4XSEA

Complex structure of thymidylate synthase from varicella zoster virus
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
279
structure length
279
Chain Sequence
TGELQYLKQVDDILRYGVRKRDRTGIGTLSLFGMQARYNLRNEFPLLTTKRVFWRAVVEELLWFIRGSTDSKELAAKDIHIWDIYGSSKFLNRNGFHKRHTGDLGPIYGFQWRHFGAEYKDCQSNYLQQGIDQLQTVIDTIKTNPESRRMIISSWNPKDIPLMVLPPCHTLCQFYVANGELSCQVYQRSGDMGLGVPFNIAGYALLTYIVAHVTGLKTGDLIHTMGDAHIYLNHIDALKVQLARSPKPFPCLKIIRNVTDINDFKWDDFQLDGYNPHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Thymidylate synthase
publication title Structure of the Varicella Zoster Virus Thymidylate Synthase Establishes Functional and Structural Similarities as the Human Enzyme and Potentiates Itself as a Target of Brivudine.
pubmed doi rcsb
source organism Varicella-zoster virus (strain oka vaccine)
total genus 77
structure length 279
sequence length 279
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4xseA00
1JUTA 1BP0A 4LRRA 2BBQA 3DL5A 1BKPA 2VETA 4EINA 3BNZA 1TDAA 4G6WX 1BPJA 3IK0A 1TDBA 3B9HA 4O1XA 1RTSA 5H39A 5H3AA 3QG2A 3IRNA 1TSMA 4DP3A 1JUJA 1BSFA 4KY4A 1AOBA 1TDUA 3UWLA 3HB8A 2G8XA 2TDMA 1EV5A 1HW3A 3K2HA 3V8HA 1TYSA 1F4FA 3EBUA 3GG5A 3KJSA 1TSVA 2TSRA 1TLSA 3CL9A 4GYHA 1NJDA 1JMHA 2OIPA 3ED7A 4IQQA 3EHIX 1THYA 3TMSA 1TSYA 1HW4A 1SEJA 1VZDA 1AXWA 4E5OA 1TSWA 2KCEA 3INVA 1VZAA 2TSCA 4FOGA 3DL6A 5FCTA 4EB4A 1CI7A 1J3KC 4UP1A 1F4EA 1NJBA 2ONBA 3IJZA 4TMSA 4FOAA 4XSCA 3N5GA 3QJ7A 4PSGA 4JEFA 4H0UA 2TDDA 1HVYA 3EF9A 3H9KA 1B49A 3HJ3A 1DNAA 1LCBA 1FFLA 2G86A 3B5BA 1KCEA 3C0AA 3BYXA 1QQQA 1TJSA 3JSUA 1NJEA 1F4DA 1BSPA 1J3IC 5J7WA 4GD7A 1TSXA 4O1XD 1AIQA 1JU6A 1ZPRA 3DG8C 3BHRA 3EAWX 3GH2X 4FGTA 1B5DA 3NRRA 1AJMA 2RD8B 1KZIA 1TSLA 2FTNA 1BO7A 1KZJA 1SYNA 1VZEA 3HBBA 3N5EB 2G8AA 1VZCA 1NJAA 1BKOA 1TVWA 2A9WA 1FWMA 3EDWX 3EJLA 2RDAA 1AN5A 1BO8A 1BQ1A 2FTOX 3UM8A 4IQBA 1NCEA 3N5EA 5BY6A 4F2VA 1BIDA 3IRMA 3KGBA 1TVUA 1B5EA 1QZFA 1LCEA 1TRGA 1YPVA 2VF0A 3I3RA 4KY8A 3UM6A 1BDUA 4XSEA 5WRNA 1HZWA 1LCAA 4Q0DA 1TDCA 5HS3A 1JTQA 4Q0EA 4DPHA 4IRRA 1F28A 1JMFA 1I00A 3BZ0A 3C06A 4ISWA 4KYAA 1BQ2A 3QGTA 4XSDA 4H0RA 3UWLB 1BJGA 3GH0A 4KNZA 4E28A 