1BIDA 4UP1A 4F2VA 4E28A 3IRMA 1TYSA 1JU6A 3I3RA 3UWLA 1TDBA 4H1IA 1LCBA 3EJLA 1KZIA 1BP0A 1F4EA 3DG8C 1RTSA 1F4GA 4KNZA 1VZCA 1TISA 3B5BA 3GG5A 1FFLA 4XSCA 5WRNA 1B02A 2G8XA 3KGBA 4DPDA 1HVYA 2G8DA 3DGAC
chains in the Genus database with same CATH superfamily
5BY6A 1NJEA 3KJSA 2OIPA 1TSLA 3INVA 1EV5A 1ZPRA 1BP6A 1BPJA 1TSZA 4XSEA 4PSGA 1TRGA 2H2QA 1F28A 1VZEA 3C06A 4FOAA 1KZJA 1TSWA 2TDDA 3EAWX 3IROA 1B49A 1VZDA 3BFIA 5FCTA 1HZWA 1JMHA 1LCEA 2RDAA 3CLBA 4G6WX 1NJCA 5H38A 1B5DA 3UWLB 3EGYX 1JUTA 4EILA 4KY4A 1FWMA 1TDCA 4FGTA 1AOBA 3IK1A 4FOXA 4Q0EA 4EINA 1QZFA 1TSDA 2VETA 4EZ8A 3ED7A 3IK0A 1JTUA 1F4FA 4XSDA 4G2OX 3H9KA 4KYAA 5H39A 1KCEA 4FOGA 4IQQA 2TSCA 3HJ3A 3OB7A 1TVUA 1F4DA 2A9WA 1JMFA 1BKOA 2G89A 4DQ1A 3UM5A 1I00A 1BQ1A 5J7WA 1TJSA 2BBQA 1AIQA 1J3JC 4KY8A 4O1XA 1BO7A 1TSMA 1CI7A 1NCEA 1HW3A 1TVVA 3NRRA 4DPHA 5H3AA 1TSVA 4E5OA 4EB4A 4JEFA 2G86A 2TDMA 4ISWA 4Q0DA 4LRRA 3BGXA 4O7UA 1DDUA 3DL5A 3B9HA 2RD8A 1BQ2A 3QG2A 1NJAA 5HS3A 2TSRA 3K2HA 4GYHA 2KCEA 2RD8B 1TSNA 3GH2X 1BDUA 1VZAA 3N5EA 1J3KC 1QQQA 1TLCA 4H0RA 1VZBA 1F4CA 3N5EB 1DNAA 2FTNA 1JTQA 1SYNA 4ISKA 4DP3A 3IHIA 3C0AA 1TSYA 3IJZA 3BNZA 1SEJA 3QJ7A 1BO8A 3TMSA 1LCAA 4H0UA 2FTQA 3CL9A 1YPVA 1AN5A 1TSXA 1BSPA 3HB8A 3UM8A 1EVFA 1BSFA 1EVGA 4ECKA 4O1UA 2VF0A 3BHRA 3GH0A 3QGTA 1BJGA 1JG0A 1TLSA 1JMGA 4IQBA 3UM6A 1BKPA 4KPWA 3KJRA 3IRNA 1F4BA 1AJMA 1HW4A 2AAZA 4GEVA 1B5EA 1TDAA 1J3IC 3V8HA 1EV8A 3BHLA 4GD7A 4IRRA 3DL6A 4O1XD 1NJBA 1AXWA 2G8AA 3BYXA 3IX6A 3EF9A 1TVWA 1TDUA 4FQSA 3EHIX 3N5GA 3HBBA 1JMIA 2FTOX 3EBUA 2ONBA 4TMSA 3BZ0A 1JUJA 3EDWX 1NJDA 1THYA 3JSUA 1BIDA 4UP1A 4F2VA 4E28A 3IRMA 1TYSA 1JU6A 3I3RA 3UWLA 1TDBA 4H1IA 1LCBA 3EJLA 1KZIA 1BP0A 1F4EA 3DG8C 1RTSA 1F4GA 4KNZA 1VZCA 1TISA 3B5BA 3GG5A 1FFLA 4XSCA 5WRNA 1B02A 2G8XA 3KGBA 4DPDA 1HVYA 2G8DA 3DGAC
chains in the Genus database with same CATH topology
