4XSDA

Complex structure of thymidylate synthase from varicella zoster virus with a dump
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
281
structure length
262
Chain Sequence
LTGELQYLKQVDDILRYGVRKRDRTGIGTLSLFGMQARYNLRNEFPLLTTKRVFWRAVVEELLWFIRGSTDSKELAAKDIHIWGDLGPIYGFQWRHFGAEYKDCQSNYLQQGIDQLQTVIDTIKTNPESRRMIISSWNPKDIPLMVLPPCHTLCQFYVANGELSCQVYQRSGDMGLGVPFNIAGYALLTYIVAHVTGLKTGDLIHTMGDAHIYLNHIDALKVQLARSPKPFPCLKIIRNVTDINDFKWDDFQLDGYNPHPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Thymidylate synthase
publication title Structure of the Varicella Zoster Virus Thymidylate Synthase Establishes Functional and Structural Similarities as the Human Enzyme and Potentiates Itself as a Target of Brivudine.
pubmed doi rcsb
source organism Varicella-zoster virus (strain oka vaccine)
total genus 64
structure length 262
sequence length 281
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4xsdA00
3ED7A 1TSNA 1EVGA 3UWLB 1EVFA 1HZWA 3HJ3A 3N5EA 3EAWX 3QJ7A 4KYAA 2FTNA 1JTUA 1TISA 1BKOA 4KY4A 4G2OX 1TDAA 1AOBA 5HS3A 2TDMA 2G8AA 1VZBA 1JMFA 3K2HA 1BO8A 1BDUA 2RDAA 1BO7A 1KCEA 1TJSA 1TLCA 1TVWA 1I00A 3I3RA 1JUJA 5WRNA 1TSXA 3GG5A 1NJAA 1FWMA 3IHIA 3N5GA 1TVUA 4GD7A 2G89A 1SEJA 1BJGA 1QQQA 1EV5A 3IRMA 4H0UA 2KCEA 4XSEA 1BP0A 1JU6A 3DG8C 3NRRA 4O1XD 2G86A 5FCTA 1LCBA 1BIDA 1TVVA 3CLBA 1F4BA 3UM5A 5H3AA 1B02A 4O7UA 1KZJA 2A9WA 3HB8A 3B5BA 3HBBA 1TLSA 3IK0A 3N5EB 1BQ1A 4ISWA 4DPDA 1VZEA 3KGBA 3IJZA 5BY6A 4KY8A 3IRNA 3IROA 2AAZA 3UM6A 1BSFA 2TDDA 4PSGA 4GEVA 4IQBA 1J3IC 4Q0DA 1CI7A 1F4FA 2G8XA 3C06A 4FOXA 1KZIA 1BKPA 1HVYA 1TSDA 3EBUA 4XSDA 2RD8A 3GH2X 1NJCA 2H2QA 2FTOX 3DL6A 3GH0A 1BPJA 4O1XA 4LRRA 4EB4A 1TDCA 3BYXA 1JTQA 3BHLA 3EHIX 3C0AA 1BSPA 3JSUA 4IRRA 3EDWX 1TSWA 1QZFA 4KNZA 3EJLA 4UP1A 1TRGA 2TSCA 4DQ1A 1VZCA 1HW3A 3TMSA 4EILA 4E5OA 4GYHA 1TSVA 1JUTA 1LCEA 1NJEA 3OB7A 5H38A 1DNAA 4DPHA 1F4CA 4H0RA 1TSZA 3QGTA 1JG0A 1NJDA 1B49A 1NJBA 1TDBA 1TSMA 2TSRA 1THYA 1ZPRA 4G6WX 1TSLA 3BHRA 1RTSA 1FFLA 1YPVA 1B5EA 1AXWA 1VZDA 2VETA 4KPWA 3UWLA 1SYNA 3BFIA 1TDUA 4H1IA 1AN5A 4DP3A 3DL5A 4FOAA 1HW4A 2OIPA 2RD8B 3BNZA 3EGYX 4FQSA 4XSCA 