5BY6A

Crystal structure of trichinella spiralis thymidylate synthase complexed with dump
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
284
structure length
284
Chain Sequence
DYVNQEELNYLNQLKDIIDHGVRKNDRTGIGTLSTFGTQSRYCLRDDIFPLLTTKRVFWRGVVEELLWFISGSTNAKQLSEKNVNIWDGNSSREFLDSRGLYNYEEGDLGPVYGFQWRHFGCPYSSMTADYKGKGYDQLQQCIKMIREEPESRRIIMTAWNPCDLEKVALPPCHCFVQFYVADGELSCQMYQRSADMGLGVPFNIASYSLLTRMIAHITSLKPGFFIHTIGDAHVYLTHVDALKVQMERKPRPFPKLKILRNVENIDDFRAEDFELINYKPYPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase
publication title Crystal structures of nematode (parasitic T. spiralis and free living C. elegans), compared to mammalian, thymidylate synthases (TS). Molecular docking and molecular dynamics simulations in search for nematode-specific inhibitors of TS.
pubmed doi rcsb
source organism Trichinella spiralis
total genus 98
structure length 284
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2015-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 5by6A00
1VZDA 1BPJA 1AXWA 3K2HA 3GH0A 4XSCA 4GYHA 1KCEA 1NJEA 3OB7A 3GH2X 3GG5A 2TSCA 3KJRA 1VZEA 1LCEA 5H3AA 1DDUA 1TDCA 3NRRA 1QQQA 2TSRA 1F4BA 3HB8A 4FQSA 1J3JC 3EF9A 4EILA 3UM6A 1VZCA 1JMHA 3QG2A 1SYNA 3HJ3A 1TSMA 2VF0A 2VETA 3DL6A 1TSLA 2OIPA 2RDAA 4E5OA 3C06A 1FWMA 4H1IA 4E28A 1JUJA 4EINA 2G8AA 2ONBA 4H0UA 4O7UA 3UWLA 5BY6A 1F4CA 1LCBA 1BKPA 1EV5A 1BO7A 2G8DA 3N5GA 3UM8A 1NCEA 1BJGA 4TMSA 3IRNA 1BQ2A 1NJCA 3EBUA 4XSDA 3V8HA 1I00A 1NJBA 1BSFA 4ISWA 1TISA 3BZ0A 2H2QA 1TSNA 3IHIA 4Q0DA 1BP0A 4KY8A 3IK1A 1BO8A 4EZ8A 3DG8C 4DQ1A 1J3IC 1TSWA 4KPWA 2RD8B 1F28A 4H0RA 4Q0EA 1TSXA 5FCTA 3IK0A 1BQ1A 2BBQA 1BDUA 2G89A 1F4GA 1HZWA 1NJAA 1ZPRA 1AN5A 1SEJA 2FTQA 2G86A 4IRRA 1AOBA 5H38A 1JMFA 2KCEA 3ED7A 3HBBA 3N5EB 1DNAA 1HW3A 4FOAA 1F4DA 1TDUA 1VZAA 1B49A 1TSZA 2A9WA 1JMGA 1JTQA 1EVGA 3QJ7A 1TRGA 1LCAA 2TDMA 4DPHA 5WRNA 1J3KC 3B9HA 4O1XA 4FGTA 1TDBA 3KJSA 1NJDA 1B5EA 3EDWX 4DP3A 3BFIA 4FOGA 4ECKA 1TSYA 3EHIX 1TVVA 3H9KA 1JG0A 1JMIA 2G8XA 3BHRA 4JEFA 4O1UA 3KGBA 1B02A 4DPDA 1BKOA 1HVYA 4IQBA 4FOXA 3CLBA 3QGTA 3UM5A 5HS3A 1AIQA 4UP1A 1KZIA 1TSVA 5J7WA 1QZFA 1TYSA 4KY4A 4LRRA 3UWLB 