4XSCA

Complex structure of thymidylate synthase from varicella zoster virus with a phosphorylated bvdu
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
280
structure length
263
Chain Sequence
TLTGELQYLKQVDDILRYGVRKRDRTGIGTLSLFGMQARYNLRNEFPLLTTKRVFWRAVVEELLWFIRGSTDSKELAAKDIHIWDTGDLGPIYGFQWRHFGAEYKDCQSNYLQQGIDQLQTVIDTIKTNPESRRMIISSWNPKDIPLMVLPPCHTLCQFYVANGELSCQVYQRSGDMGLGVPFNIAGYALLTYIVAHVTGLKTGDLIHTMGDAHIYLNHIDALKVQLARSPKPFPCLKIIRNVTDINDFKWDDFQLDGYNPHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase
publication title Structure of the Varicella Zoster Virus Thymidylate Synthase Establishes Functional and Structural Similarities as the Human Enzyme and Potentiates Itself as a Target of Brivudine.
pubmed doi rcsb
source organism Varicella-zoster virus (strain oka vaccine)
total genus 81
structure length 263
sequence length 280
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4xscA00
2A9WA 3QJ7A 1JUJA 1TSNA 1QQQA 1LCBA 3B9HA 3BHLA 4FGTA 4EB4A 3INVA 4TMSA 1HW4A 3OB7A 1F4CA 2G8DA 1RTSA 1AIQA 1BP0A 1NJDA 3EHIX 1VZAA 1DNAA 1AJMA 1F4EA 3UM8A 4KY8A 1YPVA 4FQSA 1KZIA 3EF9A 1AOBA 4O1XD 4Q0EA 3BFIA 3HBBA 1JMGA 3NRRA 3CL9A 1DDUA 1JU6A 3IRMA 5FCTA 3UWLB 1BDUA 1F4GA 1EV8A 3BGXA 3DGAC 4E28A 2FTOX 1TJSA 4IQQA 1BQ1A 4KYAA 4JEFA 5J7WA 3K2HA 4H0RA 1B49A 1J3KC 4KNZA 4O1UA 1TSLA 4DP3A 1NCEA 3QG2A 2TDMA 4EINA 1BJGA 2AAZA 1F4BA 4IQBA 4XSCA 4EILA 4GYHA 1BP6A 1BSPA 3H9KA 4FOAA 1NJAA 2G86A 1THYA 4O7UA 4XSDA 1TLCA 3C06A 3IHIA 1TISA 1TSDA 2FTQA 3V8HA 1BKPA 1SYNA 1TSZA 2RD8A 4FOGA 3IX6A 2FTNA 3IRNA 1HW3A 4O1XA 1JMFA 3I3RA 3QGTA 1BPJA 1FFLA 1VZCA 3HB8A 4XSEA 2KCEA 1TVWA 3GH2X 4E5OA 1HVYA 1TVUA 1AXWA 1TDBA 3BHRA 3BNZA 4H1IA 4LRRA 2BBQA 1TSXA 4GEVA 1F28A 1EVFA 5WRNA 4F2VA 1QZFA 1TSVA 1FWMA 1BO8A 3GG5A 3UM5A 1B5DA 3DL5A 4ISKA 1JG0A 2RD8B 3IK0A 5H38A 1VZDA 3BYXA 4Q0DA 1NJEA 1SEJA 1TVVA 2TSCA 1I00A 1JTQA 4DPHA 1F4DA 4DPDA 2ONBA 2VETA 1CI7A 3TMSA 2RDAA 1BO7A 3UM6A 2G8AA 4ISWA 4G6WX 3KJRA 1TYSA 2TDDA 1F4FA 1TSWA 4PSGA 1TRGA 3IK1A 1JMIA 3JSUA 5H3AA 1HZWA 1ZPRA 3N5EA 4KPWA 2TSRA 1BIDA 2G89A 1EV5A 4EZ8A 3EAWX 1LCAA 3EGYX 1EVGA 4UP1A 3IJZA 1AN5A 