5HS3A

Human thymidylate synthase complexed with dump and 3-amino-2-benzoyl-4-methylthieno[2,3-b]pyridin-6-ol
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
289
structure length
289
Chain Sequence
MPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate synthase
publication title CETSA screening identifies known and novel thymidylate synthase inhibitors and slow intracellular activation of 5-fluorouracil
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 289
sequence length 289
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 5hs3A00
1JMGA 2G89A 5J7WA 3BHLA 1BO7A 1BSPA 3BNZA 1F4EA 5H38A 3UM6A 1KZIA 3B9HA 3I3RA 2A9WA 1F4GA 4XSDA 2TSRA 5H39A 3HJ3A 3IROA 3EAWX 1BQ2A 1NJDA 4G6WX 3INVA 1TSMA 1BDUA 3B5BA 5HS3A 3GH0A 4F2VA 1AN5A 1DNAA 3QGTA 1TVUA 2G8AA 1JU6A 3IHIA 1TSDA 1NJBA 4O1UA 1YPVA 5FCTA 4XSEA 4Q0DA 1TSZA 1HVYA 4ISWA 1F28A 1EVFA 3C06A 4G2OX 1NJEA 1NCEA 1F4DA 1QQQA 4FOXA 1TLSA 3EHIX 5H3AA 3KGBA 1QZFA 1BP0A 3HBBA 1J3KC 1JUJA 1TRGA 4KPWA 3UWLA 1BP6A 1BIDA 1TJSA 1VZEA 2KCEA 1JTQA 3DGAC 3BHRA 3EGYX 4DPDA 4DP3A 1AXWA 3GH2X 4E5OA 3DL5A 4JEFA 1EVGA 1BKOA 1VZCA 3CL9A 1JUTA 1B5EA 1BQ1A 4Q0EA 1J3IC 2TDMA 1TSYA 2OIPA 1TSNA 2VF0A 1NJCA 3BZ0A 4KYAA 3V8HA 1F4CA 4GEVA 1HZWA 1EV5A 4O1XD 5WRNA 4DQ1A 1JMIA 4ISKA 4DPHA 4FOGA 4IRRA 4PSGA 1THYA 1FFLA 3IRNA 4UP1A 3UM5A 4FOAA 1VZAA 2RD8B 1AIQA 1JTUA 3ED7A 1LCBA 4LRRA 1BO8A 3HB8A 3EDWX 3IRMA 4ECKA 1BKPA 1NJAA 4H0RA 4IQBA 4EB4A 1TSXA 1TSWA 2AAZA 3DG8C 4O1XA 1HW4A 4GD7A 3TMSA 3N5EA 4EILA 1BSFA 3IK1A 1BJGA 3H9KA 1TISA 1TSLA 1VZBA 2H2QA 3EF9A 3NRRA 3QJ7A 4FQSA 4IQQA 3UWLB 1J3JC 2TSCA 4FGTA 4EZ8A 1TDAA 4KY4A 1TYSA 2G86A 3QG2A 4KY8A 1JMFA 3KJSA 1LCAA 3BYXA 2FTNA 2FTQA 3BFIA 3BGXA 3OB7A 1EV8A 1JMHA 1JG0A 1AOBA 1B49A 1TSVA 1TDCA 1LCEA 2ONBA 2TDDA 3EJLA 4TMSA 3EBUA 4KNZA 1DDUA 2VETA 4GYHA 4O7UA 1SEJA 2G8DA 3K2HA 3KJRA 1TVVA 1B02A 1KCEA 1KZJA 3CLBA 3C0AA 4E28A 5BY6A 1RTSA 1I00A 3JSUA 1F4BA 4H1IA 1ZPRA 1TVWA 3IJZA 1HW3A 3UM8A 3N5EB 3DL6A 3IK0A 2RD8A 2FTOX 2RDAA 1BPJA 3IX6A 1TDUA 1VZDA 2G8XA 4H0UA 4XSCA 2BBQA 1TLCA 3N5GA 4EINA 1B5DA 1CI7A 3GG5A 1TDBA 1F4FA 1AJMA 1FWMA 1SYNA
chains in the Genus database with same CATH superfamily
1JMGA 2G89A 5J7WA 3BHLA 1BO7A 1BSPA 3BNZA 1F4EA 5H38A 3UM6A 1KZIA 3B9HA 3I3RA 2A9WA 1F4GA 4XSDA 2TSRA 5H39A 3HJ3A 3IROA 3EAWX 1BQ2A 1NJDA 4G6WX 3INVA 1TSMA 1BDUA 3B5BA 5HS3A 3GH0A 4F2VA 1AN5A 1DNAA 3QGTA 1TVUA 2G8AA 1JU6A 3IHIA 1TSDA 1NJBA 4O1UA 1YPVA 5FCTA 4XSEA 4Q0DA 1TSZA 1HVYA 4ISWA 1F28A 1EVFA 3C06A 4G2OX 1NJEA 1NCEA 1F4DA 1QQQA 4FOXA 1TLSA 3EHIX 5H3AA 3KGBA 1QZFA 1BP0A 3HBBA 1J3KC 1JUJA 1TRGA 4KPWA 3UWLA 1BP6A 1BIDA 1TJSA 1VZEA 2KCEA 