5BY6A 1NJEA 3KJSA 2OIPA 1TSLA 3INVA 1EV5A 1ZPRA 1BP6A 1BPJA 1TSZA 4XSEA 4PSGA 1TRGA 2H2QA 1F28A 1VZEA 3C06A 4FOAA 1KZJA 1TSWA 2TDDA 3EAWX 3IROA 1B49A 1VZDA 3BFIA 5FCTA 1HZWA 1JMHA 1LCEA 2RDAA 3CLBA 4G6WX 1NJCA 5H38A 1B5DA 3UWLB 3EGYX 1JUTA 4EILA 4KY4A 1FWMA 1TDCA 4FGTA 1AOBA 3IK1A 4FOXA 4Q0EA 4EINA 1QZFA 1TSDA 2VETA 4EZ8A 3ED7A 3IK0A 1JTUA 1F4FA 4XSDA 4G2OX 3H9KA 4KYAA 5H39A 1KCEA 4FOGA 4IQQA 2TSCA 3HJ3A 3OB7A 1TVUA 1F4DA 2A9WA 1JMFA 1BKOA 2G89A 4DQ1A 3UM5A 1I00A 1BQ1A 5J7WA 1TJSA 2BBQA 1AIQA 1J3JC 4KY8A 4O1XA 1BO7A 1TSMA 1CI7A 1NCEA 1HW3A 1TVVA 3NRRA 4DPHA 5H3AA 1TSVA 4E5OA 4EB4A 4JEFA 2G86A 2TDMA 4ISWA 4Q0DA 4LRRA 3BGXA 4O7UA 1DDUA 3DL5A 3B9HA 2RD8A 1BQ2A 3QG2A 1NJAA 5HS3A 2TSRA 3K2HA 4GYHA 2KCEA 2RD8B 1TSNA 3GH2X 1BDUA 1VZAA 3N5EA 1J3KC 1QQQA 1TLCA 4H0RA 1VZBA 1F4CA 3N5EB 1DNAA 2FTNA 1JTQA 1SYNA 4ISKA 4DP3A 3IHIA 3C0AA 1TSYA 3IJZA 3BNZA 1SEJA 3QJ7A 1BO8A 3TMSA 1LCAA 4H0UA 2FTQA 3CL9A 1YPVA 1AN5A 1TSXA 1BSPA 3HB8A 3UM8A 1EVFA 1BSFA 1EVGA 4ECKA 4O1UA 2VF0A 3BHRA 3GH0A 3QGTA 1BJGA 1JG0A 1TLSA 1JMGA 4IQBA 3UM6A 1BKPA 4KPWA 3KJRA 3IRNA 1F4BA 1AJMA 1HW4A 2AAZA 4GEVA 1B5EA 1TDAA 1J3IC 3V8HA 1EV8A 3BHLA 4GD7A 4IRRA 3DL6A 4O1XD 1NJBA 1AXWA 2G8AA 3BYXA 3IX6A 3EF9A 1TVWA 1TDUA 4FQSA 3EHIX 3N5GA 3HBBA 1JMIA 2FTOX 3EBUA 2ONBA 4TMSA 3BZ0A 1JUJA 3EDWX 1NJDA 1THYA 3JSUA 1BIDA 4UP1A 4F2VA 4E28A 3IRMA 1TYSA 1JU6A 3I3RA 3UWLA 1TDBA 4H1IA 1LCBA 3EJLA 1KZIA 1BP0A 1F4EA 3DG8C 1RTSA 1F4GA 4KNZA 1VZCA 1TISA 3B5BA 3GG5A 1FFLA 4XSCA 5WRNA 1B02A 2G8XA 3KGBA 4DPDA 1HVYA 2G8DA 3DGAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BY6 A;  1NJE A;  3KJS A;  2OIP A;  1TSL A;  3INV A;  1EV5 A;  1ZPR A;  1BP6 A;  1BPJ A;  1TSZ A;  4XSE A;  4PSG A;  1TRG A;  2H2Q A;  1F28 A;  1VZE A;  3C06 A;  4FOA A;  1KZJ A;  1TSW A;  2TDD A;  3EAW X;  3IRO A;  1B49 A;  1VZD A;  3BFI A;  5FCT A;  1HZW A;  1JMH A;  1LCE A;  2RDA A;  3CLB A;  4G6W X;  1NJC A;  5H38 A;  1B5D A;  3UWL B;  3EGY X;  1JUT A;  4EIL A;  4KY4 A;  1FWM A;  1TDC A;  4FGT A;  1AOB A;  3IK1 A;  4FOX A;  4Q0E A;  4EIN A;  1QZF A;  1TSD A;  2VET A;  4EZ8 A;  3ED7 A;  3IK0 A;  1JTU A;  1F4F A;  4XSD A;  4G2O X;  3H9K A;  4KYA A;  5H39 A;  1KCE A;  4FOG A;  4IQQ A;  2TSC A;  3HJ3 A;  3OB7 A;  1TVU A;  1F4D A;  2A9W A;  1JMF A;  1BKO A;  2G89 A;  4DQ1 A;  3UM5 A;  1I00 A;  1BQ1 A;  5J7W A;  1TJS A;  2BBQ A;  1AIQ A;  1J3J C;  4KY8 A;  4O1X A;  1BO7 A;  1TSM A;  1CI7 A;  1NCE A;  1HW3 A;  1TVV A;  3NRR A;  4DPH A;  5H3A A;  1TSV A;  4E5O A;  4EB4 A;  4JEF A;  2G86 A;  2TDM A;  4ISW A;  4Q0D A;  4LRR A;  3BGX A;  4O7U A;  1DDU A;  3DL5 A;  3B9H A;  2RD8 A;  1BQ2 A;  3QG2 A;  1NJA A;  5HS3 A;  2TSR A;  3K2H A;  4GYH A;  2KCE A;  2RD8 B;  1TSN A;  3GH2 X;  1BDU A;  1VZA A;  3N5E A;  1J3K C;  1QQQ A;  1TLC A;  4H0R A;  1VZB A;  1F4C A;  3N5E B;  1DNA A;  2FTN A;  1JTQ A;  1SYN A;  4ISK A;  4DP3 A;  3IHI A;  3C0A A;  1TSY A;  3IJZ A;  3BNZ A;  1SEJ A;  3QJ7 A;  1BO8 A;  3TMS A;  1LCA A;  4H0U A;  2FTQ A;  3CL9 A;  1YPV A;  1AN5 A;  1TSX A;  1BSP A;  3HB8 A;  3UM8 A;  1EVF A;  1BSF A;  1EVG A;  4ECK A;  4O1U A;  2VF0 A;  3BHR A;  3GH0 A;  3QGT A;  1BJG A;  1JG0 A;  1TLS A;  1JMG A;  4IQB A;  3UM6 A;  1BKP A;  4KPW A;  3KJR A;  3IRN A;  1F4B A;  1AJM A;  1HW4 A;  2AAZ A;  4GEV A;  1B5E A;  1TDA A;  1J3I C;  3V8H A;  1EV8 A;  3BHL A;  4GD7 A;  4IRR A;  3DL6 A;  4O1X D;  1NJB A;  1AXW A;  2G8A A;  3BYX A;  3IX6 A;  3EF9 A;  1TVW A;  1TDU A;  4FQS A;  3EHI X;  3N5G A;  3HBB A;  1JMI A;  2FTO X;  3EBU A;  2ONB A;  4TMS A;  3BZ0 A;  1JUJ A;  3EDW X;  1NJD A;  1THY A;  3JSU A;  1BID A;  4UP1 A;  4F2V A;  4E28 A;  3IRM A;  1TYS A;  1JU6 A;  3I3R A;  3UWL A;  1TDB A;  4H1I A;  1LCB A;  3EJL A;  1KZI A;  1BP0 A;  1F4E A;  3DG8 C;  1RTS A;  1F4G A;  4KNZ A;  1VZC A;  1TIS A;  3B5B A;  3GG5 A;  1FFL A;  4XSC A;  5WRN A;  1B02 A;  2G8X A;  3KGB A;  4DPD A;  1HVY A;  2G8D A;  3DGA C; 
#chains in the Genus database with same CATH topology
 5BY6 A;  1NJE A;  3KJS A;  2OIP A;  1TSL A;  3INV A;  1EV5 A;  1ZPR A;  1BP6 A;  1BPJ A;  1TSZ A;  4XSE A;  4PSG A;  1TRG A;  2H2Q A;  1F28 A;  1VZE A;  3C06 A;  4FOA A;  1KZJ A;  1TSW A;  2TDD A;  3EAW X;  3IRO A;  1B49 A;  1VZD A;  3BFI A;  5FCT A;  1HZW A;  1JMH A;  1LCE A;  2RDA A;  3CLB A;  4G6W X;  1NJC A;  5H38 A;  1B5D A;  3UWL B;  3EGY X;  1JUT A;  4EIL A;  4KY4 A;  1FWM A;  1TDC A;  4FGT A;  1AOB A;  3IK1 A;  4FOX A;  4Q0E A;  4EIN A;  1QZF A;  1TSD A;  2VET A;  4EZ8 A;  3ED7 