4TMSA

Plastic adaptation toward mutations in proteins: structural comparison of thymidylate synthases
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
316
structure length
316
Chain Sequence
MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSKGFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTSKGDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVNDGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDFDMKDIKLLNYDPYPAIKAPVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase (methyltransferase)
molecule keywords THYMIDYLATE SYNTHASE
publication title Plastic adaptation toward mutations in proteins: structural comparison of thymidylate synthases.
pubmed doi rcsb
source organism Lactobacillus casei
total genus 103
structure length 316
sequence length 316
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 1992-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4tmsA00
1TVWA 3TMSA 1BSPA 1TLCA 3C0AA 3IX6A 3JSUA 1TSMA 1TSXA 4DP3A 1RTSA 1DNAA 1KZIA 1TSZA 2KCEA 1CI7A 1NJBA 3V8HA 3IRMA 4EILA 1B5DA 2G8XA 1B49A 1BDUA 4FOGA 4H0UA 4F2VA 1BSFA 1YPVA 3EAWX 3GG5A 4KYAA 5WRNA 1B02A 4ISKA 1TVVA 3EF9A 1BO7A 3QJ7A 1BP0A 1LCBA 1BQ2A 1HW3A 1NCEA 3IHIA 4G6WX 1BO8A 1HZWA 3IRNA 5H39A 4TMSA 1TRGA 4DPDA 1AIQA 4E28A 3DGAC 1TISA 2FTQA 4IRRA 3BZ0A 3UM8A 4XSEA 3DL5A 4E5OA 3UWLA 2H2QA 2RD8A 3EDWX 1F28A 4O1XA 4H0RA 2FTOX 4O1UA 3INVA 1BJGA 1EVFA 1TVUA 2OIPA 1NJCA 3B5BA 3UM5A 1TDAA 4LRRA 1TJSA 3GH2X 3QG2A 4GD7A 4XSDA 1VZBA 1FWMA 2G89A 3OB7A 2VF0A 1AOBA 1I00A 1TLSA 2FTNA 2TDDA 2TSCA 1TDCA 2TDMA 3ED7A 1HW4A 3I3RA 3N5EB 3H9KA 3BYXA 4UP1A 1BQ1A 1SEJA 2AAZA 3CL9A 3EHIX 5FCTA 1HVYA 1F4DA 1LCEA 2A9WA 4JEFA 1F4CA 4G2OX 4KNZA 3C06A 3UM6A 1JUTA 5HS3A 1DDUA 1NJAA 1QQQA 1TSDA 4H1IA 2G8AA 1F4EA 1KCEA 1TSVA 3BFIA 1EV8A 4FOXA 3QGTA 4PSGA 1KZJA 5H3AA 1TSYA 1F4FA 1JMHA 1VZCA 4DPHA 1JMFA 4ISWA 1BPJA 2G86A 1TYSA 3BGXA 4KPWA 4ECKA 1JUJA 1NJEA 3HB8A 1J3IC 3NRRA 1JTQA 2TSRA 1J3KC 1F4GA 1FFLA 1JMGA 1J3JC 2BBQA 5BY6A 1AXWA 2RDAA 4KY4A 3BHRA 3KJRA 1NJDA 4EB4A 1AN5A 4Q0EA 4GEVA 4EZ8A 3EJLA 3IROA 1TSNA 2ONBA 4FQSA 1LCAA 2G8DA 1THYA 3N5GA 1TDUA 3EGYX 3IK0A 