1TDAA 3IROA 3N5GA 3EBUA 1B5EA 1J3IC 5HS3A 1JTUA 3KJSA 3KGBA 5H39A 3B5BA 1BKOA 1VZEA 2VF0A 4DQ1A 4KY4A 1NJCA 4G2OX 1J3JC 1NJBA 3EDWX 3HJ3A 1TSMA 3GH0A 4IRRA 3C0AA 3DL6A 3EJLA 1BSFA 1KCEA 1LCEA 5BY6A 1TLSA 1JUTA 1TDUA 3N5EB 4FOXA 3ED7A 1JMHA 3BZ0A 2H2QA 1TDCA 1VZBA 1B02A 2G8XA 1BQ2A 4H0UA 4ECKA 2OIPA 3DG8C 3CLBA 4GD7A 3UWLA 1TSYA 1KZJA
chains in the Genus database with same CATH superfamily
2A9WA 3QJ7A 1JUJA 1TSNA 1QQQA 1LCBA 3B9HA 3BHLA 4FGTA 4EB4A 3INVA 4TMSA 1HW4A 3OB7A 1F4CA 2G8DA 1RTSA 1AIQA 1BP0A 1NJDA 3EHIX 1VZAA 1DNAA 1AJMA 1F4EA 3UM8A 4KY8A 1YPVA 4FQSA 1KZIA 3EF9A 1AOBA 4O1XD 4Q0EA 3BFIA 3HBBA 1JMGA 3NRRA 3CL9A 1DDUA 1JU6A 3IRMA 5FCTA 3UWLB 1BDUA 1F4GA 1EV8A 3BGXA 3DGAC 4E28A 2FTOX 1TJSA 4IQQA 1BQ1A 4KYAA 4JEFA 5J7WA 3K2HA 4H0RA 1B49A 1J3KC 4KNZA 4O1UA 1TSLA 4DP3A 1NCEA 3QG2A 2TDMA 4EINA 1BJGA 2AAZA 1F4BA 4IQBA 4XSCA 4EILA 4GYHA 1BP6A 1BSPA 3H9KA 4FOAA 1NJAA 2G86A 1THYA 4O7UA 4XSDA 1TLCA 3C06A 3IHIA 1TISA 1TSDA 2FTQA 3V8HA 1BKPA 1SYNA 1TSZA 2RD8A 4FOGA 3IX6A 2FTNA 3IRNA 1HW3A 4O1XA 1JMFA 3I3RA 3QGTA 1BPJA 1FFLA 1VZCA 3HB8A 4XSEA 2KCEA 1TVWA 3GH2X 4E5OA 1HVYA 1TVUA 1AXWA 1TDBA 3BHRA 3BNZA 4H1IA 4LRRA 2BBQA 1TSXA 4GEVA 1F28A 1EVFA 5WRNA 4F2VA 1QZFA 1TSVA 1FWMA 1BO8A 3GG5A 3UM5A 1B5DA 3DL5A 4ISKA 1JG0A 2RD8B 3IK0A 5H38A 1VZDA 3BYXA 4Q0DA 1NJEA 1SEJA 1TVVA 2TSCA 1I00A 1JTQA 4DPHA 1F4DA 4DPDA 2ONBA 2VETA 1CI7A 3TMSA 2RDAA 1BO7A 3UM6A 2G8AA 4ISWA 4G6WX 3KJRA 1TYSA 2TDDA 1F4FA 1TSWA 4PSGA 1TRGA 3IK1A 1JMIA 3JSUA 5H3AA 1HZWA 1ZPRA 3N5EA 4KPWA 2TSRA 1BIDA 2G89A 1EV5A 4EZ8A 3EAWX 1LCAA 3EGYX 1EVGA 4UP1A 3IJZA 1AN5A 1TDAA 3IROA 3N5GA 3EBUA 1B5EA 1J3IC 5HS3A 1JTUA 3KJSA 3KGBA 5H39A 3B5BA 1BKOA 1VZEA 2VF0A 4DQ1A 4KY4A 1NJCA 4G2OX 1J3JC 1NJBA 3EDWX 3HJ3A 1TSMA 3GH0A 4IRRA 3C0AA 3DL6A 3EJLA 1BSFA 1KCEA 1LCEA 5BY6A 1TLSA 1JUTA 1TDUA 3N5EB 4FOXA 3ED7A 1JMHA 3BZ0A 2H2QA 1TDCA 1VZBA 1B02A 2G8XA 1BQ2A 4H0UA 4ECKA 2OIPA 3DG8C 3CLBA 4GD7A 3UWLA 1TSYA 1KZJA
chains in the Genus database with same CATH topology