A;  3IK0 A;  1JTU A;  1F4F A;  4XSD A;  4G2O X;  3H9K A;  4KYA A;  5H39 A;  1KCE A;  4FOG A;  4IQQ A;  2TSC A;  3HJ3 A;  3OB7 A;  1TVU A;  1F4D A;  2A9W A;  1JMF A;  1BKO A;  2G89 A;  4DQ1 A;  3UM5 A;  1I00 A;  1BQ1 A;  5J7W A;  1TJS A;  2BBQ A;  1AIQ A;  1J3J C;  4KY8 A;  4O1X A;  1BO7 A;  1TSM A;  1CI7 A;  1NCE A;  1HW3 A;  1TVV A;  3NRR A;  4DPH A;  5H3A A;  1TSV A;  4E5O A;  4EB4 A;  4JEF A;  2G86 A;  2TDM A;  4ISW A;  4Q0D A;  4LRR A;  3BGX A;  4O7U A;  1DDU A;  3DL5 A;  3B9H A;  2RD8 A;  1BQ2 A;  3QG2 A;  1NJA A;  5HS3 A;  2TSR A;  3K2H A;  4GYH A;  2KCE A;  2RD8 B;  1TSN A;  3GH2 X;  1BDU A;  1VZA A;  3N5E A;  1J3K C;  1QQQ A;  1TLC A;  4H0R A;  1VZB A;  1F4C A;  3N5E B;  1DNA A;  2FTN A;  1JTQ A;  1SYN A;  4ISK A;  4DP3 A;  3IHI A;  3C0A A;  1TSY A;  3IJZ A;  3BNZ A;  1SEJ A;  3QJ7 A;  1BO8 A;  3TMS A;  1LCA A;  4H0U A;  2FTQ A;  3CL9 A;  1YPV A;  1AN5 A;  1TSX A;  1BSP A;  3HB8 A;  3UM8 A;  1EVF A;  1BSF A;  1EVG A;  4ECK A;  4O1U A;  2VF0 A;  3BHR A;  3GH0 A;  3QGT A;  1BJG A;  1JG0 A;  1TLS A;  1JMG A;  4IQB A;  3UM6 A;  1BKP A;  4KPW A;  3KJR A;  3IRN A;  1F4B A;  1AJM A;  1HW4 A;  2AAZ A;  4GEV A;  1B5E A;  1TDA A;  1J3I C;  3V8H A;  1EV8 A;  3BHL A;  4GD7 A;  4IRR A;  3DL6 A;  4O1X D;  1NJB A;  1AXW A;  2G8A A;  3BYX A;  3IX6 A;  3EF9 A;  1TVW A;  1TDU A;  4FQS A;  3EHI X;  3N5G A;  3HBB A;  1JMI A;  2FTO X;  3EBU A;  2ONB A;  4TMS A;  3BZ0 A;  1JUJ A;  3EDW X;  1NJD A;  1THY A;  3JSU A;  1BID A;  4UP1 A;  4F2V A;  4E28 A;  3IRM A;  1TYS A;  1JU6 A;  3I3R A;  3UWL A;  1TDB A;  4H1I A;  1LCB A;  3EJL A;  1KZI A;  1BP0 A;  1F4E A;  3DG8 C;  1RTS A;  1F4G A;  4KNZ A;  1VZC A;  1TIS A;  3B5B A;  3GG5 A;  1FFL A;  4XSC A;  5WRN A;  1B02 A;  2G8X A;  3KGB A;  4DPD A;  1HVY A;  2G8D A;  3DGA C; 
#chains in the Genus database with same CATH homology
