5FCTA

Mouse thymidylate synthase in ternary complex with fdump and methylenetetrahydrofolate.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
287
structure length
287
Chain Sequence
RHGELQYLRQVEHILRCGFKKEDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVRIWDANGSRDFLDSLGFSARQEGDLGPVYGFQWRHFGAEYKDMDSDYSGQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVNGELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLKILRKVETIDDFKVEDFQIEGYNPHPTIKMEMAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase
publication title Mouse thymidylate synthase does not show the inactive conformation, observed for the human enzyme
doi rcsb
source organism Mus musculus
total genus 96
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 5fctA00
1B49A 4UP1A 1AOBA 3IX6A 4KYAA 1F4BA 1FFLA 1BIDA 3HBBA 2VF0A 1THYA 1EV5A 1BPJA 1EV8A 4EZ8A 4H0UA 2FTOX 5FCTA 4O1UA 3EAWX 1ZPRA 1DDUA 1JU6A 4EINA 1BSFA 1FWMA 3KJRA 2AAZA 3INVA 1J3JC 4FQSA 1I00A 3KJSA 1TDCA 3EHIX 4KY8A 1BP0A 1YPVA 1VZBA 4Q0EA 5J7WA 2TDDA 4XSCA 4EILA 4TMSA 3I3RA 1TLSA 1JG0A 1BJGA 2ONBA 1TSXA 1HW4A 5BY6A 4Q0DA 1TJSA 2G8AA 4DP3A 1BP6A 1BKOA 4XSDA 4IRRA 3EF9A 3BHRA 1NCEA 2G8XA 1F4DA 1TSLA 1CI7A 1HVYA 1KZIA 2FTNA 3IJZA 3B5BA 1NJEA 4IQBA 1TISA 3HB8A 1F4GA 1JTUA 3DG8C 3BHLA 1JMFA 4ECKA 2FTQA 1VZAA 3CL9A 5H3AA 3UM8A 1TSWA 1B5DA 4KPWA 1VZEA 2G86A 5WRNA 4KNZA 1AJMA 4KY4A 1TDAA 1JMGA 1LCAA 4O7UA 3NRRA 1JMIA 1F28A 1NJAA 3GH0A 3HJ3A 1JUTA 4F2VA 1SYNA 4E5OA 3EDWX 1F4FA 3CLBA 1BDUA 2H2QA 4LRRA 1LCBA 2KCEA 2OIPA 2TSRA 2TSCA 1AN5A 1J3IC 4FGTA 1AXWA 1EVGA 1BQ1A 1F4CA 3DL6A 4GD7A 4ISWA 3V8HA 1NJDA 1BSPA 3B9HA 4H1IA 1B02A 3GG5A 4FOGA 1HW3A 1TSZA 3UM5A 3EBUA 1TSMA 3N5EA 4GEVA 1NJCA 1QQQA 1F4EA 1TDBA 2G8DA 4E28A 3C06A 2BBQA 1JMHA 3IRNA 3BGXA 1TVUA 3IK1A 3QJ7A 3ED7A 3EGYX 1NJBA 4FOAA 4DPDA 3UWLA 1BKPA 3BYXA 1JUJA 3BZ0A 1TRGA 3UM6A 5HS3A 1BO7A 1TSDA 2RD8A 4ISKA 4EB4A 2G89A 3N5GA 3KGBA 3OB7A 3N5EB 4DQ1A 1BQ2A 4H0RA 1LCEA 3BNZA 1QZFA 3K2HA 3H9KA 1TSYA 3DGAC 1KCEA 1VZCA 1AIQA 1TDUA 3QG2A 4O1XD 1TVVA 4O1XA 1EVFA 3DL5A 3GH2X 3IK0A 3JSUA 1SEJA 1J3KC 3C0AA 4XSEA 3BFIA 3IHIA 1KZJA 1BO8A 1TSNA 3QGTA 4DPHA 4PSGA 1TSVA 3UWLB 3TMSA 3IRMA 2RDAA 1VZDA 1B5EA 1RTSA 5H39A 4G6WX 4IQQA 2A9WA 1HZWA 2RD8B 3IROA 5H38A 1JTQA 1TVWA 4FOXA 1TLCA 2TDMA 2VETA 4GYHA 1DNAA 4G2OX 1TYSA 4JEFA 3EJLA