1TDBA 2VETA 1TSLA 4IQBA 1JG0A 1B5EA 1BP6A 1QZFA 4Q0DA 3HJ3A 5J7WA 1BIDA 1SYNA 4EINA 3N5EA 1AJMA 4GYHA 1BKPA 4O7UA 3B9HA 4XSCA 3CLBA 3UWLB 3GH0A 2RD8B 3BNZA 3IJZA 1BKOA 3DG8C 3HBBA 4FGTA 1JU6A 4KY8A 4IQQA 1F4BA 1JMIA 4DQ1A 4FOAA 3IK1A 3KJSA 5H38A 4O1XD 3BHLA 1VZEA 3KGBA 3EBUA 1VZAA 3DL6A 1EV5A 1TSWA 3K2HA 1JTUA 1EVGA 1ZPRA 1VZDA
chains in the Genus database with same CATH superfamily
1TVWA 3TMSA 1BSPA 1TLCA 3C0AA 3IX6A 3JSUA 1TSMA 1TSXA 4DP3A 1RTSA 1DNAA 1KZIA 1TSZA 2KCEA 1CI7A 1NJBA 3V8HA 3IRMA 4EILA 1B5DA 2G8XA 1B49A 1BDUA 4FOGA 4H0UA 4F2VA 1BSFA 1YPVA 3EAWX 3GG5A 4KYAA 5WRNA 1B02A 4ISKA 1TVVA 3EF9A 1BO7A 3QJ7A 1BP0A 1LCBA 1BQ2A 1HW3A 1NCEA 3IHIA 4G6WX 1BO8A 1HZWA 3IRNA 5H39A 4TMSA 1TRGA 4DPDA 1AIQA 4E28A 3DGAC 1TISA 2FTQA 4IRRA 3BZ0A 3UM8A 4XSEA 3DL5A 4E5OA 3UWLA 2H2QA 2RD8A 3EDWX 1F28A 4O1XA 4H0RA 2FTOX 4O1UA 3INVA 1BJGA 1EVFA 1TVUA 2OIPA 1NJCA 3B5BA 3UM5A 1TDAA 4LRRA 1TJSA 3GH2X 3QG2A 4GD7A 4XSDA 1VZBA 1FWMA 2G89A 3OB7A 2VF0A 1AOBA 1I00A 1TLSA 2FTNA 2TDDA 2TSCA 1TDCA 2TDMA 3ED7A 1HW4A 3I3RA 3N5EB 3H9KA 3BYXA 4UP1A 1BQ1A 1SEJA 2AAZA 3CL9A 3EHIX 5FCTA 1HVYA 1F4DA 1LCEA 2A9WA 4JEFA 1F4CA 4G2OX 4KNZA 3C06A 3UM6A 1JUTA 5HS3A 1DDUA 1NJAA 1QQQA 1TSDA 4H1IA 2G8AA 1F4EA 1KCEA 1TSVA 3BFIA 1EV8A 4FOXA 3QGTA 4PSGA 1KZJA 5H3AA 1TSYA 1F4FA 1JMHA 1VZCA 4DPHA 1JMFA 4ISWA 1BPJA 2G86A 1TYSA 3BGXA 4KPWA 4ECKA 1JUJA 1NJEA 3HB8A 1J3IC 3NRRA 1JTQA 2TSRA 1J3KC 1F4GA 1FFLA 1JMGA 1J3JC 2BBQA 5BY6A 1AXWA 2RDAA 4KY4A 3BHRA 3KJRA 1NJDA 4EB4A 1AN5A 4Q0EA 4GEVA 4EZ8A 3EJLA 3IROA 1TSNA 2ONBA 4FQSA 1LCAA 2G8DA 1THYA 3N5GA 1TDUA 3EGYX 3IK0A 1TDBA 2VETA 1TSLA 4IQBA 1JG0A 1B5EA 1BP6A 1QZFA 4Q0DA 3HJ3A 5J7WA 1BIDA 1SYNA 4EINA 3N5EA 1AJMA 4GYHA 1BKPA 4O7UA 3B9HA 4XSCA 3CLBA 3UWLB 3GH0A 2RD8B 3BNZA 3IJZA 1BKOA 3DG8C 3HBBA 4FGTA 1JU6A 4KY8A 4IQQA 1F4BA 1JMIA 4DQ1A 4FOAA 3IK1A 3KJSA 5H38A 4O1XD 3BHLA 1VZEA 3KGBA 3EBUA 1VZAA 3DL6A 1EV5A 1TSWA 3K2HA 1JTUA 1EVGA 1ZPRA 1VZDA
chains in the Genus database with same CATH topology