4O1XD 4G6WX 3IX6A 3BHLA 4F2VA 1RTSA 1EV8A 1TLCA 4KYAA 1FFLA 1HW4A 3JSUA 3BNZA 2FTNA 1JU6A 3CL9A 2FTOX 1JTUA 4EB4A 1CI7A 4IQQA 1TJSA 3DGAC 1THYA 1JUTA 3IRMA 3TMSA 1TVWA 1F4FA 1TDAA 1TVUA 2AAZA 2RD8A 3IROA 1KZJA 3IJZA 5H39A 1AJMA 1TLSA 3EGYX 3BGXA 3INVA 3EAWX 4KNZA 1BSPA 4GD7A 1BIDA 1TSDA 4G2OX 3N5EA 4XSEA 1B5DA 1F4EA 1YPVA 2TDDA 3B5BA 3C0AA 3EJLA 4GEVA 4PSGA 1VZBA 3I3RA 1BP6A 3DL5A 3BYXA 4ISKA 1EVFA
chains in the Genus database with same CATH superfamily
1VZDA 1BPJA 1AXWA 3K2HA 3GH0A 4XSCA 4GYHA 1KCEA 1NJEA 3OB7A 3GH2X 3GG5A 2TSCA 3KJRA 1VZEA 1LCEA 5H3AA 1DDUA 1TDCA 3NRRA 1QQQA 2TSRA 1F4BA 3HB8A 4FQSA 1J3JC 3EF9A 4EILA 3UM6A 1VZCA 1JMHA 3QG2A 1SYNA 3HJ3A 1TSMA 2VF0A 2VETA 3DL6A 1TSLA 2OIPA 2RDAA 4E5OA 3C06A 1FWMA 4H1IA 4E28A 1JUJA 4EINA 2G8AA 2ONBA 4H0UA 4O7UA 3UWLA 5BY6A 1F4CA 1LCBA 1BKPA 1EV5A 1BO7A 2G8DA 3N5GA 3UM8A 1NCEA 1BJGA 4TMSA 3IRNA 1BQ2A 1NJCA 3EBUA 4XSDA 3V8HA 1I00A 1NJBA 1BSFA 4ISWA 1TISA 3BZ0A 2H2QA 1TSNA 3IHIA 4Q0DA 1BP0A 4KY8A 3IK1A 1BO8A 4EZ8A 3DG8C 4DQ1A 1J3IC 1TSWA 4KPWA 2RD8B 1F28A 4H0RA 4Q0EA 1TSXA 5FCTA 3IK0A 1BQ1A 2BBQA 1BDUA 2G89A 1F4GA 1HZWA 1NJAA 1ZPRA 1AN5A 1SEJA 2FTQA 2G86A 4IRRA 1AOBA 5H38A 1JMFA 2KCEA 3ED7A 3HBBA 3N5EB 1DNAA 1HW3A 4FOAA 1F4DA 1TDUA 1VZAA 1B49A 1TSZA 2A9WA 1JMGA 1JTQA 1EVGA 3QJ7A 1TRGA 1LCAA 2TDMA 4DPHA 5WRNA 1J3KC 3B9HA 4O1XA 4FGTA 1TDBA 3KJSA 1NJDA 1B5EA 3EDWX 4DP3A 3BFIA 4FOGA 4ECKA 1TSYA 3EHIX 1TVVA 3H9KA 1JG0A 1JMIA 2G8XA 3BHRA 4JEFA 4O1UA 3KGBA 1B02A 4DPDA 1BKOA 1HVYA 4IQBA 4FOXA 3CLBA 3QGTA 3UM5A 5HS3A 1AIQA 4UP1A 1KZIA 1TSVA 5J7WA 1QZFA 1TYSA 4KY4A 4LRRA 3UWLB 4O1XD 4G6WX 3IX6A 3BHLA 4F2VA 1RTSA 1EV8A 1TLCA 4KYAA 1FFLA 1HW4A 3JSUA 3BNZA 2FTNA 1JU6A 3CL9A 2FTOX 1JTUA 4EB4A 1CI7A 4IQQA 1TJSA 3DGAC 1THYA 1JUTA 3IRMA 3TMSA 1TVWA 1F4FA 1TDAA 1TVUA 2AAZA 2RD8A 3IROA 1KZJA 3IJZA 5H39A 1AJMA 1TLSA 3EGYX 3BGXA 3INVA 3EAWX 4KNZA 1BSPA 4GD7A 1BIDA 1TSDA 4G2OX 3N5EA 4XSEA 1B5DA 1F4EA 1YPVA 2TDDA 3B5BA 3C0AA 3EJLA 4GEVA 4PSGA 1VZBA 3I3RA 1BP6A 3DL5A 3BYXA 4ISKA 1EVFA
chains in the Genus database with same CATH topology