chains in the Genus database with same CATH superfamily
1B49A 4UP1A 1AOBA 3IX6A 4KYAA 1F4BA 1FFLA 1BIDA 3HBBA 2VF0A 1THYA 1EV5A 1BPJA 1EV8A 4EZ8A 4H0UA 2FTOX 5FCTA 4O1UA 3EAWX 1ZPRA 1DDUA 1JU6A 4EINA 1BSFA 1FWMA 3KJRA 2AAZA 3INVA 1J3JC 4FQSA 1I00A 3KJSA 1TDCA 3EHIX 4KY8A 1BP0A 1YPVA 1VZBA 4Q0EA 5J7WA 2TDDA 4XSCA 4EILA 4TMSA 3I3RA 1TLSA 1JG0A 1BJGA 2ONBA 1TSXA 1HW4A 5BY6A 4Q0DA 1TJSA 2G8AA 4DP3A 1BP6A 1BKOA 4XSDA 4IRRA 3EF9A 3BHRA 1NCEA 2G8XA 1F4DA 1TSLA 1CI7A 1HVYA 1KZIA 2FTNA 3IJZA 3B5BA 1NJEA 4IQBA 1TISA 3HB8A 1F4GA 1JTUA 3DG8C 3BHLA 1JMFA 4ECKA 2FTQA 1VZAA 3CL9A 5H3AA 3UM8A 1TSWA 1B5DA 4KPWA 1VZEA 2G86A 5WRNA 4KNZA 1AJMA 4KY4A 1TDAA 1JMGA 1LCAA 4O7UA 3NRRA 1JMIA 1F28A 1NJAA 3GH0A 3HJ3A 1JUTA 4F2VA 1SYNA 4E5OA 3EDWX 1F4FA 3CLBA 1BDUA 2H2QA 4LRRA 1LCBA 2KCEA 2OIPA 2TSRA 2TSCA 1AN5A 1J3IC 4FGTA 1AXWA 1EVGA 1BQ1A 1F4CA 3DL6A 4GD7A 4ISWA 3V8HA 1NJDA 1BSPA 3B9HA 4H1IA 1B02A 3GG5A 4FOGA 1HW3A 1TSZA 3UM5A 3EBUA 1TSMA 3N5EA 4GEVA 1NJCA 1QQQA 1F4EA 1TDBA 2G8DA 4E28A 3C06A 2BBQA 1JMHA 3IRNA 3BGXA 1TVUA 3IK1A 3QJ7A 3ED7A 3EGYX 1NJBA 4FOAA 4DPDA 3UWLA 1BKPA 3BYXA 1JUJA 3BZ0A 1TRGA 3UM6A 5HS3A 1BO7A 1TSDA 2RD8A 4ISKA 4EB4A 2G89A 3N5GA 3KGBA 3OB7A 3N5EB 4DQ1A 1BQ2A 4H0RA 1LCEA 3BNZA 1QZFA 3K2HA 3H9KA 1TSYA 3DGAC 1KCEA 1VZCA 1AIQA 1TDUA 3QG2A 4O1XD 1TVVA 4O1XA 1EVFA 3DL5A 3GH2X 3IK0A 3JSUA 1SEJA 1J3KC 3C0AA 4XSEA 3BFIA 3IHIA 1KZJA 1BO8A 1TSNA 3QGTA 4DPHA 4PSGA 1TSVA 3UWLB 3TMSA 3IRMA 2RDAA 1VZDA 1B5EA 1RTSA 5H39A 4G6WX 4IQQA 2A9WA 1HZWA 2RD8B 3IROA 5H38A 1JTQA 1TVWA 4FOXA 1TLCA 2TDMA 2VETA 4GYHA 1DNAA 4G2OX 1TYSA 4JEFA 3EJLA
chains in the Genus database with same CATH topology
