5H38A

Structural analysis of kshv thymidylate synthase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
283
structure length
283
Chain Sequence
PHEELQYLRQLREILCRGSDRLDRTGIGTLSLFGMQARYSLRDHFPLLTTKRVFWRGVVQELLWFLKGSTDSRELSRTGVKIWDKNGSREFLAGRGLAHRREGDLGPVYGFQWRHFGAAYVDADADYTGQGFDQLSYIVDLIKNNPHDRRIIMCAWNPADLSLMALPPCHLLCQFYVADGELSCQLYQRSGDMGLGVPFNIASYSLLTYMLAHVTGLRPGEFIHTLGDAHIYKTHIEPLRLQLTRTPRPFPRLEILRSVSSMEEFTPDDFRLVDYCPHPTIRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ORF70
publication title Structural Analysis of Thymidylate Synthase from Kaposi's Sarcoma-Associated Herpesvirus with the Anticancer Drug Raltitrexed.
pubmed doi rcsb
source organism Human herpesvirus 8
total genus 89
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2016-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 5h38A00
1HVYA 1TSMA 4H0RA 4FGTA 1TJSA 5H38A 3IJZA 1BQ1A 2VF0A 3UM5A 1TDAA 1VZEA 3BYXA 3EAWX 2TDDA 1JTUA 4ISKA 2G8DA 1F4FA 5WRNA 1FFLA 4DPHA 1AXWA 1FWMA 1JUJA 1TDUA 1BSFA 4EZ8A 1JG0A 4Q0DA 1ZPRA 3CLBA 3UM6A 1TYSA 1AIQA 4KY8A 5H39A 4O7UA 1HW4A 3UWLB 1BP0A 1TSZA 2G8XA 3C06A 3EGYX 1TSLA 4H1IA 3EJLA 3BHRA 1TSXA 4FOXA 1BKOA 3DL6A 3BNZA 1NJDA 1TSWA 1DNAA 2OIPA 1TSDA 2RD8B 1F4BA 3KJRA 1B5DA 3EDWX 3H9KA 1KZJA 4O1XD 5J7WA 1CI7A 1BDUA 1EV8A 1TVVA 1NJEA 4IQQA 1JUTA 4E28A 4KNZA 1VZCA 2G89A 1BKPA 1QQQA 3KGBA 3TMSA 3UM8A 1B02A 1F4DA 3IROA 3N5EA 3ED7A 5FCTA 3CL9A 4EINA 1NJCA 3IK0A 4FQSA 3DGAC 4DP3A 5HS3A 3EHIX 1HW3A 4DPDA 1B5EA 3V8HA 1JU6A 4XSEA 3OB7A 3IRNA 4XSDA 3BHLA 1YPVA 1LCEA 3QG2A 3I3RA 2KCEA 4TMSA 3BFIA 2TSCA 4ISWA 3C0AA 4G6WX 1LCBA 2A9WA 1F28A 3HBBA 1BQ2A 3EBUA 1F4GA 2ONBA 4FOGA 1VZAA 4JEFA 1TDBA 4KY4A 3UWLA 2TSRA 4FOAA 1JTQA 3B5BA 4UP1A 1AN5A 1NJAA 4GYHA 4KYAA 2AAZA 3NRRA 4O1XA 4XSCA 1BPJA 1NCEA 1J3JC 1QZFA 3GH2X 1JMHA 3QJ7A 4GD7A 4IQBA 1TVWA 4LRRA 3HB8A 3HJ3A 3IHIA 4KPWA 4O1UA 3JSUA 3N5EB 1BIDA 1EVGA 3N5GA 1AOBA 2G86A 1BO8A 1TDCA 4DQ1A 2FTOX 3GG5A 1TVUA 1NJBA 1RTSA 1TLCA 2FTQA 4F2VA 1THYA 1LCAA 4Q0EA 5H3AA 1VZDA 4PSGA 1JMIA 1SEJA 2G8AA 3IK1A 1J3IC 2BBQA 1BP6A 1TLSA 1TSVA 1BO7A 3K2HA 1TRGA 1EVFA 3INVA 3DL5A 3KJSA 1AJMA 1I00A 1KZIA 2FTNA 2RD8A 3BZ0A 3DG8C 3EF9A 1F4CA 1J3KC 2VETA 1JMGA 1BSPA 1DDUA 4GEVA 2TDMA 3GH0A 1EV5A 4H0UA 1BJGA 3IX6A 1TISA 4ECKA 4E5OA 4G2OX 4IRRA 2RDAA 1JMFA 1TSYA 1B49A 1SYNA 2H2QA 4EB4A 3QGTA 1VZBA 1F4EA 3BGXA 1TSNA 5BY6A 3IRMA 1KCEA 1HZWA 3B9HA 4EILA