1TVWA 3TMSA 1BSPA 1TLCA 3C0AA 3IX6A 3JSUA 1TSMA 1TSXA 4DP3A 1RTSA 1DNAA 1KZIA 1TSZA 2KCEA 1CI7A 1NJBA 3V8HA 3IRMA 4EILA 1B5DA 2G8XA 1B49A 1BDUA 4FOGA 4H0UA 4F2VA 1BSFA 1YPVA 3EAWX 3GG5A 4KYAA 5WRNA 1B02A 4ISKA 1TVVA 3EF9A 1BO7A 3QJ7A 1BP0A 1LCBA 1BQ2A 1HW3A 1NCEA 3IHIA 4G6WX 1BO8A 1HZWA 3IRNA 5H39A 4TMSA 1TRGA 4DPDA 1AIQA 4E28A 3DGAC 1TISA 2FTQA 4IRRA 3BZ0A 3UM8A 4XSEA 3DL5A 4E5OA 3UWLA 2H2QA 2RD8A 3EDWX 1F28A 4O1XA 4H0RA 2FTOX 4O1UA 3INVA 1BJGA 1EVFA 1TVUA 2OIPA 1NJCA 3B5BA 3UM5A 1TDAA 4LRRA 1TJSA 3GH2X 3QG2A 4GD7A 4XSDA 1VZBA 1FWMA 2G89A 3OB7A 2VF0A 1AOBA 1I00A 1TLSA 2FTNA 2TDDA 2TSCA 1TDCA 2TDMA 3ED7A 1HW4A 3I3RA 3N5EB 3H9KA 3BYXA 4UP1A 1BQ1A 1SEJA 2AAZA 3CL9A 3EHIX 5FCTA 1HVYA 1F4DA 1LCEA 2A9WA 4JEFA 1F4CA 4G2OX 4KNZA 3C06A 3UM6A 1JUTA 5HS3A 1DDUA 1NJAA 1QQQA 1TSDA 4H1IA 2G8AA 1F4EA 1KCEA 1TSVA 3BFIA 1EV8A 4FOXA 3QGTA 4PSGA 1KZJA 5H3AA 1TSYA 1F4FA 1JMHA 1VZCA 4DPHA 1JMFA 4ISWA 1BPJA 2G86A 1TYSA 3BGXA 4KPWA 4ECKA 1JUJA 1NJEA 3HB8A 1J3IC 3NRRA 1JTQA 2TSRA 1J3KC 1F4GA 1FFLA 1JMGA 1J3JC 2BBQA 5BY6A 1AXWA 2RDAA 4KY4A 3BHRA 3KJRA 1NJDA 4EB4A 1AN5A 4Q0EA 4GEVA 4EZ8A 3EJLA 3IROA 1TSNA 2ONBA 4FQSA 1LCAA 2G8DA 1THYA 3N5GA 1TDUA 3EGYX 3IK0A 1TDBA 2VETA 1TSLA 4IQBA 1JG0A 1B5EA 1BP6A 1QZFA 4Q0DA 3HJ3A 5J7WA 1BIDA 1SYNA 4EINA 3N5EA 1AJMA 4GYHA 1BKPA 4O7UA 3B9HA 4XSCA 3CLBA 3UWLB 3GH0A 2RD8B 3BNZA 3IJZA 1BKOA 3DG8C 3HBBA 4FGTA 1JU6A 4KY8A 4IQQA 1F4BA 1JMIA 4DQ1A 4FOAA 3IK1A 3KJSA 5H38A 4O1XD 3BHLA 1VZEA 3KGBA 3EBUA 1VZAA 3DL6A 1EV5A 1TSWA 3K2HA 1JTUA 1EVGA 1ZPRA 1VZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TVW A;  3TMS A;  1BSP A;  1TLC A;  3C0A A;  3IX6 A;  3JSU A;  1TSM A;  1TSX A;  4DP3 A;  1RTS A;  1DNA A;  1KZI A;  1TSZ A;  2KCE A;  1CI7 A;  1NJB A;  3V8H A;  3IRM A;  4EIL A;  1B5D A;  2G8X A;  1B49 A;  1BDU A;  4FOG A;  4H0U A;  4F2V A;  1BSF A;  1YPV A;  3EAW X;  3GG5 A;  4KYA A;  5WRN A;  1B02 A;  4ISK A;  1TVV A;  3EF9 A;  1BO7 A;  3QJ7 A;  1BP0 A;  1LCB A;  1BQ2 A;  1HW3 A;  1NCE A;  3IHI A;  4G6W X;  1BO8 A;  1HZW A;  3IRN A;  5H39 A;  4TMS A;  1TRG A;  4DPD A;  1AIQ A;  4E28 A;  3DGA C;  1TIS A;  2FTQ A;  4IRR A;  3BZ0 A;  3UM8 A;  4XSE A;  3DL5 A;  4E5O A;  3UWL A;  2H2Q A;  2RD8 A;  3EDW X;  1F28 A;  4O1X A;  4H0R A;  2FTO X;  4O1U A;  3INV