1B49A 4UP1A 1AOBA 3IX6A 4KYAA 1F4BA 1FFLA 1BIDA 3HBBA 2VF0A 1THYA 1EV5A 1BPJA 1EV8A 4EZ8A 4H0UA 2FTOX 5FCTA 4O1UA 3EAWX 1ZPRA 1DDUA 1JU6A 4EINA 1BSFA 1FWMA 3KJRA 2AAZA 3INVA 1J3JC 4FQSA 1I00A 3KJSA 1TDCA 3EHIX 4KY8A 1BP0A 1YPVA 1VZBA 4Q0EA 5J7WA 2TDDA 4XSCA 4EILA 4TMSA 3I3RA 1TLSA 1JG0A 1BJGA 2ONBA 1TSXA 1HW4A 5BY6A 4Q0DA 1TJSA 2G8AA 4DP3A 1BP6A 1BKOA 4XSDA 4IRRA 3EF9A 3BHRA 1NCEA 2G8XA 1F4DA 1TSLA 1CI7A 1HVYA 1KZIA 2FTNA 3IJZA 3B5BA 1NJEA 4IQBA 1TISA 3HB8A 1F4GA 1JTUA 3DG8C 3BHLA 1JMFA 4ECKA 2FTQA 1VZAA 3CL9A 5H3AA 3UM8A 1TSWA 1B5DA 4KPWA 1VZEA 2G86A 5WRNA 4KNZA 1AJMA 4KY4A 1TDAA 1JMGA 1LCAA 4O7UA 3NRRA 1JMIA 1F28A 1NJAA 3GH0A 3HJ3A 1JUTA 4F2VA 1SYNA 4E5OA 3EDWX 1F4FA 3CLBA 1BDUA 2H2QA 4LRRA 1LCBA 2KCEA 2OIPA 2TSRA 2TSCA 1AN5A 1J3IC 4FGTA 1AXWA 1EVGA 1BQ1A 1F4CA 3DL6A 4GD7A 4ISWA 3V8HA 1NJDA 1BSPA 3B9HA 4H1IA 1B02A 3GG5A 4FOGA 1HW3A 1TSZA 3UM5A 3EBUA 1TSMA 3N5EA 4GEVA 1NJCA 1QQQA 1F4EA 1TDBA 2G8DA 4E28A 3C06A 2BBQA 1JMHA 3IRNA 3BGXA 1TVUA 3IK1A 3QJ7A 3ED7A 3EGYX 1NJBA 4FOAA 4DPDA 3UWLA 1BKPA 3BYXA 1JUJA 3BZ0A 1TRGA 3UM6A 5HS3A 1BO7A 1TSDA 2RD8A 4ISKA 4EB4A 2G89A 3N5GA 3KGBA 3OB7A 3N5EB 4DQ1A 1BQ2A 4H0RA 1LCEA 3BNZA 1QZFA 3K2HA 3H9KA 1TSYA 3DGAC 1KCEA 1VZCA 1AIQA 1TDUA 3QG2A 4O1XD 1TVVA 4O1XA 1EVFA 3DL5A 3GH2X 3IK0A 3JSUA 1SEJA 1J3KC 3C0AA 4XSEA 3BFIA 3IHIA 1KZJA 1BO8A 1TSNA 3QGTA 4DPHA 4PSGA 1TSVA 3UWLB 3TMSA 3IRMA 2RDAA 1VZDA 1B5EA 1RTSA 5H39A 4G6WX 4IQQA 2A9WA 1HZWA 2RD8B 3IROA 5H38A 1JTQA 1TVWA 4FOXA 1TLCA 2TDMA 2VETA 4GYHA 1DNAA 4G2OX 1TYSA 4JEFA 3EJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B49 A;  4UP1 A;  1AOB A;  3IX6 A;  4KYA A;  1F4B A;  1FFL A;  1BID A;  3HBB A;  2VF0 A;  1THY A;  1EV5 A;  1BPJ A;  1EV8 A;  4EZ8 A;  4H0U A;  2FTO X;  5FCT A;  4O1U A;  3EAW X;  1ZPR A;  1DDU A;  1JU6 A;  4EIN A;  1BSF A;  1FWM A;  3KJR A;  2AAZ A;  3INV A;  1J3J C;  4FQS A;  1I00 A;  3KJS A;  1TDC A;  3EHI X;  4KY8 A;  1BP0 A;  1YPV A;  1VZB A;  4Q0E A;  5J7W A;  2TDD A;  4XSC A;  4EIL A;  4TMS A;  3I3R A;  1TLS A;  1JG0 A;  1BJG A;  2ONB A;  1TSX A;  1HW4 A;  5BY6 A;  4Q0D A;  1TJS A;  2G8A A;  4DP3 A;  1BP6 A;  1BKO A;  4XSD A;  4IRR A;  3EF9 A;  3BHR A;  1NCE A;  2G8X A;  1F4D A;  1TSL A;  1CI7 A;  1HVY A;  1KZI A;  2FTN A;  3IJZ A;  3B5B A;  1NJE A;  4IQB A;  1TIS A;  3HB8 A;  1F4G A;  1JTU A;  3DG8 C;  3BHL A;  1JMF A;  