chains in the Genus database with same CATH superfamily
1HVYA 1TSMA 4H0RA 4FGTA 1TJSA 5H38A 3IJZA 1BQ1A 2VF0A 3UM5A 1TDAA 1VZEA 3BYXA 3EAWX 2TDDA 1JTUA 4ISKA 2G8DA 1F4FA 5WRNA 1FFLA 4DPHA 1AXWA 1FWMA 1JUJA 1TDUA 1BSFA 4EZ8A 1JG0A 4Q0DA 1ZPRA 3CLBA 3UM6A 1TYSA 1AIQA 4KY8A 5H39A 4O7UA 1HW4A 3UWLB 1BP0A 1TSZA 2G8XA 3C06A 3EGYX 1TSLA 4H1IA 3EJLA 3BHRA 1TSXA 4FOXA 1BKOA 3DL6A 3BNZA 1NJDA 1TSWA 1DNAA 2OIPA 1TSDA 2RD8B 1F4BA 3KJRA 1B5DA 3EDWX 3H9KA 1KZJA 4O1XD 5J7WA 1CI7A 1BDUA 1EV8A 1TVVA 1NJEA 4IQQA 1JUTA 4E28A 4KNZA 1VZCA 2G89A 1BKPA 1QQQA 3KGBA 3TMSA 3UM8A 1B02A 1F4DA 3IROA 3N5EA 3ED7A 5FCTA 3CL9A 4EINA 1NJCA 3IK0A 4FQSA 3DGAC 4DP3A 5HS3A 3EHIX 1HW3A 4DPDA 1B5EA 3V8HA 1JU6A 4XSEA 3OB7A 3IRNA 4XSDA 3BHLA 1YPVA 1LCEA 3QG2A 3I3RA 2KCEA 4TMSA 3BFIA 2TSCA 4ISWA 3C0AA 4G6WX 1LCBA 2A9WA 1F28A 3HBBA 1BQ2A 3EBUA 1F4GA 2ONBA 4FOGA 1VZAA 4JEFA 1TDBA 4KY4A 3UWLA 2TSRA 4FOAA 1JTQA 3B5BA 4UP1A 1AN5A 1NJAA 4GYHA 4KYAA 2AAZA 3NRRA 4O1XA 4XSCA 1BPJA 1NCEA 1J3JC 1QZFA 3GH2X 1JMHA 3QJ7A 4GD7A 4IQBA 1TVWA 4LRRA 3HB8A 3HJ3A 3IHIA 4KPWA 4O1UA 3JSUA 3N5EB 1BIDA 1EVGA 3N5GA 1AOBA 2G86A 1BO8A 1TDCA 4DQ1A 2FTOX 3GG5A 1TVUA 1NJBA 1RTSA 1TLCA 2FTQA 4F2VA 1THYA 1LCAA 4Q0EA 5H3AA 1VZDA 4PSGA 1JMIA 1SEJA 2G8AA 3IK1A 1J3IC 2BBQA 1BP6A 1TLSA 1TSVA 1BO7A 3K2HA 1TRGA 1EVFA 3INVA 3DL5A 3KJSA 1AJMA 1I00A 1KZIA 2FTNA 2RD8A 3BZ0A 3DG8C 3EF9A 1F4CA 1J3KC 2VETA 1JMGA 1BSPA 1DDUA 4GEVA 2TDMA 3GH0A 1EV5A 4H0UA 1BJGA 3IX6A 1TISA 4ECKA 4E5OA 4G2OX 4IRRA 2RDAA 1JMFA 1TSYA 1B49A 1SYNA 2H2QA 4EB4A 3QGTA 1VZBA 1F4EA 3BGXA 1TSNA 5BY6A 3IRMA 1KCEA 1HZWA 3B9HA 4EILA
chains in the Genus database with same CATH topology