A;  1BJG A;  1EVF A;  1TVU A;  2OIP A;  1NJC A;  3B5B A;  3UM5 A;  1TDA A;  4LRR A;  1TJS A;  3GH2 X;  3QG2 A;  4GD7 A;  4XSD A;  1VZB A;  1FWM A;  2G89 A;  3OB7 A;  2VF0 A;  1AOB A;  1I00 A;  1TLS A;  2FTN A;  2TDD A;  2TSC A;  1TDC A;  2TDM A;  3ED7 A;  1HW4 A;  3I3R A;  3N5E B;  3H9K A;  3BYX A;  4UP1 A;  1BQ1 A;  1SEJ A;  2AAZ A;  3CL9 A;  3EHI X;  5FCT A;  1HVY A;  1F4D A;  1LCE A;  2A9W A;  4JEF A;  1F4C A;  4G2O X;  4KNZ A;  3C06 A;  3UM6 A;  1JUT A;  5HS3 A;  1DDU A;  1NJA A;  1QQQ A;  1TSD A;  4H1I A;  2G8A A;  1F4E A;  1KCE A;  1TSV A;  3BFI A;  1EV8 A;  4FOX A;  3QGT A;  4PSG A;  1KZJ A;  5H3A A;  1TSY A;  1F4F A;  1JMH A;  1VZC A;  4DPH A;  1JMF A;  4ISW A;  1BPJ A;  2G86 A;  1TYS A;  3BGX A;  4KPW A;  4ECK A;  1JUJ A;  1NJE A;  3HB8 A;  1J3I C;  3NRR A;  1JTQ A;  2TSR A;  1J3K C;  1F4G A;  1FFL A;  1JMG A;  1J3J C;  2BBQ A;  5BY6 A;  1AXW A;  2RDA A;  4KY4 A;  3BHR A;  3KJR A;  1NJD A;  4EB4 A;  1AN5 A;  4Q0E A;  4GEV A;  4EZ8 A;  3EJL A;  3IRO A;  1TSN A;  2ONB A;  4FQS A;  1LCA A;  2G8D A;  1THY A;  3N5G A;  1TDU A;  3EGY X;  3IK0 A;  1TDB A;  2VET A;  1TSL A;  4IQB A;  1JG0 A;  1B5E A;  1BP6 A;  1QZF A;  4Q0D A;  3HJ3 A;  5J7W A;  1BID A;  1SYN A;  4EIN A;  3N5E A;  1AJM A;  4GYH A;  1BKP A;  4O7U A;  3B9H A;  4XSC A;  3CLB A;  3UWL B;  3GH0 A;  2RD8 B;  3BNZ A;  3IJZ A;  1BKO A;  3DG8 C;  3HBB A;  4FGT A;  1JU6 A;  4KY8 A;  4IQQ A;  1F4B A;  1JMI A;  4DQ1 A;  4FOA A;  3IK1 A;  3KJS A;  5H38 A;  4O1X D;  3BHL A;  1VZE A;  3KGB A;  3EBU A;  1VZA A;  3DL6 A;  1EV5 A;  1TSW A;  3K2H A;  1JTU A;  1EVG A;  1ZPR A;  1VZD A; 
#chains in the Genus database with same CATH topology
 1TVW A;  3TMS A;  1BSP A;  1TLC A;  3C0A A;  3IX6 A;  3JSU A;  1TSM A;  1TSX A;  4DP3 A;  1RTS A;  1DNA A;  1KZI A;  1TSZ A;  2KCE A;  1CI7 A;  1NJB A;  3V8H A;  3IRM A;  4EIL A;  1B5D A;  2G8X A;  1B49 A;  1BDU A;  4FOG A;  4H0U A;  4F2V A;  1BSF A;  1YPV A;  3EAW X;  3GG5 A;  4KYA A;  5WRN A;  1B02 A;  4ISK A;  1TVV A;  3EF9 A;  1BO7 A;  3QJ7 A;  1BP0 A;  1LCB A;  1BQ2 A;  1HW3 A;  1NCE A;  3IHI A;  4G6W X;  1BO8 A;  1HZW A;  3IRN A;  5H39 A;  4TMS A;  1TRG A;  4DPD A;  1AIQ A;  4E28 A;  3DGA C;  1TIS A;  2FTQ A;  4IRR A;  3BZ0 A;  3UM8 A;  4XSE A;  3DL5 A;  4E5O A;  3UWL A;  2H2Q A;  2RD8 A;  3EDW X;  1F28 A;  4O1X A;  4H0R A;  2FTO X;  4O1U A;  3INV A;  1BJG A;  1EVF A;  1TVU A;  2OIP A;  1NJC A;  3B5B A;  3UM5 A;  1TDA A;  4LRR A;  1TJS A;  3GH2 X;  3QG2 A;  4GD7 A;  4XSD A;  1VZB A;  1FWM A;  2G89 A;  3OB7 A;  2VF0 A;  1AOB A;  1I00 A;  1TLS A;  2FTN A;  2TDD A;  2TSC A;  1TDC A;  2TDM A;  3ED7 A;  1HW4 A;  3I3R A;  3N5E B;  3H9K A;  3BYX A;  4UP1 A;  1BQ1 A;  1SEJ A;  2AAZ A;  3CL9 A;  3EHI X;  5FCT A;  1HVY A;  1F4D A;  1LCE A;  2A9W A;  4JEF A;  1F4C A;  4G2O X;  4KNZ A;  3C06 A;  3UM6 A;  1JUT A;  5HS3 A;  1DDU A;  1NJA A;  1QQQ A;  1TSD A;  4H1I A;  2G8A A;  1F4E A;  1KCE A;  1TSV A;  3BFI A;  1EV8 A;  4FOX A;  3QGT A;  4PSG A;  1KZJ A;  5H3A A;  1TSY A;  1F4F A;  1JMH A;  1VZC A;  4DPH A;  1JMF A;  4ISW A;  1BPJ A;  2G86 A;  1TYS A;  3BGX A;  4KPW A;  4ECK A;  1JUJ A;  1NJE A;  3HB8 A;  1J3I C;  3NRR A;  1JTQ A;  2TSR A;  1J3K C;  1F4G A;  1FFL A;  1JMG A;  1J3J C;  2BBQ A;  5BY6 A;  1AXW A;  2RDA A;  4KY4 A;  3BHR A;  3KJR A;  1NJD A;  4EB4 A;  1AN5 A;  4Q0E A;  4GEV A;  4EZ8 A;  3EJL A;  3IRO A;  1TSN A;  2ONB A;  4FQS A;  1LCA A;  2G8D A;  1THY A;  3N5G A;  1TDU A;  3EGY X;  3IK0 A;  1TDB A;  2VET A;  1TSL A;  4IQB A;  1JG0 A;  1B5E A;  1BP6 A;  1QZF A;  4Q0D A;  3HJ3 A;  5J7W A;  1BID A;  1SYN A;  4EIN A;  3N5E A;  1AJM A;  4GYH A;  1BKP A;  4O7U A;  3B9H A;  4XSC A;  3CLB A;  3UWL B;  3GH0 A;  2RD8 B;  3BNZ A;  3IJZ A;  1BKO A;  3DG8 C;  3HBB A;  4FGT A;  1JU6 A;  4KY8 A;  4IQQ A;  1F4B A;  1JMI A;  4DQ1 A;  4FOA A;  3IK1 A;  3KJS A;  5H38 A;  4O1X D;  3BHL A;  1VZE A;  3KGB A;  3EBU A;  1VZA A;  3DL6 A;  1EV5 A;  1TSW A;  3K2H A;  1JTU A;  1EVG A;  1ZPR A;  1VZD A; 
#chains in the Genus database with same CATH homology