4ECK A;  2FTQ A;  1VZA A;  3CL9 A;  5H3A A;  3UM8 A;  1TSW A;  1B5D A;  4KPW A;  1VZE A;  2G86 A;  5WRN A;  4KNZ A;  1AJM A;  4KY4 A;  1TDA A;  1JMG A;  1LCA A;  4O7U A;  3NRR A;  1JMI A;  1F28 A;  1NJA A;  3GH0 A;  3HJ3 A;  1JUT A;  4F2V A;  1SYN A;  4E5O A;  3EDW X;  1F4F A;  3CLB A;  1BDU A;  2H2Q A;  4LRR A;  1LCB A;  2KCE A;  2OIP A;  2TSR A;  2TSC A;  1AN5 A;  1J3I C;  4FGT A;  1AXW A;  1EVG A;  1BQ1 A;  1F4C A;  3DL6 A;  4GD7 A;  4ISW A;  3V8H A;  1NJD A;  1BSP A;  3B9H A;  4H1I A;  1B02 A;  3GG5 A;  4FOG A;  1HW3 A;  1TSZ A;  3UM5 A;  3EBU A;  1TSM A;  3N5E A;  4GEV A;  1NJC A;  1QQQ A;  1F4E A;  1TDB A;  2G8D A;  4E28 A;  3C06 A;  2BBQ A;  1JMH A;  3IRN A;  3BGX A;  1TVU A;  3IK1 A;  3QJ7 A;  3ED7 A;  3EGY X;  1NJB A;  4FOA A;  4DPD A;  3UWL A;  1BKP A;  3BYX A;  1JUJ A;  3BZ0 A;  1TRG A;  3UM6 A;  5HS3 A;  1BO7 A;  1TSD A;  2RD8 A;  4ISK A;  4EB4 A;  2G89 A;  3N5G A;  3KGB A;  3OB7 A;  3N5E B;  4DQ1 A;  1BQ2 A;  4H0R A;  1LCE A;  3BNZ A;  1QZF A;  3K2H A;  3H9K A;  1TSY A;  3DGA C;  1KCE A;  1VZC A;  1AIQ A;  1TDU A;  3QG2 A;  4O1X D;  1TVV A;  4O1X A;  1EVF A;  3DL5 A;  3GH2 X;  3IK0 A;  3JSU A;  1SEJ A;  1J3K C;  3C0A A;  4XSE A;  3BFI A;  3IHI A;  1KZJ A;  1BO8 A;  1TSN A;  3QGT A;  4DPH A;  4PSG A;  1TSV A;  3UWL B;  3TMS A;  3IRM A;  2RDA A;  1VZD A;  1B5E A;  1RTS A;  5H39 A;  4G6W X;  4IQQ A;  2A9W A;  1HZW A;  2RD8 B;  3IRO A;  5H38 A;  1JTQ A;  1TVW A;  4FOX A;  1TLC A;  2TDM A;  2VET A;  4GYH A;  1DNA A;  4G2O X;  1TYS A;  4JEF A;  3EJL A; 
#chains in the Genus database with same CATH topology
 1B49 A;  4UP1 A;  1AOB A;  3IX6 A;  4KYA A;  1F4B A;  1FFL A;  1BID A;  3HBB A;  2VF0 A;  1THY A;  1EV5 A;  1BPJ A;  1EV8 A;  4EZ8 A;  4H0U A;  2FTO X;  5FCT A;  4O1U A;  3EAW X;  1ZPR A;  1DDU A;  1JU6 A;  4EIN A;  1BSF A;  1FWM A;  3KJR A;  2AAZ A;  3INV A;  1J3J C;  4FQS A;  1I00 A;  3KJS A;  1TDC A;  3EHI X;  4KY8 A;  1BP0 A;  1YPV A;  1VZB A;  4Q0E A;  5J7W A;  2TDD A;  4XSC A;  4EIL A;  4TMS A;  3I3R A;  1TLS A;  1JG0 A;  1BJG A;  2ONB A;  1TSX A;  1HW4 A;  5BY6 A;  4Q0D A;  1TJS