1TLCA 1TSZA 3DGAC 4ECKA 5H38A 2AAZA 1J3JC 2FTQA 2G89A 1JG0A 1F4BA 4FQSA 4DPDA 2G8DA 3IX6A 4FOXA 2RD8A 1B02A 3CLBA 4G2OX 3BGXA 4EZ8A 4DQ1A 1F4GA 4H1IA 3UM5A 1TSNA 1F4CA 4ISKA 1EVFA 1JMGA 4KPWA 4EILA 1EV8A 3IHIA 4O1UA 1BP6A 2H2QA 3EGYX 1TSDA 1TVVA 3IROA 1EVGA 3KJRA 4O7UA 1TISA 1DDUA 1JMIA 1NJCA 3OB7A 1VZBA 3BFIA 4GEVA 3BHLA 1JTUA 3IK1A
chains in the Genus database with same CATH superfamily
1JUTA 1BP0A 4LRRA 2BBQA 3DL5A 1BKPA 2VETA 4EINA 3BNZA 1TDAA 4G6WX 1BPJA 3IK0A 1TDBA 3B9HA 4O1XA 1RTSA 5H39A 5H3AA 3QG2A 3IRNA 1TSMA 4DP3A 1JUJA 1BSFA 4KY4A 1AOBA 1TDUA 3UWLA 3HB8A 2G8XA 2TDMA 1EV5A 1HW3A 3K2HA 3V8HA 1TYSA 1F4FA 3EBUA 3GG5A 3KJSA 1TSVA 2TSRA 1TLSA 3CL9A 4GYHA 1NJDA 1JMHA 2OIPA 3ED7A 4IQQA 3EHIX 1THYA 3TMSA 1TSYA 1HW4A 1SEJA 1VZDA 1AXWA 4E5OA 1TSWA 2KCEA 3INVA 1VZAA 2TSCA 4FOGA 3DL6A 5FCTA 4EB4A 1CI7A 1J3KC 4UP1A 1F4EA 1NJBA 2ONBA 3IJZA 4TMSA 4FOAA 4XSCA 3N5GA 3QJ7A 4PSGA 4JEFA 4H0UA 2TDDA 1HVYA 3EF9A 3H9KA 1B49A 3HJ3A 1DNAA 1LCBA 1FFLA 2G86A 3B5BA 1KCEA 3C0AA 3BYXA 1QQQA 1TJSA 3JSUA 1NJEA 1F4DA 1BSPA 1J3IC 5J7WA 4GD7A 1TSXA 4O1XD 1AIQA 1JU6A 1ZPRA 3DG8C 3BHRA 3EAWX 3GH2X 4FGTA 1B5DA 3NRRA 1AJMA 2RD8B 1KZIA 1TSLA 2FTNA 1BO7A 1KZJA 1SYNA 1VZEA 3HBBA 3N5EB 2G8AA 1VZCA 1NJAA 1BKOA 1TVWA 2A9WA 1FWMA 3EDWX 3EJLA 2RDAA 1AN5A 1BO8A 1BQ1A 2FTOX 3UM8A 4IQBA 1NCEA 3N5EA 5BY6A 4F2VA 1BIDA 3IRMA 3KGBA 1TVUA 1B5EA 1QZFA 1LCEA 1TRGA 1YPVA 2VF0A 3I3RA 4KY8A 3UM6A 1BDUA 4XSEA 5WRNA 1HZWA 1LCAA 4Q0DA 1TDCA 5HS3A 1JTQA 4Q0EA 4DPHA 4IRRA 1F28A 1JMFA 1I00A 3BZ0A 3C06A 4ISWA 4KYAA 1BQ2A 3QGTA 4XSDA 4H0RA 3UWLB 1BJGA 3GH0A 4KNZA 4E28A 1TLCA 1TSZA 3DGAC 4ECKA 5H38A 2AAZA 1J3JC 2FTQA 2G89A 1JG0A 1F4BA 4FQSA 4DPDA 2G8DA 3IX6A 4FOXA 2RD8A 1B02A 3CLBA 4G2OX 3BGXA 4EZ8A 4DQ1A 1F4GA 4H1IA 3UM5A 1TSNA 1F4CA 4ISKA 1EVFA 1JMGA 4KPWA 4EILA 1EV8A 3IHIA 4O1UA 1BP6A 2H2QA 3EGYX 1TSDA 1TVVA 3IROA 1EVGA 3KJRA 4O7UA 1TISA 1DDUA 1JMIA 1NJCA 3OB7A 1VZBA 3BFIA 4GEVA 3BHLA 1JTUA 3IK1A
chains in the Genus database with same CATH topology