4EZ8A 1JMGA 3IX6A 2FTQA 1F4EA 1BP6A 4O1UA 1DDUA 3B9HA 1BQ2A 3EF9A 3BGXA 2VF0A 3KJRA 1AIQA 1J3JC 1TSYA 2BBQA 3IK1A 3INVA 5J7WA 1JMHA 1JMIA 1F4GA 4F2VA 1VZAA 1F4DA 1NCEA 4TMSA 4EINA 4IQQA 1LCAA 4E28A 5H39A 4JEFA 3V8HA 4FOGA 3UM8A 4Q0EA 2G8DA 4FGTA 2ONBA 4ISKA 3CL9A 3H9KA 3QG2A 3BZ0A 1B5DA 4ECKA 1EV8A 1AJMA 3DGAC 1J3KC 3KJSA 1F28A 1TYSA
chains in the Genus database with same CATH superfamily
3ED7A 1TSNA 1EVGA 3UWLB 1EVFA 1HZWA 3HJ3A 3N5EA 3EAWX 3QJ7A 4KYAA 2FTNA 1JTUA 1TISA 1BKOA 4KY4A 4G2OX 1TDAA 1AOBA 5HS3A 2TDMA 2G8AA 1VZBA 1JMFA 3K2HA 1BO8A 1BDUA 2RDAA 1BO7A 1KCEA 1TJSA 1TLCA 1TVWA 1I00A 3I3RA 1JUJA 5WRNA 1TSXA 3GG5A 1NJAA 1FWMA 3IHIA 3N5GA 1TVUA 4GD7A 2G89A 1SEJA 1BJGA 1QQQA 1EV5A 3IRMA 4H0UA 2KCEA 4XSEA 1BP0A 1JU6A 3DG8C 3NRRA 4O1XD 2G86A 5FCTA 1LCBA 1BIDA 1TVVA 3CLBA 1F4BA 3UM5A 5H3AA 1B02A 4O7UA 1KZJA 2A9WA 3HB8A 3B5BA 3HBBA 1TLSA 3IK0A 3N5EB 1BQ1A 4ISWA 4DPDA 1VZEA 3KGBA 3IJZA 5BY6A 4KY8A 3IRNA 3IROA 2AAZA 3UM6A 1BSFA 2TDDA 4PSGA 4GEVA 4IQBA 1J3IC 4Q0DA 1CI7A 1F4FA 2G8XA 3C06A 4FOXA 1KZIA 1BKPA 1HVYA 1TSDA 3EBUA 4XSDA 2RD8A 3GH2X 1NJCA 2H2QA 2FTOX 3DL6A 3GH0A 1BPJA 4O1XA 4LRRA 4EB4A 1TDCA 3BYXA 1JTQA 3BHLA 3EHIX 3C0AA 1BSPA 3JSUA 4IRRA 3EDWX 1TSWA 1QZFA 4KNZA 3EJLA 4UP1A 1TRGA 2TSCA 4DQ1A 1VZCA 1HW3A 3TMSA 4EILA 4E5OA 4GYHA 1TSVA 1JUTA 1LCEA 1NJEA 3OB7A 5H38A 1DNAA 4DPHA 1F4CA 4H0RA 1TSZA 3QGTA 1JG0A 1NJDA 1B49A 1NJBA 1TDBA 1TSMA 2TSRA 1THYA 1ZPRA 4G6WX 1TSLA 3BHRA 1RTSA 1FFLA 1YPVA 1B5EA 1AXWA 1VZDA 2VETA 4KPWA 3UWLA 1SYNA 3BFIA 1TDUA 4H1IA 1AN5A 4DP3A 3DL5A 4FOAA 1HW4A 2OIPA 2RD8B 3BNZA 3EGYX 4FQSA 4XSCA 4EZ8A 1JMGA 3IX6A 2FTQA 1F4EA 1BP6A 4O1UA 1DDUA 3B9HA 1BQ2A 3EF9A 3BGXA 2VF0A 3KJRA 1AIQA 1J3JC 1TSYA 2BBQA 3IK1A 3INVA 5J7WA 1JMHA 1JMIA 1F4GA 4F2VA 1VZAA 1F4DA 1NCEA 4TMSA 4EINA 4IQQA 1LCAA 4E28A 5H39A 4JEFA 3V8HA 4FOGA 3UM8A 4Q0EA 2G8DA 4FGTA 2ONBA 4ISKA 3CL9A 3H9KA 3QG2A 3BZ0A 1B5DA 4ECKA 1EV8A 1AJMA 3DGAC 1J3KC 3KJSA 1F28A 1TYSA
chains in the Genus database with same CATH topology
