5H3AA

Structural analysis of kshv thymidylate synthase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
281
structure length
281
Chain Sequence
PHEELQYLRQLREILCRGSDRLDRTGIGTLSLFGMQARYSLRDHFPLLTTKRVFWRGVVQELLWFLKGSTDSRELSRTGVKIWDKNGSREFLAGRGLAHRREGDLGPVYGFQWRHFGAAYVDADADYTGQGFDQLSYIVDLIKNNPHDRRIIMCAWNPADLSLMALPPCHLLCQFYVADGELSCQLYQRSGDMGLGVPFNIASYSLLTYMLAHVTGLRPGEFIHTLGDAHIYKTHIEPLRLQLTRTPRPFPRLEILRSVSSMEEFTPDDFRLVDYCPHPTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ORF70
publication title Structural Analysis of Thymidylate Synthase from Kaposi's Sarcoma-Associated Herpesvirus with the Anticancer Drug Raltitrexed.
pubmed doi rcsb
source organism Human herpesvirus 8
total genus 90
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2016-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 5h3aA00
1JG0A 1BO8A 1J3IC 1TYSA 4EILA 1JUJA 3QGTA 2A9WA 1YPVA 3BZ0A 3UWLA 1EV5A 1THYA 1TSDA 3DL5A 1B49A 2FTNA 3ED7A 4LRRA 3QJ7A 3GG5A 1AN5A 3BYXA 1HZWA 3N5EB 3DG8C 1F4GA 3B9HA 3EJLA 2TDDA 1VZDA 3OB7A 4O1XA 4FGTA 3INVA 5FCTA 5H3AA 4Q0EA 1VZCA 1VZBA 3NRRA 3UM6A 1BP6A 2G8DA 2G8XA 3IHIA 1I00A 1LCAA 1TSWA 4O7UA 1BSPA 2RDAA 3C0AA 4KYAA 3EHIX 2RD8B 3V8HA 2G86A 3I3RA 1KCEA 2KCEA 4Q0DA 2VF0A 4GEVA 2TDMA 1NJDA 1TSLA 1HW3A 1BJGA 3K2HA 1F4DA 1JMGA 1HW4A 3CL9A 4ISWA 3BGXA 3HJ3A 1KZIA 4DPHA 4TMSA 1DDUA 2TSCA 1LCEA 3IK0A 4FQSA 2TSRA 1TVWA 3KJSA 3JSUA 1TDBA 1AOBA 2FTOX 1TSNA 2H2QA 3BFIA 4H0RA 1NJCA 3IK1A 4FOXA 1BQ2A 1NCEA 4E5OA 3DL6A 1TLCA 1TSYA 1TSZA 3UM5A 1TVVA 5WRNA 1BPJA 3UM8A 3IX6A 1AIQA 1JMFA 1F4BA 1JTUA 1BQ1A 1TLSA 1JMHA 4O1XD 4IRRA 1BSFA 5J7WA 4XSCA 3EGYX 4DP3A 1SEJA 1HVYA 4IQQA 3TMSA 1TDUA 1VZAA 4DPDA 2OIPA 1AXWA 1JMIA 1JUTA 1BIDA 2AAZA 4EB4A 1TDAA 1BP0A 3KGBA 4G6WX 4GYHA 4JEFA 5HS3A 1LCBA 4EINA 1BKPA 3IROA 4KNZA 4G2OX 3HBBA 1B5DA 1KZJA 3KJRA 2RD8A 3UWLB 4KY8A 5H38A 1BO7A 1F28A 1AJMA 1SYNA 3EF9A 4XSEA 3EDWX 2BBQA 1J3KC 4F2VA 4KY4A 3BHRA 2ONBA 3HB8A 3GH0A 4ISKA 1JU6A 1TRGA 3B5BA 1NJEA 1FFLA 1EV8A 1QZFA 1NJAA 1TSXA 4IQBA 4XSDA 1TSMA 2FTQA 1BDUA 1EVGA 4UP1A 3N5EA 4FOGA 1TVUA 5BY6A 3IJZA 1EVFA 2VETA 1J3JC 2G8AA 4EZ8A 4H1IA 4GD7A 3CLBA 1TDCA 1RTSA 1TISA 4PSGA 3H9KA 3GH2X 3BNZA 4E28A 3N5GA 4ECKA 1B5EA 2G89A 3DGAC 3IRNA 4FOAA 1ZPRA 1F4CA 1F4EA 3IRMA 1VZEA 1CI7A 1NJBA 1QQQA 4DQ1A 1TSVA 3C06A 4H0UA 1BKOA 1F4FA 1FWMA 3EAWX 4O1UA 1B02A 4KPWA 3QG2A 1TJSA 1JTQA 3EBUA 1DNAA 3BHLA 5H39A
chains in the Genus database with same CATH superfamily
1JG0A 1BO8A 1J3IC 1TYSA 4EILA 1JUJA 3QGTA 2A9WA 1YPVA 3BZ0A 3UWLA 1EV5A 1THYA 1TSDA 3DL5A 1B49A 2FTNA 3ED7A 4LRRA 3QJ7A 3GG5A 1AN5A 3BYXA 1HZWA 3N5EB 3DG8C 1F4GA 3B9HA 3EJLA 2TDDA 1VZDA 3OB7A 4O1XA 4FGTA 3INVA 5FCTA 5H3AA 4Q0EA 1VZCA 1VZBA 3NRRA 3UM6A 1BP6A 2G8DA 2G8XA 3IHIA 1I00A 1LCAA 1TSWA 4O7UA 1BSPA 2RDAA 3C0AA 4KYAA 3EHIX 2RD8B 3V8HA 2G86A 3I3RA 1KCEA 2KCEA 4Q0DA 2VF0A 4GEVA 2TDMA 1NJDA 1TSLA 1HW3A 1BJGA 3K2HA 1F4DA 1JMGA 1HW4A 3CL9A 4ISWA 3BGXA 3HJ3A 1KZIA 4DPHA 4TMSA 1DDUA 2TSCA 1LCEA 3IK0A 4FQSA 2TSRA 1TVWA 3KJSA 3JSUA 1TDBA 1AOBA 2FTOX 1TSNA 2H2QA 3BFIA 4H0RA 1NJCA 3IK1A 4FOXA 1BQ2A 1NCEA 4E5OA 3DL6A 1TLCA 1TSYA 1TSZA 3UM5A 1TVVA 5WRNA 1BPJA 3UM8A 3IX6A 1AIQA 1JMFA 1F4BA 1JTUA 1BQ1A 1TLSA 1JMHA 4O1XD 4IRRA 1BSFA 5J7WA 4XSCA 3EGYX 4DP3A 1SEJA 1HVYA 4IQQA 3TMSA 1TDUA 1VZAA 4DPDA 2OIPA 1AXWA 1JMIA 1JUTA 1BIDA 2AAZA 4EB4A 1TDAA 1BP0A 3KGBA 4G6WX 4GYHA 4JEFA 5HS3A 1LCBA 4EINA 1BKPA 3IROA 4KNZA 4G2OX 3HBBA 1B5DA 1KZJA 3KJRA 2RD8A 3UWLB 4KY8A 5H38A 1BO7A 1F28A 1AJMA 1SYNA 3EF9A 4XSEA 3EDWX 2BBQA 1J3KC 4F2VA 4KY4A 3BHRA 2ONBA 3HB8A 3GH0A 4ISKA 1JU6A 1TRGA 3B5BA 1NJEA 1FFLA 1EV8A 1QZFA 1NJAA 1TSXA 4IQBA 4XSDA 1TSMA 2FTQA 1BDUA 1EVGA 4UP1A 3N5EA 4FOGA 1TVUA 5BY6A 3IJZA 1EVFA 2VETA 1J3JC 2G8AA 4EZ8A 4H1IA 4GD7A 3CLBA 1TDCA 1RTSA 1TISA 4PSGA 3H9KA 3GH2X 3BNZA 4E28A 3N5GA 4ECKA 1B5EA 2G89A 3DGAC 3IRNA 4FOAA 1ZPRA 1F4CA 1F4EA 3IRMA 1VZEA 1CI7A 1NJBA 1QQQA 4DQ1A 1TSVA 3C06A 4H0UA 1BKOA 1F4FA 1FWMA 3EAWX 4O1UA 1B02A 4KPWA 3QG2A 1TJSA 1JTQA 3EBUA 1DNAA 3BHLA 5H39A
chains in the Genus database with same CATH topology