1JUTA 1BP0A 4LRRA 2BBQA 3DL5A 1BKPA 2VETA 4EINA 3BNZA 1TDAA 4G6WX 1BPJA 3IK0A 1TDBA 3B9HA 4O1XA 1RTSA 5H39A 5H3AA 3QG2A 3IRNA 1TSMA 4DP3A 1JUJA 1BSFA 4KY4A 1AOBA 1TDUA 3UWLA 3HB8A 2G8XA 2TDMA 1EV5A 1HW3A 3K2HA 3V8HA 1TYSA 1F4FA 3EBUA 3GG5A 3KJSA 1TSVA 2TSRA 1TLSA 3CL9A 4GYHA 1NJDA 1JMHA 2OIPA 3ED7A 4IQQA 3EHIX 1THYA 3TMSA 1TSYA 1HW4A 1SEJA 1VZDA 1AXWA 4E5OA 1TSWA 2KCEA 3INVA 1VZAA 2TSCA 4FOGA 3DL6A 5FCTA 4EB4A 1CI7A 1J3KC 4UP1A 1F4EA 1NJBA 2ONBA 3IJZA 4TMSA 4FOAA 4XSCA 3N5GA 3QJ7A 4PSGA 4JEFA 4H0UA 2TDDA 1HVYA 3EF9A 3H9KA 1B49A 3HJ3A 1DNAA 1LCBA 1FFLA 2G86A 3B5BA 1KCEA 3C0AA 3BYXA 1QQQA 1TJSA 3JSUA 1NJEA 1F4DA 1BSPA 1J3IC 5J7WA 4GD7A 1TSXA 4O1XD 1AIQA 1JU6A 1ZPRA 3DG8C 3BHRA 3EAWX 3GH2X 4FGTA 1B5DA 3NRRA 1AJMA 2RD8B 1KZIA 1TSLA 2FTNA 1BO7A 1KZJA 1SYNA 1VZEA 3HBBA 3N5EB 2G8AA 1VZCA 1NJAA 1BKOA 1TVWA 2A9WA 1FWMA 3EDWX 3EJLA 2RDAA 1AN5A 1BO8A 1BQ1A 2FTOX 3UM8A 4IQBA 1NCEA 3N5EA 5BY6A 4F2VA 1BIDA 3IRMA 3KGBA 1TVUA 1B5EA 1QZFA 1LCEA 1TRGA 1YPVA 2VF0A 3I3RA 4KY8A 3UM6A 1BDUA 4XSEA 5WRNA 1HZWA 1LCAA 4Q0DA 1TDCA 5HS3A 1JTQA 4Q0EA 4DPHA 4IRRA 1F28A 1JMFA 1I00A 3BZ0A 3C06A 4ISWA 4KYAA 1BQ2A 3QGTA 4XSDA 4H0RA 3UWLB 1BJGA 3GH0A 4KNZA 4E28A 1TLCA 1TSZA 3DGAC 4ECKA 5H38A 2AAZA 1J3JC 2FTQA 2G89A 1JG0A 1F4BA 4FQSA 4DPDA 2G8DA 3IX6A 4FOXA 2RD8A 1B02A 3CLBA 4G2OX 3BGXA 4EZ8A 4DQ1A 1F4GA 4H1IA 3UM5A 1TSNA 1F4CA 4ISKA 1EVFA 1JMGA 4KPWA 4EILA 1EV8A 3IHIA 4O1UA 1BP6A 2H2QA 3EGYX 1TSDA 1TVVA 3IROA 1EVGA 3KJRA 4O7UA 1TISA 1DDUA 1JMIA 1NJCA 3OB7A 1VZBA 3BFIA 4GEVA 3BHLA 1JTUA 3IK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JUT A;  1BP0 A;  4LRR A;  2BBQ A;  3DL5 A;  1BKP A;  2VET A;  4EIN A;  3BNZ A;  1TDA A;  4G6W X;  1BPJ A;  3IK0 A;  1TDB A;  3B9H A;  4O1X A;  1RTS A;  5H39 A;  5H3A A;  3QG2 A;  3IRN A;  1TSM A;  4DP3 A;  1JUJ A;  1BSF A;  4KY4 A;  1AOB A;  1TDU A;  3UWL A;  3HB8 A;  2G8X A;  2TDM A;  1EV5 A;  1HW3 A;  3K2H A;  3V8H A;  1TYS A;  1F4F A;  3EBU A;  3GG5 A;  3KJS A;  1TSV A;  2TSR A;  1TLS A;  3CL9 A;  4GYH A;  1NJD A;  1JMH A;  2OIP A;  3ED7 A;  4IQQ A;  3EHI X;  1THY A;  3TMS A;  1TSY A;  1HW4 A;  1SEJ A;  1VZD A;  1AXW A;  4E5O A;  1TSW A;  2KCE A;  3INV A;  1VZA A;  2TSC A;  4FOG A;  3DL6 A;  5FCT A;  4EB4 A;  1CI7 A;  1J3K C;  4UP1 A;  1F4E A;  