1VZDA 1BPJA 1AXWA 3K2HA 3GH0A 4XSCA 4GYHA 1KCEA 1NJEA 3OB7A 3GH2X 3GG5A 2TSCA 3KJRA 1VZEA 1LCEA 5H3AA 1DDUA 1TDCA 3NRRA 1QQQA 2TSRA 1F4BA 3HB8A 4FQSA 1J3JC 3EF9A 4EILA 3UM6A 1VZCA 1JMHA 3QG2A 1SYNA 3HJ3A 1TSMA 2VF0A 2VETA 3DL6A 1TSLA 2OIPA 2RDAA 4E5OA 3C06A 1FWMA 4H1IA 4E28A 1JUJA 4EINA 2G8AA 2ONBA 4H0UA 4O7UA 3UWLA 5BY6A 1F4CA 1LCBA 1BKPA 1EV5A 1BO7A 2G8DA 3N5GA 3UM8A 1NCEA 1BJGA 4TMSA 3IRNA 1BQ2A 1NJCA 3EBUA 4XSDA 3V8HA 1I00A 1NJBA 1BSFA 4ISWA 1TISA 3BZ0A 2H2QA 1TSNA 3IHIA 4Q0DA 1BP0A 4KY8A 3IK1A 1BO8A 4EZ8A 3DG8C 4DQ1A 1J3IC 1TSWA 4KPWA 2RD8B 1F28A 4H0RA 4Q0EA 1TSXA 5FCTA 3IK0A 1BQ1A 2BBQA 1BDUA 2G89A 1F4GA 1HZWA 1NJAA 1ZPRA 1AN5A 1SEJA 2FTQA 2G86A 4IRRA 1AOBA 5H38A 1JMFA 2KCEA 3ED7A 3HBBA 3N5EB 1DNAA 1HW3A 4FOAA 1F4DA 1TDUA 1VZAA 1B49A 1TSZA 2A9WA 1JMGA 1JTQA 1EVGA 3QJ7A 1TRGA 1LCAA 2TDMA 4DPHA 5WRNA 1J3KC 3B9HA 4O1XA 4FGTA 1TDBA 3KJSA 1NJDA 1B5EA 3EDWX 4DP3A 3BFIA 4FOGA 4ECKA 1TSYA 3EHIX 1TVVA 3H9KA 1JG0A 1JMIA 2G8XA 3BHRA 4JEFA 4O1UA 3KGBA 1B02A 4DPDA 1BKOA 1HVYA 4IQBA 4FOXA 3CLBA 3QGTA 3UM5A 5HS3A 1AIQA 4UP1A 1KZIA 1TSVA 5J7WA 1QZFA 1TYSA 4KY4A 4LRRA 3UWLB 4O1XD 4G6WX 3IX6A 3BHLA 4F2VA 1RTSA 1EV8A 1TLCA 4KYAA 1FFLA 1HW4A 3JSUA 3BNZA 2FTNA 1JU6A 3CL9A 2FTOX 1JTUA 4EB4A 1CI7A 4IQQA 1TJSA 3DGAC 1THYA 1JUTA 3IRMA 3TMSA 1TVWA 1F4FA 1TDAA 1TVUA 2AAZA 2RD8A 3IROA 1KZJA 3IJZA 5H39A 1AJMA 1TLSA 3EGYX 3BGXA 3INVA 3EAWX 4KNZA 1BSPA 4GD7A 1BIDA 1TSDA 4G2OX 3N5EA 4XSEA 1B5DA 1F4EA 1YPVA 2TDDA 3B5BA 3C0AA 3EJLA 4GEVA 4PSGA 1VZBA 3I3RA 1BP6A 3DL5A 3BYXA 4ISKA 1EVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZD A;  1BPJ A;  1AXW A;  3K2H A;  3GH0 A;  4XSC A;  4GYH A;  1KCE A;  1NJE A;  3OB7 A;  3GH2 X;  3GG5 A;  2TSC A;  3KJR A;  1VZE A;  1LCE A;  5H3A A;  1DDU A;  1TDC A;  3NRR A;  1QQQ A;  2TSR A;  1F4B A;  3HB8 A;  4FQS A;  1J3J C;  3EF9 A;  4EIL A;  3UM6 A;  1VZC A;  1JMH A;  3QG2 A;  1SYN A;  3HJ3 A;  1TSM A;  2VF0 A;  2VET A;  3DL6 A;  1TSL A;  2OIP A;  2RDA A;  4E5O A;  3C06 A;  1FWM A;  4H1I A;  4E28 A;  1JUJ A;  4EIN A;  2G8A A;  2ONB A;  4H0U A;  4O7U A;  3UWL A;  5BY6 A;  1F4C A;  1LCB A;  1BKP A;  1EV5 A;  1BO7 A;  2G8D A;  3N5G A;  3UM8 A;  1NCE A;  1BJG A;  4TMS A;  3IRN A;  1BQ2 A;  1NJC A;  3EBU