1JG0A 1BO8A 1J3IC 1TYSA 4EILA 1JUJA 3QGTA 2A9WA 1YPVA 3BZ0A 3UWLA 1EV5A 1THYA 1TSDA 3DL5A 1B49A 2FTNA 3ED7A 4LRRA 3QJ7A 3GG5A 1AN5A 3BYXA 1HZWA 3N5EB 3DG8C 1F4GA 3B9HA 3EJLA 2TDDA 1VZDA 3OB7A 4O1XA 4FGTA 3INVA 5FCTA 5H3AA 4Q0EA 1VZCA 1VZBA 3NRRA 3UM6A 1BP6A 2G8DA 2G8XA 3IHIA 1I00A 1LCAA 1TSWA 4O7UA 1BSPA 2RDAA 3C0AA 4KYAA 3EHIX 2RD8B 3V8HA 2G86A 3I3RA 1KCEA 2KCEA 4Q0DA 2VF0A 4GEVA 2TDMA 1NJDA 1TSLA 1HW3A 1BJGA 3K2HA 1F4DA 1JMGA 1HW4A 3CL9A 4ISWA 3BGXA 3HJ3A 1KZIA 4DPHA 4TMSA 1DDUA 2TSCA 1LCEA 3IK0A 4FQSA 2TSRA 1TVWA 3KJSA 3JSUA 1TDBA 1AOBA 2FTOX 1TSNA 2H2QA 3BFIA 4H0RA 1NJCA 3IK1A 4FOXA 1BQ2A 1NCEA 4E5OA 3DL6A 1TLCA 1TSYA 1TSZA 3UM5A 1TVVA 5WRNA 1BPJA 3UM8A 3IX6A 1AIQA 1JMFA 1F4BA 1JTUA 1BQ1A 1TLSA 1JMHA 4O1XD 4IRRA 1BSFA 5J7WA 4XSCA 3EGYX 4DP3A 1SEJA 1HVYA 4IQQA 3TMSA 1TDUA 1VZAA 4DPDA 2OIPA 1AXWA 1JMIA 1JUTA 1BIDA 2AAZA 4EB4A 1TDAA 1BP0A 3KGBA 4G6WX 4GYHA 4JEFA 5HS3A 1LCBA 4EINA 1BKPA 3IROA 4KNZA 4G2OX 3HBBA 1B5DA 1KZJA 3KJRA 2RD8A 3UWLB 4KY8A 5H38A 1BO7A 1F28A 1AJMA 1SYNA 3EF9A 4XSEA 3EDWX 2BBQA 1J3KC 4F2VA 4KY4A 3BHRA 2ONBA 3HB8A 3GH0A 4ISKA 1JU6A 1TRGA 3B5BA 1NJEA 1FFLA 1EV8A 1QZFA 1NJAA 1TSXA 4IQBA 4XSDA 1TSMA 2FTQA 1BDUA 1EVGA 4UP1A 3N5EA 4FOGA 1TVUA 5BY6A 3IJZA 1EVFA 2VETA 1J3JC 2G8AA 4EZ8A 4H1IA 4GD7A 3CLBA 1TDCA 1RTSA 1TISA 4PSGA 3H9KA 3GH2X 3BNZA 4E28A 3N5GA 4ECKA 1B5EA 2G89A 3DGAC 3IRNA 4FOAA 1ZPRA 1F4CA 1F4EA 3IRMA 1VZEA 1CI7A 1NJBA 1QQQA 4DQ1A 1TSVA 3C06A 4H0UA 1BKOA 1F4FA 1FWMA 3EAWX 4O1UA 1B02A 4KPWA 3QG2A 1TJSA 1JTQA 3EBUA 1DNAA 3BHLA 5H39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JG0 A;  1BO8 A;  1J3I C;  1TYS A;  4EIL A;  1JUJ A;  3QGT A;  2A9W A;  1YPV A;  3BZ0 A;  3UWL A;  1EV5 A;  1THY A;  1TSD A;  3DL5 A;  1B49 A;  2FTN A;  3ED7 A;  4LRR A;  3QJ7 A;  3GG5 A;  1AN5 A;  3BYX A;  1HZW A;  3N5E B;  3DG8 C;  1F4G A;  3B9H A;  3EJL A;  2TDD A;  1VZD A;  3OB7 A;  4O1X A;  4FGT A;  3INV A;  5FCT A;  5H3A A;  4Q0E A;  1VZC A;  1VZB A;  3NRR A;  3UM6 A;  1BP6 A;  2G8D A;  2G8X A;  3IHI A;  1I00 A;  1LCA A;  1TSW A;  4O7U A;  1BSP A;  2RDA A;  3C0A A;  4KYA A;  3EHI X;  2RD8 B;  3V8H A;  2G86 A;  3I3R A;  1KCE A;  2KCE A;  4Q0D A;  2VF0 A;  4GEV A;  2TDM A;  1NJD A;  1TSL A;  1HW3 A;  1BJG A;  3K2H A;  1F4D A;  1JMG A;  1HW4 A;  3CL9 A;  4ISW A;  3BGX A;  3HJ3 A;  1KZI A;  