3ED7A 1TSNA 1EVGA 3UWLB 1EVFA 1HZWA 3HJ3A 3N5EA 3EAWX 3QJ7A 4KYAA 2FTNA 1JTUA 1TISA 1BKOA 4KY4A 4G2OX 1TDAA 1AOBA 5HS3A 2TDMA 2G8AA 1VZBA 1JMFA 3K2HA 1BO8A 1BDUA 2RDAA 1BO7A 1KCEA 1TJSA 1TLCA 1TVWA 1I00A 3I3RA 1JUJA 5WRNA 1TSXA 3GG5A 1NJAA 1FWMA 3IHIA 3N5GA 1TVUA 4GD7A 2G89A 1SEJA 1BJGA 1QQQA 1EV5A 3IRMA 4H0UA 2KCEA 4XSEA 1BP0A 1JU6A 3DG8C 3NRRA 4O1XD 2G86A 5FCTA 1LCBA 1BIDA 1TVVA 3CLBA 1F4BA 3UM5A 5H3AA 1B02A 4O7UA 1KZJA 2A9WA 3HB8A 3B5BA 3HBBA 1TLSA 3IK0A 3N5EB 1BQ1A 4ISWA 4DPDA 1VZEA 3KGBA 3IJZA 5BY6A 4KY8A 3IRNA 3IROA 2AAZA 3UM6A 1BSFA 2TDDA 4PSGA 4GEVA 4IQBA 1J3IC 4Q0DA 1CI7A 1F4FA 2G8XA 3C06A 4FOXA 1KZIA 1BKPA 1HVYA 1TSDA 3EBUA 4XSDA 2RD8A 3GH2X 1NJCA 2H2QA 2FTOX 3DL6A 3GH0A 1BPJA 4O1XA 4LRRA 4EB4A 1TDCA 3BYXA 1JTQA 3BHLA 3EHIX 3C0AA 1BSPA 3JSUA 4IRRA 3EDWX 1TSWA 1QZFA 4KNZA 3EJLA 4UP1A 1TRGA 2TSCA 4DQ1A 1VZCA 1HW3A 3TMSA 4EILA 4E5OA 4GYHA 1TSVA 1JUTA 1LCEA 1NJEA 3OB7A 5H38A 1DNAA 4DPHA 1F4CA 4H0RA 1TSZA 3QGTA 1JG0A 1NJDA 1B49A 1NJBA 1TDBA 1TSMA 2TSRA 1THYA 1ZPRA 4G6WX 1TSLA 3BHRA 1RTSA 1FFLA 1YPVA 1B5EA 1AXWA 1VZDA 2VETA 4KPWA 3UWLA 1SYNA 3BFIA 1TDUA 4H1IA 1AN5A 4DP3A 3DL5A 4FOAA 1HW4A 2OIPA 2RD8B 3BNZA 3EGYX 4FQSA 4XSCA 4EZ8A 1JMGA 3IX6A 2FTQA 1F4EA 1BP6A 4O1UA 1DDUA 3B9HA 1BQ2A 3EF9A 3BGXA 2VF0A 3KJRA 1AIQA 1J3JC 1TSYA 2BBQA 3IK1A 3INVA 5J7WA 1JMHA 1JMIA 1F4GA 4F2VA 1VZAA 1F4DA 1NCEA 4TMSA 4EINA 4IQQA 1LCAA 4E28A 5H39A 4JEFA 3V8HA 4FOGA 3UM8A 4Q0EA 2G8DA 4FGTA 2ONBA 4ISKA 3CL9A 3H9KA 3QG2A 3BZ0A 1B5DA 4ECKA 1EV8A 1AJMA 3DGAC 1J3KC 3KJSA 1F28A 1TYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ED7 A;  1TSN A;  1EVG A;  3UWL B;  1EVF A;  1HZW A;  3HJ3 A;  3N5E A;  3EAW X;  3QJ7 A;  4KYA A;  2FTN A;  1JTU A;  1TIS A;  1BKO A;  4KY4 A;  4G2O X;  1TDA A;  1AOB A;  5HS3 A;  2TDM A;  2G8A A;  1VZB A;  1JMF A;  3K2H A;  1BO8 A;  1BDU A;  2RDA A;  1BO7 A;  1KCE A;  1TJS A;  1TLC A;  1TVW A;  1I00 A;  3I3R A;  1JUJ A;  5WRN A;  1TSX A;  3GG5 A;  1NJA A;  1FWM A;  3IHI A;  3N5G A;  1TVU A;  4GD7 A;  2G89 A;  1SEJ A;  1BJG A;  1QQQ A;  1EV5 A;  3IRM A;  4H0U A;  2KCE A;  4XSE A;  1BP0 A;  1JU6 A;  3DG8 C;  3NRR A;  4O1X D;  2G86 A;  5FCT A;  1LCB A;  1BID A;  1TVV A;  3CLB A;  1F4B A;  3UM5 A;  5H3A A;  1B02 A;  4O7U A;  1KZJ A;  2A9W A;  3HB8 A;  