2A9WA 3QJ7A 1JUJA 1TSNA 1QQQA 1LCBA 3B9HA 3BHLA 4FGTA 4EB4A 3INVA 4TMSA 1HW4A 3OB7A 1F4CA 2G8DA 1RTSA 1AIQA 1BP0A 1NJDA 3EHIX 1VZAA 1DNAA 1AJMA 1F4EA 3UM8A 4KY8A 1YPVA 4FQSA 1KZIA 3EF9A 1AOBA 4O1XD 4Q0EA 3BFIA 3HBBA 1JMGA 3NRRA 3CL9A 1DDUA 1JU6A 3IRMA 5FCTA 3UWLB 1BDUA 1F4GA 1EV8A 3BGXA 3DGAC 4E28A 2FTOX 1TJSA 4IQQA 1BQ1A 4KYAA 4JEFA 5J7WA 3K2HA 4H0RA 1B49A 1J3KC 4KNZA 4O1UA 1TSLA 4DP3A 1NCEA 3QG2A 2TDMA 4EINA 1BJGA 2AAZA 1F4BA 4IQBA 4XSCA 4EILA 4GYHA 1BP6A 1BSPA 3H9KA 4FOAA 1NJAA 2G86A 1THYA 4O7UA 4XSDA 1TLCA 3C06A 3IHIA 1TISA 1TSDA 2FTQA 3V8HA 1BKPA 1SYNA 1TSZA 2RD8A 4FOGA 3IX6A 2FTNA 3IRNA 1HW3A 4O1XA 1JMFA 3I3RA 3QGTA 1BPJA 1FFLA 1VZCA 3HB8A 4XSEA 2KCEA 1TVWA 3GH2X 4E5OA 1HVYA 1TVUA 1AXWA 1TDBA 3BHRA 3BNZA 4H1IA 4LRRA 2BBQA 1TSXA 4GEVA 1F28A 1EVFA 5WRNA 4F2VA 1QZFA 1TSVA 1FWMA 1BO8A 3GG5A 3UM5A 1B5DA 3DL5A 4ISKA 1JG0A 2RD8B 3IK0A 5H38A 1VZDA 3BYXA 4Q0DA 1NJEA 1SEJA 1TVVA 2TSCA 1I00A 1JTQA 4DPHA 1F4DA 4DPDA 2ONBA 2VETA 1CI7A 3TMSA 2RDAA 1BO7A 3UM6A 2G8AA 4ISWA 4G6WX 3KJRA 1TYSA 2TDDA 1F4FA 1TSWA 4PSGA 1TRGA 3IK1A 1JMIA 3JSUA 5H3AA 1HZWA 1ZPRA 3N5EA 4KPWA 2TSRA 1BIDA 2G89A 1EV5A 4EZ8A 3EAWX 1LCAA 3EGYX 1EVGA 4UP1A 3IJZA 1AN5A 1TDAA 3IROA 3N5GA 3EBUA 1B5EA 1J3IC 5HS3A 1JTUA 3KJSA 3KGBA 5H39A 3B5BA 1BKOA 1VZEA 2VF0A 4DQ1A 4KY4A 1NJCA 4G2OX 1J3JC 1NJBA 3EDWX 3HJ3A 1TSMA 3GH0A 4IRRA 3C0AA 3DL6A 3EJLA 1BSFA 1KCEA 1LCEA 5BY6A 1TLSA 1JUTA 1TDUA 3N5EB 4FOXA 3ED7A 1JMHA 3BZ0A 2H2QA 1TDCA 1VZBA 1B02A 2G8XA 1BQ2A 4H0UA 4ECKA 2OIPA 3DG8C 3CLBA 4GD7A 3UWLA 1TSYA 1KZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A9W A;  3QJ7 A;  1JUJ A;  1TSN A;  1QQQ A;  1LCB A;  3B9H A;  3BHL A;  4FGT A;  4EB4 A;  3INV A;  4TMS A;  1HW4 A;  3OB7 A;  1F4C A;  2G8D A;  1RTS A;  1AIQ A;  1BP0 A;  1NJD A;  3EHI X;  1VZA A;  1DNA A;  1AJM A;  1F4E A;  3UM8 A;  4KY8 A;  1YPV A;  4FQS A;  1KZI A;  3EF9 A;  1AOB A;  4O1X D;  4Q0E A;  3BFI A;  3HBB A;  1JMG A;  3NRR A;  3CL9 A;  1DDU A;  1JU6 A;  3IRM A;  5FCT A;  3UWL B;  1BDU A;  1F4G A;  1EV8 A;  3BGX A;  3DGA C;  4E28 A;  2FTO X;  1TJS A;  4IQQ A;  1BQ1 A;  4KYA A;  4JEF A;  5J7W A;  3K2H A;  4H0R A;  1B49 A;  1J3K C;  4KNZ A;  4O1U A;  1TSL A;  4DP3 A;  1NCE A;  3QG2 A;  2TDM A;  4EIN A;  1BJG A;  2AAZ A;  1F4B A;  4IQB A;  