4DPH A;  4TMS A;  1DDU A;  2TSC A;  1LCE A;  3IK0 A;  4FQS A;  2TSR A;  1TVW A;  3KJS A;  3JSU A;  1TDB A;  1AOB A;  2FTO X;  1TSN A;  2H2Q A;  3BFI A;  4H0R A;  1NJC A;  3IK1 A;  4FOX A;  1BQ2 A;  1NCE A;  4E5O A;  3DL6 A;  1TLC A;  1TSY A;  1TSZ A;  3UM5 A;  1TVV A;  5WRN A;  1BPJ A;  3UM8 A;  3IX6 A;  1AIQ A;  1JMF A;  1F4B A;  1JTU A;  1BQ1 A;  1TLS A;  1JMH A;  4O1X D;  4IRR A;  1BSF A;  5J7W A;  4XSC A;  3EGY X;  4DP3 A;  1SEJ A;  1HVY A;  4IQQ A;  3TMS A;  1TDU A;  1VZA A;  4DPD A;  2OIP A;  1AXW A;  1JMI A;  1JUT A;  1BID A;  2AAZ A;  4EB4 A;  1TDA A;  1BP0 A;  3KGB A;  4G6W X;  4GYH A;  4JEF A;  5HS3 A;  1LCB A;  4EIN A;  1BKP A;  3IRO A;  4KNZ A;  4G2O X;  3HBB A;  1B5D A;  1KZJ A;  3KJR A;  2RD8 A;  3UWL B;  4KY8 A;  5H38 A;  1BO7 A;  1F28 A;  1AJM A;  1SYN A;  3EF9 A;  4XSE A;  3EDW X;  2BBQ A;  1J3K C;  4F2V A;  4KY4 A;  3BHR A;  2ONB A;  3HB8 A;  3GH0 A;  4ISK A;  1JU6 A;  1TRG A;  3B5B A;  1NJE A;  1FFL A;  1EV8 A;  1QZF A;  1NJA A;  1TSX A;  4IQB A;  4XSD A;  1TSM A;  2FTQ A;  1BDU A;  1EVG A;  4UP1 A;  3N5E A;  4FOG A;  1TVU A;  5BY6 A;  3IJZ A;  1EVF A;  2VET A;  1J3J C;  2G8A A;  4EZ8 A;  4H1I A;  4GD7 A;  3CLB A;  1TDC A;  1RTS A;  1TIS A;  4PSG A;  3H9K A;  3GH2 X;  3BNZ A;  4E28 A;  3N5G A;  4ECK A;  1B5E A;  2G89 A;  3DGA C;  3IRN A;  4FOA A;  1ZPR A;  1F4C A;  1F4E A;  3IRM A;  1VZE A;  1CI7 A;  1NJB A;  1QQQ A;  4DQ1 A;  1TSV A;  3C06 A;  4H0U A;  1BKO A;  1F4F A;  1FWM A;  3EAW X;  4O1U A;  1B02 A;  4KPW A;  3QG2 A;  1TJS A;  1JTQ A;  3EBU A;  1DNA A;  3BHL A;  5H39 A; 
#chains in the Genus database with same CATH topology
 1JG0 A;  1BO8 A;  1J3I C;  1TYS A;  4EIL A;  1JUJ A;  3QGT A;  2A9W A;  1YPV A;  3BZ0 A;  3UWL A;  1EV5 A;  1THY A;  1TSD A;  3DL5 A;  1B49 A;  2FTN A;  3ED7 A;  4LRR A;  3QJ7 A;  3GG5 A;  1AN5 A;  3BYX A;  1HZW A;  3N5E B;  3DG8 C;  1F4G A;  3B9H A;  3EJL A;  2TDD A;  1VZD A;  3OB7 A;  4O1X A;  4FGT A;  3INV A;  5FCT A;  5H3A A;  4Q0E A;  1VZC A;  1VZB A;  3NRR A;  3UM6 A;  1BP6 A;  2G8D A;  2G8X A;  3IHI A;  1I00 A;  1LCA A;  1TSW A;  4O7U A;  1BSP A;  2RDA A;  