3B5B A;  3HBB A;  1TLS A;  3IK0 A;  3N5E B;  1BQ1 A;  4ISW A;  4DPD A;  1VZE A;  3KGB A;  3IJZ A;  5BY6 A;  4KY8 A;  3IRN A;  3IRO A;  2AAZ A;  3UM6 A;  1BSF A;  2TDD A;  4PSG A;  4GEV A;  4IQB A;  1J3I C;  4Q0D A;  1CI7 A;  1F4F A;  2G8X A;  3C06 A;  4FOX A;  1KZI A;  1BKP A;  1HVY A;  1TSD A;  3EBU A;  4XSD A;  2RD8 A;  3GH2 X;  1NJC A;  2H2Q A;  2FTO X;  3DL6 A;  3GH0 A;  1BPJ A;  4O1X A;  4LRR A;  4EB4 A;  1TDC A;  3BYX A;  1JTQ A;  3BHL A;  3EHI X;  3C0A A;  1BSP A;  3JSU A;  4IRR A;  3EDW X;  1TSW A;  1QZF A;  4KNZ A;  3EJL A;  4UP1 A;  1TRG A;  2TSC A;  4DQ1 A;  1VZC A;  1HW3 A;  3TMS A;  4EIL A;  4E5O A;  4GYH A;  1TSV A;  1JUT A;  1LCE A;  1NJE A;  3OB7 A;  5H38 A;  1DNA A;  4DPH A;  1F4C A;  4H0R A;  1TSZ A;  3QGT A;  1JG0 A;  1NJD A;  1B49 A;  1NJB A;  1TDB A;  1TSM A;  2TSR A;  1THY A;  1ZPR A;  4G6W X;  1TSL A;  3BHR A;  1RTS A;  1FFL A;  1YPV A;  1B5E A;  1AXW A;  1VZD A;  2VET A;  4KPW A;  3UWL A;  1SYN A;  3BFI A;  1TDU A;  4H1I A;  1AN5 A;  4DP3 A;  3DL5 A;  4FOA A;  1HW4 A;  2OIP A;  2RD8 B;  3BNZ A;  3EGY X;  4FQS A;  4XSC A;  4EZ8 A;  1JMG A;  3IX6 A;  2FTQ A;  1F4E A;  1BP6 A;  4O1U A;  1DDU A;  3B9H A;  1BQ2 A;  3EF9 A;  3BGX A;  2VF0 A;  3KJR A;  1AIQ A;  1J3J C;  1TSY A;  2BBQ A;  3IK1 A;  3INV A;  5J7W A;  1JMH A;  1JMI A;  1F4G A;  4F2V A;  1VZA A;  1F4D A;  1NCE A;  4TMS A;  4EIN A;  4IQQ A;  1LCA A;  4E28 A;  5H39 A;  4JEF A;  3V8H A;  4FOG A;  3UM8 A;  4Q0E A;  2G8D A;  4FGT A;  2ONB A;  4ISK A;  3CL9 A;  3H9K A;  3QG2 A;  3BZ0 A;  1B5D A;  4ECK A;  1EV8 A;  1AJM A;  3DGA C;  1J3K C;  3KJS A;  1F28 A;  1TYS A; 
#chains in the Genus database with same CATH topology
 3ED7 A;  1TSN A;  1EVG A;  3UWL B;  1EVF A;  1HZW A;  3HJ3 A;  3N5E A;  3EAW X;  3QJ7 A;  4KYA A;  2FTN A;  1JTU A;  1TIS A;  1BKO A;  4KY4 A;  4G2O X;  1TDA A;  1AOB A;  5HS3 A;  2TDM A;  2G8A A;  1VZB A;  1JMF A;  3K2H A;  1BO8 A;  1BDU A;  2RDA A;  1BO7 A;  1KCE A;  1TJS A;  1TLC A;  1TVW A;  1I00 A;  3I3R A;  1JUJ A;  5WRN A;  1TSX A;  3GG5 A;  1NJA A;  1FWM A;  3IHI A;  3N5G A;  1TVU A;  4GD7 A;  2G89 A;  1SEJ A;  1BJG A;  1QQQ A;  1EV5 A;  3IRM A;  4H0U A;  2KCE A;  4XSE A;  1BP0 A;  1JU6 A;  3DG8 C;  3NRR A;  4O1X D;  2G86 A;  5FCT A;  1LCB A;  1BID A;  1TVV A;  3CLB A;  1F4B A;  3UM5 A;  5H3A A;  1B02 A;  4O7U A;  1KZJ A;  2A9W A;  3HB8 A;  3B5B A;  3HBB A;  1TLS A;  3IK0 A;  3N5E B;  1BQ1 A;  4ISW A;  4DPD A;  1VZE A;  3KGB A;  3IJZ A;  5BY6 A;  4KY8 A;  3IRN A;  3IRO A;  2AAZ A;  3UM6 A;  1BSF A;  2TDD A;  4PSG A;  4GEV A;  4IQB A;  1J3I C;  4Q0D A;  1CI7 A;  1F4F A;  2G8X A;  3C06 A;  4FOX A;  1KZI A;  1BKP A;  1HVY A;  1TSD A;  3EBU A;  4XSD A;  2RD8 A;  3GH2 X;  1NJC A;  2H2Q A;  2FTO X;  3DL6 A;  3GH0 A;  1BPJ A;  4O1X A;  4LRR A;  4EB4 A;  1TDC A;  3BYX A;  1JTQ A;  3BHL A;  3EHI X;  3C0A A;  1BSP A;  3JSU A;  4IRR A;  3EDW X;  1TSW A;  1QZF A;  4KNZ A;  3EJL A;  4UP1 A;  1TRG A;  2TSC A;  4DQ1 A;  1VZC A;  1HW3 A;  3TMS A;  4EIL A;  4E5O A;  4GYH A;  1TSV A;  1JUT A;  1LCE A;  1NJE A;  3OB7 A;  5H38 A;  1DNA A;  4DPH A;  1F4C A;  4H0R A;  1TSZ A;  3QGT A;  1JG0 A;  1NJD A;  1B49 A;  1NJB A;  1TDB A;  1TSM A;  2TSR A;  1THY A;  1ZPR A;  4G6W X;  1TSL A;  3BHR A;  1RTS A;  1FFL A;  1YPV A;  1B5E A;  1AXW A;  1VZD A;  2VET A;  4KPW A;  3UWL A;  1SYN A;  3BFI A;  1TDU A;  4H1I A;  1AN5 A;  4DP3 A;  3DL5 A;  4FOA A;  1HW4 A;  2OIP A;  2RD8 B;  3BNZ A;  3EGY X;  4FQS A;  4XSC A;  4EZ8 A;  1JMG A;  3IX6 A;  2FTQ A;  1F4E A;  1BP6 A;  4O1U A;  1DDU A;  3B9H A;  1BQ2 A;  3EF9 A;  3BGX A;  2VF0 A;  3KJR A;  1AIQ A;  1J3J C;  1TSY A;  2BBQ A;  3IK1 A;  3INV A;  5J7W A;  1JMH A;  1JMI A;  1F4G A;  4F2V A;  1VZA A;  1F4D A;  1NCE A;  4TMS A;  4EIN A;  4IQQ A;  1LCA A;  4E28 A;  5H39 A;  4JEF A;  3V8H A;  4FOG A;  3UM8 A;  4Q0E A;  2G8D A;  4FGT A;  2ONB A;  4ISK A;  3CL9 A;  3H9K A;  3QG2 A;  3BZ0 A;  1B5D A;  4ECK A;  1EV8 A;  1AJM A;  3DGA C;  1J3K C;  3KJS A;  1F28 A;  1TYS A; 
#chains in the Genus database with same CATH homology