A;  4XSD A;  3V8H A;  1I00 A;  1NJB A;  1BSF A;  4ISW A;  1TIS A;  3BZ0 A;  2H2Q A;  1TSN A;  3IHI A;  4Q0D A;  1BP0 A;  4KY8 A;  3IK1 A;  1BO8 A;  4EZ8 A;  3DG8 C;  4DQ1 A;  1J3I C;  1TSW A;  4KPW A;  2RD8 B;  1F28 A;  4H0R A;  4Q0E A;  1TSX A;  5FCT A;  3IK0 A;  1BQ1 A;  2BBQ A;  1BDU A;  2G89 A;  1F4G A;  1HZW A;  1NJA A;  1ZPR A;  1AN5 A;  1SEJ A;  2FTQ A;  2G86 A;  4IRR A;  1AOB A;  5H38 A;  1JMF A;  2KCE A;  3ED7 A;  3HBB A;  3N5E B;  1DNA A;  1HW3 A;  4FOA A;  1F4D A;  1TDU A;  1VZA A;  1B49 A;  1TSZ A;  2A9W A;  1JMG A;  1JTQ A;  1EVG A;  3QJ7 A;  1TRG A;  1LCA A;  2TDM A;  4DPH A;  5WRN A;  1J3K C;  3B9H A;  4O1X A;  4FGT A;  1TDB A;  3KJS A;  1NJD A;  1B5E A;  3EDW X;  4DP3 A;  3BFI A;  4FOG A;  4ECK A;  1TSY A;  3EHI X;  1TVV A;  3H9K A;  1JG0 A;  1JMI A;  2G8X A;  3BHR A;  4JEF A;  4O1U A;  3KGB A;  1B02 A;  4DPD A;  1BKO A;  1HVY A;  4IQB A;  4FOX A;  3CLB A;  3QGT A;  3UM5 A;  5HS3 A;  1AIQ A;  4UP1 A;  1KZI A;  1TSV A;  5J7W A;  1QZF A;  1TYS A;  4KY4 A;  4LRR A;  3UWL B;  4O1X D;  4G6W X;  3IX6 A;  3BHL A;  4F2V A;  1RTS A;  1EV8 A;  1TLC A;  4KYA A;  1FFL A;  1HW4 A;  3JSU A;  3BNZ A;  2FTN A;  1JU6 A;  3CL9 A;  2FTO X;  1JTU A;  4EB4 A;  1CI7 A;  4IQQ A;  1TJS A;  3DGA C;  1THY A;  1JUT A;  3IRM A;  3TMS A;  1TVW A;  1F4F A;  1TDA A;  1TVU A;  2AAZ A;  2RD8 A;  3IRO A;  1KZJ A;  3IJZ A;  5H39 A;  1AJM A;  1TLS A;  3EGY X;  3BGX A;  3INV A;  3EAW X;  4KNZ A;  1BSP A;  4GD7 A;  1BID A;  1TSD A;  4G2O X;  3N5E A;  4XSE A;  1B5D A;  1F4E A;  1YPV A;  2TDD A;  3B5B A;  3C0A A;  3EJL A;  4GEV A;  4PSG A;  1VZB A;  3I3R A;  1BP6 A;  3DL5 A;  3BYX A;  4ISK A;  1EVF A; 
#chains in the Genus database with same CATH topology
 1VZD A;  1BPJ A;  1AXW A;  3K2H A;  3GH0 A;  4XSC A;  4GYH A;  1KCE A;  1NJE A;  3OB7 A;  3GH2 X;  3GG5 A;  2TSC A;  3KJR A;  1VZE A;  1LCE A;  5H3A A;  1DDU A;  1TDC A;  3NRR A;  1QQQ A;  2TSR A;  1F4B A;  3HB8 A;  4FQS A;  1J3J C;  3EF9 A;  4EIL A;  3UM6 A;  1VZC A;  1JMH A;  3QG2 A;  1SYN A;  3HJ3 A;  1TSM A;  2VF0 A;  2VET A;  3DL6 A;  1TSL A;  2OIP A;  2RDA A;  4E5O A;  3C06 A;  1FWM A;  4H1I A;  4E28 