A;  2G8A A;  4DP3 A;  1BP6 A;  1BKO A;  4XSD A;  4IRR A;  3EF9 A;  3BHR A;  1NCE A;  2G8X A;  1F4D A;  1TSL A;  1CI7 A;  1HVY A;  1KZI A;  2FTN A;  3IJZ A;  3B5B A;  1NJE A;  4IQB A;  1TIS A;  3HB8 A;  1F4G A;  1JTU A;  3DG8 C;  3BHL A;  1JMF A;  4ECK A;  2FTQ A;  1VZA A;  3CL9 A;  5H3A A;  3UM8 A;  1TSW A;  1B5D A;  4KPW A;  1VZE A;  2G86 A;  5WRN A;  4KNZ A;  1AJM A;  4KY4 A;  1TDA A;  1JMG A;  1LCA A;  4O7U A;  3NRR A;  1JMI A;  1F28 A;  1NJA A;  3GH0 A;  3HJ3 A;  1JUT A;  4F2V A;  1SYN A;  4E5O A;  3EDW X;  1F4F A;  3CLB A;  1BDU A;  2H2Q A;  4LRR A;  1LCB A;  2KCE A;  2OIP A;  2TSR A;  2TSC A;  1AN5 A;  1J3I C;  4FGT A;  1AXW A;  1EVG A;  1BQ1 A;  1F4C A;  3DL6 A;  4GD7 A;  4ISW A;  3V8H A;  1NJD A;  1BSP A;  3B9H A;  4H1I A;  1B02 A;  3GG5 A;  4FOG A;  1HW3 A;  1TSZ A;  3UM5 A;  3EBU A;  1TSM A;  3N5E A;  4GEV A;  1NJC A;  1QQQ A;  1F4E A;  1TDB A;  2G8D A;  4E28 A;  3C06 A;  2BBQ A;  1JMH A;  3IRN A;  3BGX A;  1TVU A;  3IK1 A;  3QJ7 A;  3ED7 A;  3EGY X;  1NJB A;  4FOA A;  4DPD A;  3UWL A;  1BKP A;  3BYX A;  1JUJ A;  3BZ0 A;  1TRG A;  3UM6 A;  5HS3 A;  1BO7 A;  1TSD A;  2RD8 A;  4ISK A;  4EB4 A;  2G89 A;  3N5G A;  3KGB A;  3OB7 A;  3N5E B;  4DQ1 A;  1BQ2 A;  4H0R A;  1LCE A;  3BNZ A;  1QZF A;  3K2H A;  3H9K A;  1TSY A;  3DGA C;  1KCE A;  1VZC A;  1AIQ A;  1TDU A;  3QG2 A;  4O1X D;  1TVV A;  4O1X A;  1EVF A;  3DL5 A;  3GH2 X;  3IK0 A;  3JSU A;  1SEJ A;  1J3K C;  3C0A A;  4XSE A;  3BFI A;  3IHI A;  1KZJ A;  1BO8 A;  1TSN A;  3QGT A;  4DPH A;  4PSG A;  1TSV A;  3UWL B;  3TMS A;  3IRM A;  2RDA A;  1VZD A;  1B5E A;  1RTS A;  5H39 A;  4G6W X;  4IQQ A;  2A9W A;  1HZW A;  2RD8 B;  3IRO A;  5H38 A;  1JTQ A;  1TVW A;  4FOX A;  1TLC A;  2TDM A;  2VET A;  4GYH A;  1DNA A;  4G2O X;  1TYS A;  4JEF A;  3EJL A; 
#chains in the Genus database with same CATH homology