3C0A A;  4KYA A;  3EHI X;  2RD8 B;  3V8H A;  2G86 A;  3I3R A;  1KCE A;  2KCE A;  4Q0D A;  2VF0 A;  4GEV A;  2TDM A;  1NJD A;  1TSL A;  1HW3 A;  1BJG A;  3K2H A;  1F4D A;  1JMG A;  1HW4 A;  3CL9 A;  4ISW A;  3BGX A;  3HJ3 A;  1KZI A;  4DPH A;  4TMS A;  1DDU A;  2TSC A;  1LCE A;  3IK0 A;  4FQS A;  2TSR A;  1TVW A;  3KJS A;  3JSU A;  1TDB A;  1AOB A;  2FTO X;  1TSN A;  2H2Q A;  3BFI A;  4H0R A;  1NJC A;  3IK1 A;  4FOX A;  1BQ2 A;  1NCE A;  4E5O A;  3DL6 A;  1TLC A;  1TSY A;  1TSZ A;  3UM5 A;  1TVV A;  5WRN A;  1BPJ A;  3UM8 A;  3IX6 A;  1AIQ A;  1JMF A;  1F4B A;  1JTU A;  1BQ1 A;  1TLS A;  1JMH A;  4O1X D;  4IRR A;  1BSF A;  5J7W A;  4XSC A;  3EGY X;  4DP3 A;  1SEJ A;  1HVY A;  4IQQ A;  3TMS A;  1TDU A;  1VZA A;  4DPD A;  2OIP A;  1AXW A;  1JMI A;  1JUT A;  1BID A;  2AAZ A;  4EB4 A;  1TDA A;  1BP0 A;  3KGB A;  4G6W X;  4GYH A;  4JEF A;  5HS3 A;  1LCB A;  4EIN A;  1BKP A;  3IRO A;  4KNZ A;  4G2O X;  3HBB A;  1B5D A;  1KZJ A;  3KJR A;  2RD8 A;  3UWL B;  4KY8 A;  5H38 A;  1BO7 A;  1F28 A;  1AJM A;  1SYN A;  3EF9 A;  4XSE A;  3EDW X;  2BBQ A;  1J3K C;  4F2V A;  4KY4 A;  3BHR A;  2ONB A;  3HB8 A;  3GH0 A;  4ISK A;  1JU6 A;  1TRG A;  3B5B A;  1NJE A;  1FFL A;  1EV8 A;  1QZF A;  1NJA A;  1TSX A;  4IQB A;  4XSD A;  1TSM A;  2FTQ A;  1BDU A;  1EVG A;  4UP1 A;  3N5E A;  4FOG A;  1TVU A;  5BY6 A;  3IJZ A;  1EVF A;  2VET A;  1J3J C;  2G8A A;  4EZ8 A;  4H1I A;  4GD7 A;  3CLB A;  1TDC A;  1RTS A;  1TIS A;  4PSG A;  3H9K A;  3GH2 X;  3BNZ A;  4E28 A;  3N5G A;  4ECK A;  1B5E A;  2G89 A;  3DGA C;  3IRN A;  4FOA A;  1ZPR A;  1F4C A;  1F4E A;  3IRM A;  1VZE A;  1CI7 A;  1NJB A;  1QQQ A;  4DQ1 A;  1TSV A;  3C06 A;  4H0U A;  1BKO A;  1F4F A;  1FWM A;  3EAW X;  4O1U A;  1B02 A;  4KPW A;  3QG2 A;  1TJS A;  1JTQ A;  3EBU A;  1DNA A;  3BHL A;  5H39 A; 
#chains in the Genus database with same CATH homology