1HVYA 1TSMA 4H0RA 4FGTA 1TJSA 5H38A 3IJZA 1BQ1A 2VF0A 3UM5A 1TDAA 1VZEA 3BYXA 3EAWX 2TDDA 1JTUA 4ISKA 2G8DA 1F4FA 5WRNA 1FFLA 4DPHA 1AXWA 1FWMA 1JUJA 1TDUA 1BSFA 4EZ8A 1JG0A 4Q0DA 1ZPRA 3CLBA 3UM6A 1TYSA 1AIQA 4KY8A 5H39A 4O7UA 1HW4A 3UWLB 1BP0A 1TSZA 2G8XA 3C06A 3EGYX 1TSLA 4H1IA 3EJLA 3BHRA 1TSXA 4FOXA 1BKOA 3DL6A 3BNZA 1NJDA 1TSWA 1DNAA 2OIPA 1TSDA 2RD8B 1F4BA 3KJRA 1B5DA 3EDWX 3H9KA 1KZJA 4O1XD 5J7WA 1CI7A 1BDUA 1EV8A 1TVVA 1NJEA 4IQQA 1JUTA 4E28A 4KNZA 1VZCA 2G89A 1BKPA 1QQQA 3KGBA 3TMSA 3UM8A 1B02A 1F4DA 3IROA 3N5EA 3ED7A 5FCTA 3CL9A 4EINA 1NJCA 3IK0A 4FQSA 3DGAC 4DP3A 5HS3A 3EHIX 1HW3A 4DPDA 1B5EA 3V8HA 1JU6A 4XSEA 3OB7A 3IRNA 4XSDA 3BHLA 1YPVA 1LCEA 3QG2A 3I3RA 2KCEA 4TMSA 3BFIA 2TSCA 4ISWA 3C0AA 4G6WX 1LCBA 2A9WA 1F28A 3HBBA 1BQ2A 3EBUA 1F4GA 2ONBA 4FOGA 1VZAA 4JEFA 1TDBA 4KY4A 3UWLA 2TSRA 4FOAA 1JTQA 3B5BA 4UP1A 1AN5A 1NJAA 4GYHA 4KYAA 2AAZA 3NRRA 4O1XA 4XSCA 1BPJA 1NCEA 1J3JC 1QZFA 3GH2X 1JMHA 3QJ7A 4GD7A 4IQBA 1TVWA 4LRRA 3HB8A 3HJ3A 3IHIA 4KPWA 4O1UA 3JSUA 3N5EB 1BIDA 1EVGA 3N5GA 1AOBA 2G86A 1BO8A 1TDCA 4DQ1A 2FTOX 3GG5A 1TVUA 1NJBA 1RTSA 1TLCA 2FTQA 4F2VA 1THYA 1LCAA 4Q0EA 5H3AA 1VZDA 4PSGA 1JMIA 1SEJA 2G8AA 3IK1A 1J3IC 2BBQA 1BP6A 1TLSA 1TSVA 1BO7A 3K2HA 1TRGA 1EVFA 3INVA 3DL5A 3KJSA 1AJMA 1I00A 1KZIA 2FTNA 2RD8A 3BZ0A 3DG8C 3EF9A 1F4CA 1J3KC 2VETA 1JMGA 1BSPA 1DDUA 4GEVA 2TDMA 3GH0A 1EV5A 4H0UA 1BJGA 3IX6A 1TISA 4ECKA 4E5OA 4G2OX 4IRRA 2RDAA 1JMFA 1TSYA 1B49A 1SYNA 2H2QA 4EB4A 3QGTA 1VZBA 1F4EA 3BGXA 1TSNA 5BY6A 3IRMA 1KCEA 1HZWA 3B9HA 4EILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HVY A;  1TSM A;  4H0R A;  4FGT A;  1TJS A;  5H38 A;  3IJZ A;  1BQ1 A;  2VF0 A;  3UM5 A;  1TDA A;  1VZE A;  3BYX A;  3EAW X;  2TDD A;  1JTU A;  4ISK A;  2G8D A;  1F4F A;  5WRN A;  1FFL A;  4DPH A;  1AXW A;  1FWM A;  1JUJ A;  1TDU A;  1BSF A;  4EZ8 A;  1JG0 A;  4Q0D A;  1ZPR A;  3CLB A;  3UM6 A;  1TYS A;  1AIQ A;  4KY8 A;  5H39 A;  4O7U A;  1HW4 A;  3UWL B;  1BP0 A;  1TSZ A;  2G8X A;  3C06 A;  3EGY X;  1TSL A;  4H1I A;  3EJL A;  3BHR A;  1TSX A;  4FOX A;  1BKO A;  3DL6 A;  3BNZ A;  1NJD A;  1TSW A;  1DNA A;  2OIP A;  1TSD A;  2RD8 B;  1F4B A;  3KJR A;  1B5D A;  3EDW X;  3H9K A;  1KZJ A;  4O1X D;  5J7W A;  1CI7 A;  1BDU A;  1EV8 A;  1TVV A;  1NJE A;  4IQQ A;  1JUT A;  4E28 A;  4KNZ A;  1VZC A;  