1NJB A;  2ONB A;  3IJZ A;  4TMS A;  4FOA A;  4XSC A;  3N5G A;  3QJ7 A;  4PSG A;  4JEF A;  4H0U A;  2TDD A;  1HVY A;  3EF9 A;  3H9K A;  1B49 A;  3HJ3 A;  1DNA A;  1LCB A;  1FFL A;  2G86 A;  3B5B A;  1KCE A;  3C0A A;  3BYX A;  1QQQ A;  1TJS A;  3JSU A;  1NJE A;  1F4D A;  1BSP A;  1J3I C;  5J7W A;  4GD7 A;  1TSX A;  4O1X D;  1AIQ A;  1JU6 A;  1ZPR A;  3DG8 C;  3BHR A;  3EAW X;  3GH2 X;  4FGT A;  1B5D A;  3NRR A;  1AJM A;  2RD8 B;  1KZI A;  1TSL A;  2FTN A;  1BO7 A;  1KZJ A;  1SYN A;  1VZE A;  3HBB A;  3N5E B;  2G8A A;  1VZC A;  1NJA A;  1BKO A;  1TVW A;  2A9W A;  1FWM A;  3EDW X;  3EJL A;  2RDA A;  1AN5 A;  1BO8 A;  1BQ1 A;  2FTO X;  3UM8 A;  4IQB A;  1NCE A;  3N5E A;  5BY6 A;  4F2V A;  1BID A;  3IRM A;  3KGB A;  1TVU A;  1B5E A;  1QZF A;  1LCE A;  1TRG A;  1YPV A;  2VF0 A;  3I3R A;  4KY8 A;  3UM6 A;  1BDU A;  4XSE A;  5WRN A;  1HZW A;  1LCA A;  4Q0D A;  1TDC A;  5HS3 A;  1JTQ A;  4Q0E A;  4DPH A;  4IRR A;  1F28 A;  1JMF A;  1I00 A;  3BZ0 A;  3C06 A;  4ISW A;  4KYA A;  1BQ2 A;  3QGT A;  4XSD A;  4H0R A;  3UWL B;  1BJG A;  3GH0 A;  4KNZ A;  4E28 A;  1TLC A;  1TSZ A;  3DGA C;  4ECK A;  5H38 A;  2AAZ A;  1J3J C;  2FTQ A;  2G89 A;  1JG0 A;  1F4B A;  4FQS A;  4DPD A;  2G8D A;  3IX6 A;  4FOX A;  2RD8 A;  1B02 A;  3CLB A;  4G2O X;  3BGX A;  4EZ8 A;  4DQ1 A;  1F4G A;  4H1I A;  3UM5 A;  1TSN A;  1F4C A;  4ISK A;  1EVF A;  1JMG A;  4KPW A;  4EIL A;  1EV8 A;  3IHI A;  4O1U A;  1BP6 A;  2H2Q A;  3EGY X;  1TSD A;  1TVV A;  3IRO A;  1EVG A;  3KJR A;  4O7U A;  1TIS A;  1DDU A;  1JMI A;  1NJC A;  3OB7 A;  1VZB A;  3BFI A;  4GEV A;  3BHL A;  1JTU A;  3IK1 A; 
#chains in the Genus database with same CATH topology
 1JUT A;  1BP0 A;  4LRR A;  2BBQ A;  3DL5 A;  1BKP A;  2VET A;  4EIN A;  3BNZ A;  1TDA A;  4G6W X;  1BPJ A;  3IK0 A;  1TDB A;  3B9H A;  4O1X A;  1RTS A;  5H39 A;  5H3A A;  3QG2 A;  3IRN A;  1TSM A;  4DP3 A;  1JUJ A;  1BSF A;  4KY4 A;  1AOB A;  1TDU A;  3UWL A;  3HB8 A;  2G8X A;  2TDM A;  1EV5 A;  1HW3 A;  3K2H A;  3V8H A;  1TYS A;  1F4F A;  3EBU A;  3GG5 A;  3KJS A;  1TSV A;  2TSR A;  1TLS A;  3CL9 A;  4GYH A;  1NJD A;  1JMH A;  2OIP