 3ED7 A;  1TSN A;  1EVG A;  3UWL B;  1EVF A;  1HZW A;  3HJ3 A;  3N5E A;  3EAW X;  3QJ7 A;  4KYA A;  2FTN A;  1JTU A;  1TIS A;  1BKO A;  4KY4 A;  4G2O X;  1TDA A;  1AOB A;  5HS3 A;  2TDM A;  2G8A A;  1VZB A;  1JMF A;  3K2H A;  1BO8 A;  1BDU A;  2RDA A;  1BO7 A;  1KCE A;  1TJS A;  1TLC A;  1TVW A;  1I00 A;  3I3R A;  1JUJ A;  5WRN A;  1TSX A;  3GG5 A;  1NJA A;  1FWM A;  3IHI A;  3N5G A;  1TVU A;  4GD7 A;  2G89 A;  1SEJ A;  1BJG A;  1QQQ A;  1EV5 A;  3IRM A;  4H0U A;  2KCE A;  4XSE A;  1BP0 A;  1JU6 A;  3DG8 C;  3NRR A;  4O1X D;  2G86 A;  5FCT A;  1LCB A;  1BID A;  1TVV A;  3CLB A;  1F4B A;  3UM5 A;  5H3A A;  1B02 A;  4O7U A;  1KZJ A;  2A9W A;  3HB8 A;  3B5B A;  3HBB A;  1TLS A;  3IK0 A;  3N5E B;  1BQ1 A;  4ISW A;  4DPD A;  1VZE A;  3KGB A;  3IJZ A;  5BY6 A;  4KY8 A;  3IRN A;  3IRO A;  2AAZ A;  3UM6 A;  1BSF A;  2TDD A;  4PSG A;  4GEV A;  4IQB A;  1J3I C;  4Q0D A;  1CI7 A;  1F4F A;  2G8X A;  3C06 A;  4FOX A;  1KZI A;  1BKP A;  1HVY A;  1TSD A;  3EBU A;  4XSD A;  2RD8 A;  3GH2 X;  1NJC A;  2H2Q A;  2FTO X;  3DL6 A;  3GH0 A;  1BPJ A;  4O1X A;  4LRR A;  4EB4 A;  1TDC A;  3BYX A;  1JTQ A;  3BHL A;  3EHI X;  3C0A A;  1BSP A;  3JSU A;  4IRR A;  3EDW X;  1TSW A;  1QZF A;  4KNZ A;  3EJL A;  4UP1 A;  1TRG A;  2TSC A;  4DQ1 A;  1VZC A;  1HW3 A;  3TMS A;  4EIL A;  4E5O A;  4GYH A;  1TSV A;  1JUT A;  1LCE A;  1NJE A;  3OB7 A;  5H38 A;  1DNA A;  4DPH A;  1F4C A;  4H0R A;  1TSZ A;  3QGT A;  1JG0 A;  1NJD A;  1B49 A;  1NJB A;  1TDB A;  1TSM A;  2TSR A;  1THY A;  1ZPR A;  4G6W X;  1TSL A;  3BHR A;  1RTS A;  1FFL A;  1YPV A;  1B5E A;  1AXW A;  1VZD A;  2VET A;  4KPW A;  3UWL A;  1SYN A;  3BFI A;  1TDU A;  4H1I A;  1AN5 A;  4DP3 A;  3DL5 A;  4FOA A;  1HW4 A;  2OIP A;  2RD8 B;  3BNZ A;  3EGY X;  4FQS A;  4XSC A;  4EZ8 A;  1JMG A;  3IX6 A;  2FTQ A;  1F4E A;  1BP6 A;  4O1U A;  1DDU A;  3B9H A;  1BQ2 A;  3EF9 A;  3BGX A;  2VF0 A;  3KJR A;  1AIQ A;  1J3J C;  1TSY A;  2BBQ A;  3IK1 A;  3INV A;  5J7W A;  1JMH A;  1JMI A;  1F4G A;  4F2V A;  1VZA A;  1F4D A;  1NCE A;  4TMS A;  4EIN A;  4IQQ A;  1LCA A;  4E28 A;  5H39 A;  4JEF A;  3V8H A;  4FOG A;  3UM8 A;  4Q0E A;  2G8D A;  4FGT A;  2ONB A;  4ISK A;  3CL9 A;  3H9K A;  3QG2 A;  3BZ0 A;  1B5D A;  4ECK A;  1EV8 A;  1AJM A;  3DGA C;  1J3K C;  3KJS A;  1F28 A;  1TYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...