 1B49 A;  4UP1 A;  1AOB A;  3IX6 A;  4KYA A;  1F4B A;  1FFL A;  1BID A;  3HBB A;  2VF0 A;  1THY A;  1EV5 A;  1BPJ A;  1EV8 A;  4EZ8 A;  4H0U A;  2FTO X;  5FCT A;  4O1U A;  3EAW X;  1ZPR A;  1DDU A;  1JU6 A;  4EIN A;  1BSF A;  1FWM A;  3KJR A;  2AAZ A;  3INV A;  1J3J C;  4FQS A;  1I00 A;  3KJS A;  1TDC A;  3EHI X;  4KY8 A;  1BP0 A;  1YPV A;  1VZB A;  4Q0E A;  5J7W A;  2TDD A;  4XSC A;  4EIL A;  4TMS A;  3I3R A;  1TLS A;  1JG0 A;  1BJG A;  2ONB A;  1TSX A;  1HW4 A;  5BY6 A;  4Q0D A;  1TJS A;  2G8A A;  4DP3 A;  1BP6 A;  1BKO A;  4XSD A;  4IRR A;  3EF9 A;  3BHR A;  1NCE A;  2G8X A;  1F4D A;  1TSL A;  1CI7 A;  1HVY A;  1KZI A;  2FTN A;  3IJZ A;  3B5B A;  1NJE A;  4IQB A;  1TIS A;  3HB8 A;  1F4G A;  1JTU A;  3DG8 C;  3BHL A;  1JMF A;  4ECK A;  2FTQ A;  1VZA A;  3CL9 A;  5H3A A;  3UM8 A;  1TSW A;  1B5D A;  4KPW A;  1VZE A;  2G86 A;  5WRN A;  4KNZ A;  1AJM A;  4KY4 A;  1TDA A;  1JMG A;  1LCA A;  4O7U A;  3NRR A;  1JMI A;  1F28 A;  1NJA A;  3GH0 A;  3HJ3 A;  1JUT A;  4F2V A;  1SYN A;  4E5O A;  3EDW X;  1F4F A;  3CLB A;  1BDU A;  2H2Q A;  4LRR A;  1LCB A;  2KCE A;  2OIP A;  2TSR A;  2TSC A;  1AN5 A;  1J3I C;  4FGT A;  1AXW A;  1EVG A;  1BQ1 A;  1F4C A;  3DL6 A;  4GD7 A;  4ISW A;  3V8H A;  1NJD A;  1BSP A;  3B9H A;  4H1I A;  1B02 A;  3GG5 A;  4FOG A;  1HW3 A;  1TSZ A;  3UM5 A;  3EBU A;  1TSM A;  3N5E A;  4GEV A;  1NJC A;  1QQQ A;  1F4E A;  1TDB A;  2G8D A;  4E28 A;  3C06 A;  2BBQ A;  1JMH A;  3IRN A;  3BGX A;  1TVU A;  3IK1 A;  3QJ7 A;  3ED7 A;  3EGY X;  1NJB A;  4FOA A;  4DPD A;  3UWL A;  1BKP A;  3BYX A;  1JUJ A;  3BZ0 A;  1TRG A;  3UM6 A;  5HS3 A;  1BO7 A;  1TSD A;  2RD8 A;  4ISK A;  4EB4 A;  2G89 A;  3N5G A;  3KGB A;  3OB7 A;  3N5E B;  4DQ1 A;  1BQ2 A;  4H0R A;  1LCE A;  3BNZ A;  1QZF A;  3K2H A;  3H9K A;  1TSY A;  3DGA C;  1KCE A;  1VZC A;  1AIQ A;  1TDU A;  3QG2 A;  4O1X D;  1TVV A;  4O1X A;  1EVF A;  3DL5 A;  3GH2 X;  3IK0 A;  3JSU A;  1SEJ A;  1J3K C;  3C0A A;  4XSE A;  3BFI A;  3IHI A;  1KZJ A;  1BO8 A;  1TSN A;  3QGT A;  4DPH A;  4PSG A;  1TSV A;  3UWL B;  3TMS A;  3IRM A;  2RDA A;  1VZD A;  1B5E A;  1RTS A;  5H39 A;  4G6W X;  4IQQ A;  2A9W A;  1HZW A;  2RD8 B;  3IRO A;  5H38 A;  1JTQ A;  1TVW A;  4FOX A;  1TLC A;  2TDM A;  2VET A;  4GYH A;  1DNA A;  4G2O X;  1TYS A;  4JEF A;  3EJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...