2G89 A;  1BKP A;  1QQQ A;  3KGB A;  3TMS A;  3UM8 A;  1B02 A;  1F4D A;  3IRO A;  3N5E A;  3ED7 A;  5FCT A;  3CL9 A;  4EIN A;  1NJC A;  3IK0 A;  4FQS A;  3DGA C;  4DP3 A;  5HS3 A;  3EHI X;  1HW3 A;  4DPD A;  1B5E A;  3V8H A;  1JU6 A;  4XSE A;  3OB7 A;  3IRN A;  4XSD A;  3BHL A;  1YPV A;  1LCE A;  3QG2 A;  3I3R A;  2KCE A;  4TMS A;  3BFI A;  2TSC A;  4ISW A;  3C0A A;  4G6W X;  1LCB A;  2A9W A;  1F28 A;  3HBB A;  1BQ2 A;  3EBU A;  1F4G A;  2ONB A;  4FOG A;  1VZA A;  4JEF A;  1TDB A;  4KY4 A;  3UWL A;  2TSR A;  4FOA A;  1JTQ A;  3B5B A;  4UP1 A;  1AN5 A;  1NJA A;  4GYH A;  4KYA A;  2AAZ A;  3NRR A;  4O1X A;  4XSC A;  1BPJ A;  1NCE A;  1J3J C;  1QZF A;  3GH2 X;  1JMH A;  3QJ7 A;  4GD7 A;  4IQB A;  1TVW A;  4LRR A;  3HB8 A;  3HJ3 A;  3IHI A;  4KPW A;  4O1U A;  3JSU A;  3N5E B;  1BID A;  1EVG A;  3N5G A;  1AOB A;  2G86 A;  1BO8 A;  1TDC A;  4DQ1 A;  2FTO X;  3GG5 A;  1TVU A;  1NJB A;  1RTS A;  1TLC A;  2FTQ A;  4F2V A;  1THY A;  1LCA A;  4Q0E A;  5H3A A;  1VZD A;  4PSG A;  1JMI A;  1SEJ A;  2G8A A;  3IK1 A;  1J3I C;  2BBQ A;  1BP6 A;  1TLS A;  1TSV A;  1BO7 A;  3K2H A;  1TRG A;  1EVF A;  3INV A;  3DL5 A;  3KJS A;  1AJM A;  1I00 A;  1KZI A;  2FTN A;  2RD8 A;  3BZ0 A;  3DG8 C;  3EF9 A;  1F4C A;  1J3K C;  2VET A;  1JMG A;  1BSP A;  1DDU A;  4GEV A;  2TDM A;  3GH0 A;  1EV5 A;  4H0U A;  1BJG A;  3IX6 A;  1TIS A;  4ECK A;  4E5O A;  4G2O X;  4IRR A;  2RDA A;  1JMF A;  1TSY A;  1B49 A;  1SYN A;  2H2Q A;  4EB4 A;  3QGT A;  1VZB A;  1F4E A;  3BGX A;  1TSN A;  5BY6 A;  3IRM A;  1KCE A;  1HZW A;  3B9H A;  4EIL A; 
#chains in the Genus database with same CATH topology
 1HVY A;  1TSM A;  4H0R A;  4FGT A;  1TJS A;  5H38 A;  3IJZ A;  1BQ1 A;  2VF0 A;  3UM5 A;  1TDA A;  1VZE A;  3BYX A;  3EAW X;  2TDD A;  1JTU A;  4ISK A;  2G8D A;  1F4F A;  5WRN A;  1FFL A;  4DPH A;  1AXW A;  1FWM A;  1JUJ A;  1TDU A;  1BSF A;  4EZ8 A;  1JG0 A;  4Q0D A;  1ZPR A;  3CLB A;  3UM6 A;  1TYS A;  1AIQ A;  4KY8 A;  5H39 A;  4O7U A;  1HW4 A;  3UWL B;  1BP0 A;  1TSZ A;  2G8X A;  3C06 A;  3EGY X;  1TSL A;  4H1I A;  3EJL A;  3BHR A;  1TSX A;  4FOX A;  1BKO