4XSC A;  4EIL A;  4GYH A;  1BP6 A;  1BSP A;  3H9K A;  4FOA A;  1NJA A;  2G86 A;  1THY A;  4O7U A;  4XSD A;  1TLC A;  3C06 A;  3IHI A;  1TIS A;  1TSD A;  2FTQ A;  3V8H A;  1BKP A;  1SYN A;  1TSZ A;  2RD8 A;  4FOG A;  3IX6 A;  2FTN A;  3IRN A;  1HW3 A;  4O1X A;  1JMF A;  3I3R A;  3QGT A;  1BPJ A;  1FFL A;  1VZC A;  3HB8 A;  4XSE A;  2KCE A;  1TVW A;  3GH2 X;  4E5O A;  1HVY A;  1TVU A;  1AXW A;  1TDB A;  3BHR A;  3BNZ A;  4H1I A;  4LRR A;  2BBQ A;  1TSX A;  4GEV A;  1F28 A;  1EVF A;  5WRN A;  4F2V A;  1QZF A;  1TSV A;  1FWM A;  1BO8 A;  3GG5 A;  3UM5 A;  1B5D A;  3DL5 A;  4ISK A;  1JG0 A;  2RD8 B;  3IK0 A;  5H38 A;  1VZD A;  3BYX A;  4Q0D A;  1NJE A;  1SEJ A;  1TVV A;  2TSC A;  1I00 A;  1JTQ A;  4DPH A;  1F4D A;  4DPD A;  2ONB A;  2VET A;  1CI7 A;  3TMS A;  2RDA A;  1BO7 A;  3UM6 A;  2G8A A;  4ISW A;  4G6W X;  3KJR A;  1TYS A;  2TDD A;  1F4F A;  1TSW A;  4PSG A;  1TRG A;  3IK1 A;  1JMI A;  3JSU A;  5H3A A;  1HZW A;  1ZPR A;  3N5E A;  4KPW A;  2TSR A;  1BID A;  2G89 A;  1EV5 A;  4EZ8 A;  3EAW X;  1LCA A;  3EGY X;  1EVG A;  4UP1 A;  3IJZ A;  1AN5 A;  1TDA A;  3IRO A;  3N5G A;  3EBU A;  1B5E A;  1J3I C;  5HS3 A;  1JTU A;  3KJS A;  3KGB A;  5H39 A;  3B5B A;  1BKO A;  1VZE A;  2VF0 A;  4DQ1 A;  4KY4 A;  1NJC A;  4G2O X;  1J3J C;  1NJB A;  3EDW X;  3HJ3 A;  1TSM A;  3GH0 A;  4IRR A;  3C0A A;  3DL6 A;  3EJL A;  1BSF A;  1KCE A;  1LCE A;  5BY6 A;  1TLS A;  1JUT A;  1TDU A;  3N5E B;  4FOX A;  3ED7 A;  1JMH A;  3BZ0 A;  2H2Q A;  1TDC A;  1VZB A;  1B02 A;  2G8X A;  1BQ2 A;  4H0U A;  4ECK A;  2OIP A;  3DG8 C;  3CLB A;  4GD7 A;  3UWL A;  1TSY A;  1KZJ A; 
#chains in the Genus database with same CATH topology
 2A9W A;  3QJ7 A;  1JUJ A;  1TSN A;  1QQQ A;  1LCB A;  3B9H A;  3BHL A;  4FGT A;  4EB4 A;  3INV A;  4TMS A;  1HW4 A;  3OB7 A;  1F4C A;  2G8D A;  1RTS A;  1AIQ A;  1BP0 A;  1NJD A;  3EHI X;  1VZA A;  1DNA A;  1AJM A;  1F4E A;  3UM8 A;  4KY8 A;  1YPV A;  4FQS A;  1KZI A;  3EF9 A;  1AOB A;  4O1X D;  4Q0E A;  3BFI A;  3HBB A;  1JMG A;  3NRR A;  3CL9 A;  1DDU A;  1JU6 A;  3IRM A;  5FCT A;  3UWL B;  1BDU A;  1F4G A;  1EV8 A;  3BGX A;  3DGA