A;  3ED7 A;  4IQQ A;  3EHI X;  1THY A;  3TMS A;  1TSY A;  1HW4 A;  1SEJ A;  1VZD A;  1AXW A;  4E5O A;  1TSW A;  2KCE A;  3INV A;  1VZA A;  2TSC A;  4FOG A;  3DL6 A;  5FCT A;  4EB4 A;  1CI7 A;  1J3K C;  4UP1 A;  1F4E A;  1NJB A;  2ONB A;  3IJZ A;  4TMS A;  4FOA A;  4XSC A;  3N5G A;  3QJ7 A;  4PSG A;  4JEF A;  4H0U A;  2TDD A;  1HVY A;  3EF9 A;  3H9K A;  1B49 A;  3HJ3 A;  1DNA A;  1LCB A;  1FFL A;  2G86 A;  3B5B A;  1KCE A;  3C0A A;  3BYX A;  1QQQ A;  1TJS A;  3JSU A;  1NJE A;  1F4D A;  1BSP A;  1J3I C;  5J7W A;  4GD7 A;  1TSX A;  4O1X D;  1AIQ A;  1JU6 A;  1ZPR A;  3DG8 C;  3BHR A;  3EAW X;  3GH2 X;  4FGT A;  1B5D A;  3NRR A;  1AJM A;  2RD8 B;  1KZI A;  1TSL A;  2FTN A;  1BO7 A;  1KZJ A;  1SYN A;  1VZE A;  3HBB A;  3N5E B;  2G8A A;  1VZC A;  1NJA A;  1BKO A;  1TVW A;  2A9W A;  1FWM A;  3EDW X;  3EJL A;  2RDA A;  1AN5 A;  1BO8 A;  1BQ1 A;  2FTO X;  3UM8 A;  4IQB A;  1NCE A;  3N5E A;  5BY6 A;  4F2V A;  1BID A;  3IRM A;  3KGB A;  1TVU A;  1B5E A;  1QZF A;  1LCE A;  1TRG A;  1YPV A;  2VF0 A;  3I3R A;  4KY8 A;  3UM6 A;  1BDU A;  4XSE A;  5WRN A;  1HZW A;  1LCA A;  4Q0D A;  1TDC A;  5HS3 A;  1JTQ A;  4Q0E A;  4DPH A;  4IRR A;  1F28 A;  1JMF A;  1I00 A;  3BZ0 A;  3C06 A;  4ISW A;  4KYA A;  1BQ2 A;  3QGT A;  4XSD A;  4H0R A;  3UWL B;  1BJG A;  3GH0 A;  4KNZ A;  4E28 A;  1TLC A;  1TSZ A;  3DGA C;  4ECK A;  5H38 A;  2AAZ A;  1J3J C;  2FTQ A;  2G89 A;  1JG0 A;  1F4B A;  4FQS A;  4DPD A;  2G8D A;  3IX6 A;  4FOX A;  2RD8 A;  1B02 A;  3CLB A;  4G2O X;  3BGX A;  4EZ8 A;  4DQ1 A;  1F4G A;  4H1I A;  3UM5 A;  1TSN A;  1F4C A;  4ISK A;  1EVF A;  1JMG A;  4KPW A;  4EIL A;  1EV8 A;  3IHI A;  4O1U A;  1BP6 A;  2H2Q A;  3EGY X;  1TSD A;  1TVV A;  3IRO A;  1EVG A;  3KJR A;  4O7U A;  1TIS A;  1DDU A;  1JMI A;  1NJC A;  3OB7 A;  1VZB A;  3BFI A;  4GEV A;  3BHL A;  1JTU A;  3IK1 A; 
#chains in the Genus database with same CATH homology