A;  3DL6 A;  3BNZ A;  1NJD A;  1TSW A;  1DNA A;  2OIP A;  1TSD A;  2RD8 B;  1F4B A;  3KJR A;  1B5D A;  3EDW X;  3H9K A;  1KZJ A;  4O1X D;  5J7W A;  1CI7 A;  1BDU A;  1EV8 A;  1TVV A;  1NJE A;  4IQQ A;  1JUT A;  4E28 A;  4KNZ A;  1VZC A;  2G89 A;  1BKP A;  1QQQ A;  3KGB A;  3TMS A;  3UM8 A;  1B02 A;  1F4D A;  3IRO A;  3N5E A;  3ED7 A;  5FCT A;  3CL9 A;  4EIN A;  1NJC A;  3IK0 A;  4FQS A;  3DGA C;  4DP3 A;  5HS3 A;  3EHI X;  1HW3 A;  4DPD A;  1B5E A;  3V8H A;  1JU6 A;  4XSE A;  3OB7 A;  3IRN A;  4XSD A;  3BHL A;  1YPV A;  1LCE A;  3QG2 A;  3I3R A;  2KCE A;  4TMS A;  3BFI A;  2TSC A;  4ISW A;  3C0A A;  4G6W X;  1LCB A;  2A9W A;  1F28 A;  3HBB A;  1BQ2 A;  3EBU A;  1F4G A;  2ONB A;  4FOG A;  1VZA A;  4JEF A;  1TDB A;  4KY4 A;  3UWL A;  2TSR A;  4FOA A;  1JTQ A;  3B5B A;  4UP1 A;  1AN5 A;  1NJA A;  4GYH A;  4KYA A;  2AAZ A;  3NRR A;  4O1X A;  4XSC A;  1BPJ A;  1NCE A;  1J3J C;  1QZF A;  3GH2 X;  1JMH A;  3QJ7 A;  4GD7 A;  4IQB A;  1TVW A;  4LRR A;  3HB8 A;  3HJ3 A;  3IHI A;  4KPW A;  4O1U A;  3JSU A;  3N5E B;  1BID A;  1EVG A;  3N5G A;  1AOB A;  2G86 A;  1BO8 A;  1TDC A;  4DQ1 A;  2FTO X;  3GG5 A;  1TVU A;  1NJB A;  1RTS A;  1TLC A;  2FTQ A;  4F2V A;  1THY A;  1LCA A;  4Q0E A;  5H3A A;  1VZD A;  4PSG A;  1JMI A;  1SEJ A;  2G8A A;  3IK1 A;  1J3I C;  2BBQ A;  1BP6 A;  1TLS A;  1TSV A;  1BO7 A;  3K2H A;  1TRG A;  1EVF A;  3INV A;  3DL5 A;  3KJS A;  1AJM A;  1I00 A;  1KZI A;  2FTN A;  2RD8 A;  3BZ0 A;  3DG8 C;  3EF9 A;  1F4C A;  1J3K C;  2VET A;  1JMG A;  1BSP A;  1DDU A;  4GEV A;  2TDM A;  3GH0 A;  1EV5 A;  4H0U A;  1BJG A;  3IX6 A;  1TIS A;  4ECK A;  4E5O A;  4G2O X;  4IRR A;  2RDA A;  1JMF A;  1TSY A;  1B49 A;  1SYN A;  2H2Q A;  4EB4 A;  3QGT A;  1VZB A;  1F4E A;  3BGX A;  1TSN A;  5BY6 A;  3IRM A;  1KCE A;  1HZW A;  3B9H A;  4EIL A; 
#chains in the Genus database with same CATH homology