 1TVW A;  3TMS A;  1BSP A;  1TLC A;  3C0A A;  3IX6 A;  3JSU A;  1TSM A;  1TSX A;  4DP3 A;  1RTS A;  1DNA A;  1KZI A;  1TSZ A;  2KCE A;  1CI7 A;  1NJB A;  3V8H A;  3IRM A;  4EIL A;  1B5D A;  2G8X A;  1B49 A;  1BDU A;  4FOG A;  4H0U A;  4F2V A;  1BSF A;  1YPV A;  3EAW X;  3GG5 A;  4KYA A;  5WRN A;  1B02 A;  4ISK A;  1TVV A;  3EF9 A;  1BO7 A;  3QJ7 A;  1BP0 A;  1LCB A;  1BQ2 A;  1HW3 A;  1NCE A;  3IHI A;  4G6W X;  1BO8 A;  1HZW A;  3IRN A;  5H39 A;  4TMS A;  1TRG A;  4DPD A;  1AIQ A;  4E28 A;  3DGA C;  1TIS A;  2FTQ A;  4IRR A;  3BZ0 A;  3UM8 A;  4XSE A;  3DL5 A;  4E5O A;  3UWL A;  2H2Q A;  2RD8 A;  3EDW X;  1F28 A;  4O1X A;  4H0R A;  2FTO X;  4O1U A;  3INV A;  1BJG A;  1EVF A;  1TVU A;  2OIP A;  1NJC A;  3B5B A;  3UM5 A;  1TDA A;  4LRR A;  1TJS A;  3GH2 X;  3QG2 A;  4GD7 A;  4XSD A;  1VZB A;  1FWM A;  2G89 A;  3OB7 A;  2VF0 A;  1AOB A;  1I00 A;  1TLS A;  2FTN A;  2TDD A;  2TSC A;  1TDC A;  2TDM A;  3ED7 A;  1HW4 A;  3I3R A;  3N5E B;  3H9K A;  3BYX A;  4UP1 A;  1BQ1 A;  1SEJ A;  2AAZ A;  3CL9 A;  3EHI X;  5FCT A;  1HVY A;  1F4D A;  1LCE A;  2A9W A;  4JEF A;  1F4C A;  4G2O X;  4KNZ A;  3C06 A;  3UM6 A;  1JUT A;  5HS3 A;  1DDU A;  1NJA A;  1QQQ A;  1TSD A;  4H1I A;  2G8A A;  1F4E A;  1KCE A;  1TSV A;  3BFI A;  1EV8 A;  4FOX A;  3QGT A;  4PSG A;  1KZJ A;  5H3A A;  1TSY A;  1F4F A;  1JMH A;  1VZC A;  4DPH A;  1JMF A;  4ISW A;  1BPJ A;  2G86 A;  1TYS A;  3BGX A;  4KPW A;  4ECK A;  1JUJ A;  1NJE A;  3HB8 A;  1J3I C;  3NRR A;  1JTQ A;  2TSR A;  1J3K C;  1F4G A;  1FFL A;  1JMG A;  1J3J C;  2BBQ A;  5BY6 A;  1AXW A;  2RDA A;  4KY4 A;  3BHR A;  3KJR A;  1NJD A;  4EB4 A;  1AN5 A;  4Q0E A;  4GEV A;  4EZ8 A;  3EJL A;  3IRO A;  1TSN A;  2ONB A;  4FQS A;  1LCA A;  2G8D A;  1THY A;  3N5G A;  1TDU A;  3EGY X;  3IK0 A;  1TDB A;  2VET A;  1TSL A;  4IQB A;  1JG0 A;  1B5E A;  1BP6 A;  1QZF A;  4Q0D A;  3HJ3 A;  5J7W A;  1BID A;  1SYN A;  4EIN A;  3N5E A;  1AJM A;  4GYH A;  1BKP A;  4O7U A;  3B9H A;  4XSC A;  3CLB A;  3UWL B;  3GH0 A;  2RD8 B;  3BNZ A;  3IJZ A;  1BKO A;  3DG8 C;  3HBB A;  4FGT A;  1JU6 A;  4KY8 A;  4IQQ A;  1F4B A;  1JMI A;  4DQ1 A;  4FOA A;  3IK1 A;  3KJS A;  5H38 A;  4O1X D;  3BHL A;  1VZE A;  3KGB A;  3EBU A;  1VZA A;  3DL6 A;  1EV5 A;  1TSW A;  3K2H A;  1JTU A;  1EVG A;  1ZPR A;  1VZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...