A;  1JUJ A;  4EIN A;  2G8A A;  2ONB A;  4H0U A;  4O7U A;  3UWL A;  5BY6 A;  1F4C A;  1LCB A;  1BKP A;  1EV5 A;  1BO7 A;  2G8D A;  3N5G A;  3UM8 A;  1NCE A;  1BJG A;  4TMS A;  3IRN A;  1BQ2 A;  1NJC A;  3EBU A;  4XSD A;  3V8H A;  1I00 A;  1NJB A;  1BSF A;  4ISW A;  1TIS A;  3BZ0 A;  2H2Q A;  1TSN A;  3IHI A;  4Q0D A;  1BP0 A;  4KY8 A;  3IK1 A;  1BO8 A;  4EZ8 A;  3DG8 C;  4DQ1 A;  1J3I C;  1TSW A;  4KPW A;  2RD8 B;  1F28 A;  4H0R A;  4Q0E A;  1TSX A;  5FCT A;  3IK0 A;  1BQ1 A;  2BBQ A;  1BDU A;  2G89 A;  1F4G A;  1HZW A;  1NJA A;  1ZPR A;  1AN5 A;  1SEJ A;  2FTQ A;  2G86 A;  4IRR A;  1AOB A;  5H38 A;  1JMF A;  2KCE A;  3ED7 A;  3HBB A;  3N5E B;  1DNA A;  1HW3 A;  4FOA A;  1F4D A;  1TDU A;  1VZA A;  1B49 A;  1TSZ A;  2A9W A;  1JMG A;  1JTQ A;  1EVG A;  3QJ7 A;  1TRG A;  1LCA A;  2TDM A;  4DPH A;  5WRN A;  1J3K C;  3B9H A;  4O1X A;  4FGT A;  1TDB A;  3KJS A;  1NJD A;  1B5E A;  3EDW X;  4DP3 A;  3BFI A;  4FOG A;  4ECK A;  1TSY A;  3EHI X;  1TVV A;  3H9K A;  1JG0 A;  1JMI A;  2G8X A;  3BHR A;  4JEF A;  4O1U A;  3KGB A;  1B02 A;  4DPD A;  1BKO A;  1HVY A;  4IQB A;  4FOX A;  3CLB A;  3QGT A;  3UM5 A;  5HS3 A;  1AIQ A;  4UP1 A;  1KZI A;  1TSV A;  5J7W A;  1QZF A;  1TYS A;  4KY4 A;  4LRR A;  3UWL B;  4O1X D;  4G6W X;  3IX6 A;  3BHL A;  4F2V A;  1RTS A;  1EV8 A;  1TLC A;  4KYA A;  1FFL A;  1HW4 A;  3JSU A;  3BNZ A;  2FTN A;  1JU6 A;  3CL9 A;  2FTO X;  1JTU A;  4EB4 A;  1CI7 A;  4IQQ A;  1TJS A;  3DGA C;  1THY A;  1JUT A;  3IRM A;  3TMS A;  1TVW A;  1F4F A;  1TDA A;  1TVU A;  2AAZ A;  2RD8 A;  3IRO A;  1KZJ A;  3IJZ A;  5H39 A;  1AJM A;  1TLS A;  3EGY X;  3BGX A;  3INV A;  3EAW X;  4KNZ A;  1BSP A;  4GD7 A;  1BID A;  1TSD A;  4G2O X;  3N5E A;  4XSE A;  1B5D A;  1F4E A;  1YPV A;  2TDD A;  3B5B A;  3C0A A;  3EJL A;  4GEV A;  4PSG A;  1VZB A;  3I3R A;  1BP6 A;  3DL5 A;  3BYX A;  4ISK A;  1EVF A; 
#chains in the Genus database with same CATH homology