C;  4E28 A;  2FTO X;  1TJS A;  4IQQ A;  1BQ1 A;  4KYA A;  4JEF A;  5J7W A;  3K2H A;  4H0R A;  1B49 A;  1J3K C;  4KNZ A;  4O1U A;  1TSL A;  4DP3 A;  1NCE A;  3QG2 A;  2TDM A;  4EIN A;  1BJG A;  2AAZ A;  1F4B A;  4IQB A;  4XSC A;  4EIL A;  4GYH A;  1BP6 A;  1BSP A;  3H9K A;  4FOA A;  1NJA A;  2G86 A;  1THY A;  4O7U A;  4XSD A;  1TLC A;  3C06 A;  3IHI A;  1TIS A;  1TSD A;  2FTQ A;  3V8H A;  1BKP A;  1SYN A;  1TSZ A;  2RD8 A;  4FOG A;  3IX6 A;  2FTN A;  3IRN A;  1HW3 A;  4O1X A;  1JMF A;  3I3R A;  3QGT A;  1BPJ A;  1FFL A;  1VZC A;  3HB8 A;  4XSE A;  2KCE A;  1TVW A;  3GH2 X;  4E5O A;  1HVY A;  1TVU A;  1AXW A;  1TDB A;  3BHR A;  3BNZ A;  4H1I A;  4LRR A;  2BBQ A;  1TSX A;  4GEV A;  1F28 A;  1EVF A;  5WRN A;  4F2V A;  1QZF A;  1TSV A;  1FWM A;  1BO8 A;  3GG5 A;  3UM5 A;  1B5D A;  3DL5 A;  4ISK A;  1JG0 A;  2RD8 B;  3IK0 A;  5H38 A;  1VZD A;  3BYX A;  4Q0D A;  1NJE A;  1SEJ A;  1TVV A;  2TSC A;  1I00 A;  1JTQ A;  4DPH A;  1F4D A;  4DPD A;  2ONB A;  2VET A;  1CI7 A;  3TMS A;  2RDA A;  1BO7 A;  3UM6 A;  2G8A A;  4ISW A;  4G6W X;  3KJR A;  1TYS A;  2TDD A;  1F4F A;  1TSW A;  4PSG A;  1TRG A;  3IK1 A;  1JMI A;  3JSU A;  5H3A A;  1HZW A;  1ZPR A;  3N5E A;  4KPW A;  2TSR A;  1BID A;  2G89 A;  1EV5 A;  4EZ8 A;  3EAW X;  1LCA A;  3EGY X;  1EVG A;  4UP1 A;  3IJZ A;  1AN5 A;  1TDA A;  3IRO A;  3N5G A;  3EBU A;  1B5E A;  1J3I C;  5HS3 A;  1JTU A;  3KJS A;  3KGB A;  5H39 A;  3B5B A;  1BKO A;  1VZE A;  2VF0 A;  4DQ1 A;  4KY4 A;  1NJC A;  4G2O X;  1J3J C;  1NJB A;  3EDW X;  3HJ3 A;  1TSM A;  3GH0 A;  4IRR A;  3C0A A;  3DL6 A;  3EJL A;  1BSF A;  1KCE A;  1LCE A;  5BY6 A;  1TLS A;  1JUT A;  1TDU A;  3N5E B;  4FOX A;  3ED7 A;  1JMH A;  3BZ0 A;  2H2Q A;  1TDC A;  1VZB A;  1B02 A;  2G8X A;  1BQ2 A;  4H0U A;  4ECK A;  2OIP A;  3DG8 C;  3CLB A;  4GD7 A;  3UWL A;  1TSY A;  1KZJ A; 
#chains in the Genus database with same CATH homology