 5BY6 A;  1NJE A;  3KJS A;  2OIP A;  1TSL A;  3INV A;  1EV5 A;  1ZPR A;  1BP6 A;  1BPJ A;  1TSZ A;  4XSE A;  4PSG A;  1TRG A;  2H2Q A;  1F28 A;  1VZE A;  3C06 A;  4FOA A;  1KZJ A;  1TSW A;  2TDD A;  3EAW X;  3IRO A;  1B49 A;  1VZD A;  3BFI A;  5FCT A;  1HZW A;  1JMH A;  1LCE A;  2RDA A;  3CLB A;  4G6W X;  1NJC A;  5H38 A;  1B5D A;  3UWL B;  3EGY X;  1JUT A;  4EIL A;  4KY4 A;  1FWM A;  1TDC A;  4FGT A;  1AOB A;  3IK1 A;  4FOX A;  4Q0E A;  4EIN A;  1QZF A;  1TSD A;  2VET A;  4EZ8 A;  3ED7 A;  3IK0 A;  1JTU A;  1F4F A;  4XSD A;  4G2O X;  3H9K A;  4KYA A;  5H39 A;  1KCE A;  4FOG A;  4IQQ A;  2TSC A;  3HJ3 A;  3OB7 A;  1TVU A;  1F4D A;  2A9W A;  1JMF A;  1BKO A;  2G89 A;  4DQ1 A;  3UM5 A;  1I00 A;  1BQ1 A;  5J7W A;  1TJS A;  2BBQ A;  1AIQ A;  1J3J C;  4KY8 A;  4O1X A;  1BO7 A;  1TSM A;  1CI7 A;  1NCE A;  1HW3 A;  1TVV A;  3NRR A;  4DPH A;  5H3A A;  1TSV A;  4E5O A;  4EB4 A;  4JEF A;  2G86 A;  2TDM A;  4ISW A;  4Q0D A;  4LRR A;  3BGX A;  4O7U A;  1DDU A;  3DL5 A;  3B9H A;  2RD8 A;  1BQ2 A;  3QG2 A;  1NJA A;  5HS3 A;  2TSR A;  3K2H A;  4GYH A;  2KCE A;  2RD8 B;  1TSN A;  3GH2 X;  1BDU A;  1VZA A;  3N5E A;  1J3K C;  1QQQ A;  1TLC A;  4H0R A;  1VZB A;  1F4C A;  3N5E B;  1DNA A;  2FTN A;  1JTQ A;  1SYN A;  4ISK A;  4DP3 A;  3IHI A;  3C0A A;  1TSY A;  3IJZ A;  3BNZ A;  1SEJ A;  3QJ7 A;  1BO8 A;  3TMS A;  1LCA A;  4H0U A;  2FTQ A;  3CL9 A;  1YPV A;  1AN5 A;  1TSX A;  1BSP A;  3HB8 A;  3UM8 A;  1EVF A;  1BSF A;  1EVG A;  4ECK A;  4O1U A;  2VF0 A;  3BHR A;  3GH0 A;  3QGT A;  1BJG A;  1JG0 A;  1TLS A;  1JMG A;  4IQB A;  3UM6 A;  1BKP A;  4KPW A;  3KJR A;  3IRN A;  1F4B A;  1AJM A;  1HW4 A;  2AAZ A;  4GEV A;  1B5E A;  1TDA A;  1J3I C;  3V8H A;  1EV8 A;  3BHL A;  4GD7 A;  4IRR A;  3DL6 A;  4O1X D;  1NJB A;  1AXW A;  2G8A A;  3BYX A;  3IX6 A;  3EF9 A;  1TVW A;  1TDU A;  4FQS A;  3EHI X;  3N5G A;  3HBB A;  1JMI A;  2FTO X;  3EBU A;  2ONB A;  4TMS A;  3BZ0 A;  1JUJ A;  3EDW X;  1NJD A;  1THY A;  3JSU A;  1BID A;  4UP1 A;  4F2V A;  4E28 A;  3IRM A;  1TYS A;  1JU6 A;  3I3R A;  3UWL A;  1TDB A;  4H1I A;  1LCB A;  3EJL A;  1KZI A;  1BP0 A;  1F4E A;  3DG8 C;  1RTS A;  1F4G A;  4KNZ A;  1VZC A;  1TIS A;  3B5B A;  3GG5 A;  1FFL A;  4XSC A;  5WRN A;  1B02 A;  2G8X A;  3KGB A;  4DPD A;  1HVY A;  2G8D A;  3DGA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...