 1VZD A;  1BPJ A;  1AXW A;  3K2H A;  3GH0 A;  4XSC A;  4GYH A;  1KCE A;  1NJE A;  3OB7 A;  3GH2 X;  3GG5 A;  2TSC A;  3KJR A;  1VZE A;  1LCE A;  5H3A A;  1DDU A;  1TDC A;  3NRR A;  1QQQ A;  2TSR A;  1F4B A;  3HB8 A;  4FQS A;  1J3J C;  3EF9 A;  4EIL A;  3UM6 A;  1VZC A;  1JMH A;  3QG2 A;  1SYN A;  3HJ3 A;  1TSM A;  2VF0 A;  2VET A;  3DL6 A;  1TSL A;  2OIP A;  2RDA A;  4E5O A;  3C06 A;  1FWM A;  4H1I A;  4E28 A;  1JUJ A;  4EIN A;  2G8A A;  2ONB A;  4H0U A;  4O7U A;  3UWL A;  5BY6 A;  1F4C A;  1LCB A;  1BKP A;  1EV5 A;  1BO7 A;  2G8D A;  3N5G A;  3UM8 A;  1NCE A;  1BJG A;  4TMS A;  3IRN A;  1BQ2 A;  1NJC A;  3EBU A;  4XSD A;  3V8H A;  1I00 A;  1NJB A;  1BSF A;  4ISW A;  1TIS A;  3BZ0 A;  2H2Q A;  1TSN A;  3IHI A;  4Q0D A;  1BP0 A;  4KY8 A;  3IK1 A;  1BO8 A;  4EZ8 A;  3DG8 C;  4DQ1 A;  1J3I C;  1TSW A;  4KPW A;  2RD8 B;  1F28 A;  4H0R A;  4Q0E A;  1TSX A;  5FCT A;  3IK0 A;  1BQ1 A;  2BBQ A;  1BDU A;  2G89 A;  1F4G A;  1HZW A;  1NJA A;  1ZPR A;  1AN5 A;  1SEJ A;  2FTQ A;  2G86 A;  4IRR A;  1AOB A;  5H38 A;  1JMF A;  2KCE A;  3ED7 A;  3HBB A;  3N5E B;  1DNA A;  1HW3 A;  4FOA A;  1F4D A;  1TDU A;  1VZA A;  1B49 A;  1TSZ A;  2A9W A;  1JMG A;  1JTQ A;  1EVG A;  3QJ7 A;  1TRG A;  1LCA A;  2TDM A;  4DPH A;  5WRN A;  1J3K C;  3B9H A;  4O1X A;  4FGT A;  1TDB A;  3KJS A;  1NJD A;  1B5E A;  3EDW X;  4DP3 A;  3BFI A;  4FOG A;  4ECK A;  1TSY A;  3EHI X;  1TVV A;  3H9K A;  1JG0 A;  1JMI A;  2G8X A;  3BHR A;  4JEF A;  4O1U A;  3KGB A;  1B02 A;  4DPD A;  1BKO A;  1HVY A;  4IQB A;  4FOX A;  3CLB A;  3QGT A;  3UM5 A;  5HS3 A;  1AIQ A;  4UP1 A;  1KZI A;  1TSV A;  5J7W A;  1QZF A;  1TYS A;  4KY4 A;  4LRR A;  3UWL B;  4O1X D;  4G6W X;  3IX6 A;  3BHL A;  4F2V A;  1RTS A;  1EV8 A;  1TLC A;  4KYA A;  1FFL A;  1HW4 A;  3JSU A;  3BNZ A;  2FTN A;  1JU6 A;  3CL9 A;  2FTO X;  1JTU A;  4EB4 A;  1CI7 A;  4IQQ A;  1TJS A;  3DGA C;  1THY A;  1JUT A;  3IRM A;  3TMS A;  1TVW A;  1F4F A;  1TDA A;  1TVU A;  2AAZ A;  2RD8 A;  3IRO A;  1KZJ A;  3IJZ A;  5H39 A;  1AJM A;  1TLS A;  3EGY X;  3BGX A;  3INV A;  3EAW X;  4KNZ A;  1BSP A;  4GD7 A;  1BID A;  1TSD A;  4G2O X;  3N5E A;  4XSE A;  1B5D A;  1F4E A;  1YPV A;  2TDD A;  3B5B A;  3C0A A;  3EJL A;  4GEV A;  4PSG A;  1VZB A;  3I3R A;  1BP6 A;  3DL5 A;  3BYX A;  4ISK A;  1EVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...