 1HVY A;  1TSM A;  4H0R A;  4FGT A;  1TJS A;  5H38 A;  3IJZ A;  1BQ1 A;  2VF0 A;  3UM5 A;  1TDA A;  1VZE A;  3BYX A;  3EAW X;  2TDD A;  1JTU A;  4ISK A;  2G8D A;  1F4F A;  5WRN A;  1FFL A;  4DPH A;  1AXW A;  1FWM A;  1JUJ A;  1TDU A;  1BSF A;  4EZ8 A;  1JG0 A;  4Q0D A;  1ZPR A;  3CLB A;  3UM6 A;  1TYS A;  1AIQ A;  4KY8 A;  5H39 A;  4O7U A;  1HW4 A;  3UWL B;  1BP0 A;  1TSZ A;  2G8X A;  3C06 A;  3EGY X;  1TSL A;  4H1I A;  3EJL A;  3BHR A;  1TSX A;  4FOX A;  1BKO A;  3DL6 A;  3BNZ A;  1NJD A;  1TSW A;  1DNA A;  2OIP A;  1TSD A;  2RD8 B;  1F4B A;  3KJR A;  1B5D A;  3EDW X;  3H9K A;  1KZJ A;  4O1X D;  5J7W A;  1CI7 A;  1BDU A;  1EV8 A;  1TVV A;  1NJE A;  4IQQ A;  1JUT A;  4E28 A;  4KNZ A;  1VZC A;  2G89 A;  1BKP A;  1QQQ A;  3KGB A;  3TMS A;  3UM8 A;  1B02 A;  1F4D A;  3IRO A;  3N5E A;  3ED7 A;  5FCT A;  3CL9 A;  4EIN A;  1NJC A;  3IK0 A;  4FQS A;  3DGA C;  4DP3 A;  5HS3 A;  3EHI X;  1HW3 A;  4DPD A;  1B5E A;  3V8H A;  1JU6 A;  4XSE A;  3OB7 A;  3IRN A;  4XSD A;  3BHL A;  1YPV A;  1LCE A;  3QG2 A;  3I3R A;  2KCE A;  4TMS A;  3BFI A;  2TSC A;  4ISW A;  3C0A A;  4G6W X;  1LCB A;  2A9W A;  1F28 A;  3HBB A;  1BQ2 A;  3EBU A;  1F4G A;  2ONB A;  4FOG A;  1VZA A;  4JEF A;  1TDB A;  4KY4 A;  3UWL A;  2TSR A;  4FOA A;  1JTQ A;  3B5B A;  4UP1 A;  1AN5 A;  1NJA A;  4GYH A;  4KYA A;  2AAZ A;  3NRR A;  4O1X A;  4XSC A;  1BPJ A;  1NCE A;  1J3J C;  1QZF A;  3GH2 X;  1JMH A;  3QJ7 A;  4GD7 A;  4IQB A;  1TVW A;  4LRR A;  3HB8 A;  3HJ3 A;  3IHI A;  4KPW A;  4O1U A;  3JSU A;  3N5E B;  1BID A;  1EVG A;  3N5G A;  1AOB A;  2G86 A;  1BO8 A;  1TDC A;  4DQ1 A;  2FTO X;  3GG5 A;  1TVU A;  1NJB A;  1RTS A;  1TLC A;  2FTQ A;  4F2V A;  1THY A;  1LCA A;  4Q0E A;  5H3A A;  1VZD A;  4PSG A;  1JMI A;  1SEJ A;  2G8A A;  3IK1 A;  1J3I C;  2BBQ A;  1BP6 A;  1TLS A;  1TSV A;  1BO7 A;  3K2H A;  1TRG A;  1EVF A;  3INV A;  3DL5 A;  3KJS A;  1AJM A;  1I00 A;  1KZI A;  2FTN A;  2RD8 A;  3BZ0 A;  3DG8 C;  3EF9 A;  1F4C A;  1J3K C;  2VET A;  1JMG A;  1BSP A;  1DDU A;  4GEV A;  2TDM A;  3GH0 A;  1EV5 A;  4H0U A;  1BJG A;  3IX6 A;  1TIS A;  4ECK A;  4E5O A;  4G2O X;  4IRR A;  2RDA A;  1JMF A;  1TSY A;  1B49 A;  1SYN A;  2H2Q A;  4EB4 A;  3QGT A;  1VZB A;  1F4E A;  3BGX A;  1TSN A;  5BY6 A;  3IRM A;  1KCE A;  1HZW A;  3B9H A;  4EIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...