 2A9W A;  3QJ7 A;  1JUJ A;  1TSN A;  1QQQ A;  1LCB A;  3B9H A;  3BHL A;  4FGT A;  4EB4 A;  3INV A;  4TMS A;  1HW4 A;  3OB7 A;  1F4C A;  2G8D A;  1RTS A;  1AIQ A;  1BP0 A;  1NJD A;  3EHI X;  1VZA A;  1DNA A;  1AJM A;  1F4E A;  3UM8 A;  4KY8 A;  1YPV A;  4FQS A;  1KZI A;  3EF9 A;  1AOB A;  4O1X D;  4Q0E A;  3BFI A;  3HBB A;  1JMG A;  3NRR A;  3CL9 A;  1DDU A;  1JU6 A;  3IRM A;  5FCT A;  3UWL B;  1BDU A;  1F4G A;  1EV8 A;  3BGX A;  3DGA C;  4E28 A;  2FTO X;  1TJS A;  4IQQ A;  1BQ1 A;  4KYA A;  4JEF A;  5J7W A;  3K2H A;  4H0R A;  1B49 A;  1J3K C;  4KNZ A;  4O1U A;  1TSL A;  4DP3 A;  1NCE A;  3QG2 A;  2TDM A;  4EIN A;  1BJG A;  2AAZ A;  1F4B A;  4IQB A;  4XSC A;  4EIL A;  4GYH A;  1BP6 A;  1BSP A;  3H9K A;  4FOA A;  1NJA A;  2G86 A;  1THY A;  4O7U A;  4XSD A;  1TLC A;  3C06 A;  3IHI A;  1TIS A;  1TSD A;  2FTQ A;  3V8H A;  1BKP A;  1SYN A;  1TSZ A;  2RD8 A;  4FOG A;  3IX6 A;  2FTN A;  3IRN A;  1HW3 A;  4O1X A;  1JMF A;  3I3R A;  3QGT A;  1BPJ A;  1FFL A;  1VZC A;  3HB8 A;  4XSE A;  2KCE A;  1TVW A;  3GH2 X;  4E5O A;  1HVY A;  1TVU A;  1AXW A;  1TDB A;  3BHR A;  3BNZ A;  4H1I A;  4LRR A;  2BBQ A;  1TSX A;  4GEV A;  1F28 A;  1EVF A;  5WRN A;  4F2V A;  1QZF A;  1TSV A;  1FWM A;  1BO8 A;  3GG5 A;  3UM5 A;  1B5D A;  3DL5 A;  4ISK A;  1JG0 A;  2RD8 B;  3IK0 A;  5H38 A;  1VZD A;  3BYX A;  4Q0D A;  1NJE A;  1SEJ A;  1TVV A;  2TSC A;  1I00 A;  1JTQ A;  4DPH A;  1F4D A;  4DPD A;  2ONB A;  2VET A;  1CI7 A;  3TMS A;  2RDA A;  1BO7 A;  3UM6 A;  2G8A A;  4ISW A;  4G6W X;  3KJR A;  1TYS A;  2TDD A;  1F4F A;  1TSW A;  4PSG A;  1TRG A;  3IK1 A;  1JMI A;  3JSU A;  5H3A A;  1HZW A;  1ZPR A;  3N5E A;  4KPW A;  2TSR A;  1BID A;  2G89 A;  1EV5 A;  4EZ8 A;  3EAW X;  1LCA A;  3EGY X;  1EVG A;  4UP1 A;  3IJZ A;  1AN5 A;  1TDA A;  3IRO A;  3N5G A;  3EBU A;  1B5E A;  1J3I C;  5HS3 A;  1JTU A;  3KJS A;  3KGB A;  5H39 A;  3B5B A;  1BKO A;  1VZE A;  2VF0 A;  4DQ1 A;  4KY4 A;  1NJC A;  4G2O X;  1J3J C;  1NJB A;  3EDW X;  3HJ3 A;  1TSM A;  3GH0 A;  4IRR A;  3C0A A;  3DL6 A;  3EJL A;  1BSF A;  1KCE A;  1LCE A;  5BY6 A;  1TLS A;  1JUT A;  1TDU A;  3N5E B;  4FOX A;  3ED7 A;  1JMH A;  3BZ0 A;  2H2Q A;  1TDC A;  1VZB A;  1B02 A;  2G8X A;  1BQ2 A;  4H0U A;  4ECK A;  2OIP A;  3DG8 C;  3CLB A;  4GD7 A;  3UWL A;  1TSY A;  1KZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...