 1JG0 A;  1BO8 A;  1J3I C;  1TYS A;  4EIL A;  1JUJ A;  3QGT A;  2A9W A;  1YPV A;  3BZ0 A;  3UWL A;  1EV5 A;  1THY A;  1TSD A;  3DL5 A;  1B49 A;  2FTN A;  3ED7 A;  4LRR A;  3QJ7 A;  3GG5 A;  1AN5 A;  3BYX A;  1HZW A;  3N5E B;  3DG8 C;  1F4G A;  3B9H A;  3EJL A;  2TDD A;  1VZD A;  3OB7 A;  4O1X A;  4FGT A;  3INV A;  5FCT A;  5H3A A;  4Q0E A;  1VZC A;  1VZB A;  3NRR A;  3UM6 A;  1BP6 A;  2G8D A;  2G8X A;  3IHI A;  1I00 A;  1LCA A;  1TSW A;  4O7U A;  1BSP A;  2RDA A;  3C0A A;  4KYA A;  3EHI X;  2RD8 B;  3V8H A;  2G86 A;  3I3R A;  1KCE A;  2KCE A;  4Q0D A;  2VF0 A;  4GEV A;  2TDM A;  1NJD A;  1TSL A;  1HW3 A;  1BJG A;  3K2H A;  1F4D A;  1JMG A;  1HW4 A;  3CL9 A;  4ISW A;  3BGX A;  3HJ3 A;  1KZI A;  4DPH A;  4TMS A;  1DDU A;  2TSC A;  1LCE A;  3IK0 A;  4FQS A;  2TSR A;  1TVW A;  3KJS A;  3JSU A;  1TDB A;  1AOB A;  2FTO X;  1TSN A;  2H2Q A;  3BFI A;  4H0R A;  1NJC A;  3IK1 A;  4FOX A;  1BQ2 A;  1NCE A;  4E5O A;  3DL6 A;  1TLC A;  1TSY A;  1TSZ A;  3UM5 A;  1TVV A;  5WRN A;  1BPJ A;  3UM8 A;  3IX6 A;  1AIQ A;  1JMF A;  1F4B A;  1JTU A;  1BQ1 A;  1TLS A;  1JMH A;  4O1X D;  4IRR A;  1BSF A;  5J7W A;  4XSC A;  3EGY X;  4DP3 A;  1SEJ A;  1HVY A;  4IQQ A;  3TMS A;  1TDU A;  1VZA A;  4DPD A;  2OIP A;  1AXW A;  1JMI A;  1JUT A;  1BID A;  2AAZ A;  4EB4 A;  1TDA A;  1BP0 A;  3KGB A;  4G6W X;  4GYH A;  4JEF A;  5HS3 A;  1LCB A;  4EIN A;  1BKP A;  3IRO A;  4KNZ A;  4G2O X;  3HBB A;  1B5D A;  1KZJ A;  3KJR A;  2RD8 A;  3UWL B;  4KY8 A;  5H38 A;  1BO7 A;  1F28 A;  1AJM A;  1SYN A;  3EF9 A;  4XSE A;  3EDW X;  2BBQ A;  1J3K C;  4F2V A;  4KY4 A;  3BHR A;  2ONB A;  3HB8 A;  3GH0 A;  4ISK A;  1JU6 A;  1TRG A;  3B5B A;  1NJE A;  1FFL A;  1EV8 A;  1QZF A;  1NJA A;  1TSX A;  4IQB A;  4XSD A;  1TSM A;  2FTQ A;  1BDU A;  1EVG A;  4UP1 A;  3N5E A;  4FOG A;  1TVU A;  5BY6 A;  3IJZ A;  1EVF A;  2VET A;  1J3J C;  2G8A A;  4EZ8 A;  4H1I A;  4GD7 A;  3CLB A;  1TDC A;  1RTS A;  1TIS A;  4PSG A;  3H9K A;  3GH2 X;  3BNZ A;  4E28 A;  3N5G A;  4ECK A;  1B5E A;  2G89 A;  3DGA C;  3IRN A;  4FOA A;  1ZPR A;  1F4C A;  1F4E A;  3IRM A;  1VZE A;  1CI7 A;  1NJB A;  1QQQ A;  4DQ1 A;  1TSV A;  3C06 A;  4H0U A;  1BKO A;  1F4F A;  1FWM A;  3EAW X;  4O1U A;  1B02 A;  4KPW A;  3QG2 A;  1TJS A;  1JTQ A;  3EBU A;  1DNA A;  3BHL A;  5H39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...