 1JUT A;  1BP0 A;  4LRR A;  2BBQ A;  3DL5 A;  1BKP A;  2VET A;  4EIN A;  3BNZ A;  1TDA A;  4G6W X;  1BPJ A;  3IK0 A;  1TDB A;  3B9H A;  4O1X A;  1RTS A;  5H39 A;  5H3A A;  3QG2 A;  3IRN A;  1TSM A;  4DP3 A;  1JUJ A;  1BSF A;  4KY4 A;  1AOB A;  1TDU A;  3UWL A;  3HB8 A;  2G8X A;  2TDM A;  1EV5 A;  1HW3 A;  3K2H A;  3V8H A;  1TYS A;  1F4F A;  3EBU A;  3GG5 A;  3KJS A;  1TSV A;  2TSR A;  1TLS A;  3CL9 A;  4GYH A;  1NJD A;  1JMH A;  2OIP A;  3ED7 A;  4IQQ A;  3EHI X;  1THY A;  3TMS A;  1TSY A;  1HW4 A;  1SEJ A;  1VZD A;  1AXW A;  4E5O A;  1TSW A;  2KCE A;  3INV A;  1VZA A;  2TSC A;  4FOG A;  3DL6 A;  5FCT A;  4EB4 A;  1CI7 A;  1J3K C;  4UP1 A;  1F4E A;  1NJB A;  2ONB A;  3IJZ A;  4TMS A;  4FOA A;  4XSC A;  3N5G A;  3QJ7 A;  4PSG A;  4JEF A;  4H0U A;  2TDD A;  1HVY A;  3EF9 A;  3H9K A;  1B49 A;  3HJ3 A;  1DNA A;  1LCB A;  1FFL A;  2G86 A;  3B5B A;  1KCE A;  3C0A A;  3BYX A;  1QQQ A;  1TJS A;  3JSU A;  1NJE A;  1F4D A;  1BSP A;  1J3I C;  5J7W A;  4GD7 A;  1TSX A;  4O1X D;  1AIQ A;  1JU6 A;  1ZPR A;  3DG8 C;  3BHR A;  3EAW X;  3GH2 X;  4FGT A;  1B5D A;  3NRR A;  1AJM A;  2RD8 B;  1KZI A;  1TSL A;  2FTN A;  1BO7 A;  1KZJ A;  1SYN A;  1VZE A;  3HBB A;  3N5E B;  2G8A A;  1VZC A;  1NJA A;  1BKO A;  1TVW A;  2A9W A;  1FWM A;  3EDW X;  3EJL A;  2RDA A;  1AN5 A;  1BO8 A;  1BQ1 A;  2FTO X;  3UM8 A;  4IQB A;  1NCE A;  3N5E A;  5BY6 A;  4F2V A;  1BID A;  3IRM A;  3KGB A;  1TVU A;  1B5E A;  1QZF A;  1LCE A;  1TRG A;  1YPV A;  2VF0 A;  3I3R A;  4KY8 A;  3UM6 A;  1BDU A;  4XSE A;  5WRN A;  1HZW A;  1LCA A;  4Q0D A;  1TDC A;  5HS3 A;  1JTQ A;  4Q0E A;  4DPH A;  4IRR A;  1F28 A;  1JMF A;  1I00 A;  3BZ0 A;  3C06 A;  4ISW A;  4KYA A;  1BQ2 A;  3QGT A;  4XSD A;  4H0R A;  3UWL B;  1BJG A;  3GH0 A;  4KNZ A;  4E28 A;  1TLC A;  1TSZ A;  3DGA C;  4ECK A;  5H38 A;  2AAZ A;  1J3J C;  2FTQ A;  2G89 A;  1JG0 A;  1F4B A;  4FQS A;  4DPD A;  2G8D A;  3IX6 A;  4FOX A;  2RD8 A;  1B02 A;  3CLB A;  4G2O X;  3BGX A;  4EZ8 A;  4DQ1 A;  1F4G A;  4H1I A;  3UM5 A;  1TSN A;  1F4C A;  4ISK A;  1EVF A;  1JMG A;  4KPW A;  4EIL A;  1EV8 A;  3IHI A;  4O1U A;  1BP6 A;  2H2Q A;  3EGY X;  1TSD A;  1TVV A;  3IRO A;  1EVG A;  3KJR A;  4O7U A;  1TIS A;  1DDU A;  1JMI A;  1NJC A;  3OB7 A;  1VZB A;  3BFI A;  4GEV A;  3BHL A;  1JTU A;  3IK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...