1JTQA 3DGAC 3BHRA 3EGYX 4DPDA 4DP3A 1AXWA 3GH2X 4E5OA 3DL5A 4JEFA 1EVGA 1BKOA 1VZCA 3CL9A 1JUTA 1B5EA 1BQ1A 4Q0EA 1J3IC 2TDMA 1TSYA 2OIPA 1TSNA 2VF0A 1NJCA 3BZ0A 4KYAA 3V8HA 1F4CA 4GEVA 1HZWA 1EV5A 4O1XD 5WRNA 4DQ1A 1JMIA 4ISKA 4DPHA 4FOGA 4IRRA 4PSGA 1THYA 1FFLA 3IRNA 4UP1A 3UM5A 4FOAA 1VZAA 2RD8B 1AIQA 1JTUA 3ED7A 1LCBA 4LRRA 1BO8A 3HB8A 3EDWX 3IRMA 4ECKA 1BKPA 1NJAA 4H0RA 4IQBA 4EB4A 1TSXA 1TSWA 2AAZA 3DG8C 4O1XA 1HW4A 4GD7A 3TMSA 3N5EA 4EILA 1BSFA 3IK1A 1BJGA 3H9KA 1TISA 1TSLA 1VZBA 2H2QA 3EF9A 3NRRA 3QJ7A 4FQSA 4IQQA 3UWLB 1J3JC 2TSCA 4FGTA 4EZ8A 1TDAA 4KY4A 1TYSA 2G86A 3QG2A 4KY8A 1JMFA 3KJSA 1LCAA 3BYXA 2FTNA 2FTQA 3BFIA 3BGXA 3OB7A 1EV8A 1JMHA 1JG0A 1AOBA 1B49A 1TSVA 1TDCA 1LCEA 2ONBA 2TDDA 3EJLA 4TMSA 3EBUA 4KNZA 1DDUA 2VETA 4GYHA 4O7UA 1SEJA 2G8DA 3K2HA 3KJRA 1TVVA 1B02A 1KCEA 1KZJA 3CLBA 3C0AA 4E28A 5BY6A 1RTSA 1I00A 3JSUA 1F4BA 4H1IA 1ZPRA 1TVWA 3IJZA 1HW3A 3UM8A 3N5EB 3DL6A 3IK0A 2RD8A 2FTOX 2RDAA 1BPJA 3IX6A 1TDUA 1VZDA 2G8XA 4H0UA 4XSCA 2BBQA 1TLCA 3N5GA 4EINA 1B5DA 1CI7A 3GG5A 1TDBA 1F4FA 1AJMA 1FWMA 1SYNA
chains in the Genus database with same CATH topology
1JMGA 2G89A 5J7WA 3BHLA 1BO7A 1BSPA 3BNZA 1F4EA 5H38A 3UM6A 1KZIA 3B9HA 3I3RA 2A9WA 1F4GA 4XSDA 2TSRA 5H39A 3HJ3A 3IROA 3EAWX 1BQ2A 1NJDA 4G6WX 3INVA 1TSMA 1BDUA 3B5BA 5HS3A 3GH0A 4F2VA 1AN5A 1DNAA 3QGTA 1TVUA 2G8AA 1JU6A 3IHIA 1TSDA 1NJBA 4O1UA 1YPVA 5FCTA 4XSEA 4Q0DA 1TSZA 1HVYA 4ISWA 1F28A 1EVFA 3C06A 4G2OX 1NJEA 1NCEA 1F4DA 1QQQA 4FOXA 1TLSA 3EHIX 5H3AA 3KGBA 1QZFA 1BP0A 3HBBA 1J3KC 1JUJA 1TRGA 4KPWA 3UWLA 1BP6A 1BIDA 1TJSA 1VZEA 2KCEA 1JTQA 3DGAC 3BHRA 3EGYX 4DPDA 4DP3A 1AXWA 3GH2X 4E5OA 3DL5A 4JEFA 1EVGA 1BKOA 1VZCA 3CL9A 1JUTA 1B5EA 1BQ1A 4Q0EA 1J3IC 2TDMA 1TSYA 2OIPA 1TSNA 2VF0A 1NJCA 3BZ0A 4KYAA 3V8HA 1F4CA 4GEVA 1HZWA 1EV5A 4O1XD 5WRNA 4DQ1A 1JMIA 4ISKA 4DPHA 4FOGA 4IRRA 4PSGA 1THYA 1FFLA 3IRNA 4UP1A 3UM5A 4FOAA 1VZAA 2RD8B 1AIQA 1JTUA 3ED7A 1LCBA 4LRRA 1BO8A 3HB8A 3EDWX 3IRMA 4ECKA 1BKPA 1NJAA 4H0RA 4IQBA 4EB4A 1TSXA 1TSWA 2AAZA 3DG8C 4O1XA 1HW4A 4GD7A 3TMSA 3N5EA 4EILA 1BSFA 3IK1A 1BJGA 3H9KA 1TISA 1TSLA 1VZBA 2H2QA 3EF9A 3NRRA 3QJ7A 4FQSA 4IQQA 3UWLB 1J3JC 2TSCA 4FGTA 4EZ8A 1TDAA 4KY4A 1TYSA 2G86A 3QG2A 4KY8A 1JMFA 3KJSA 1LCAA 3BYXA 2FTNA 2FTQA 3BFIA 3BGXA 3OB7A 1EV8A 1JMHA 1JG0A 1AOBA 1B49A 1TSVA 1TDCA 1LCEA 2ONBA 2TDDA 3EJLA 4TMSA 3EBUA 4KNZA 1DDUA 2VETA 4GYHA 4O7UA 1SEJA 2G8DA 3K2HA 3KJRA 1TVVA 1B02A 1KCEA 1KZJA 3CLBA 3C0AA 4E28A 5BY6A 1RTSA 1I00A 3JSUA 1F4BA 4H1IA 1ZPRA 1TVWA 3IJZA 1HW3A 3UM8A 3N5EB 3DL6A 3IK0A 2RD8A 2FTOX 2RDAA 1BPJA 3IX6A 1TDUA 1VZDA 2G8XA 4H0UA 4XSCA 2BBQA 1TLCA 3N5GA 4EINA 1B5DA 1CI7A 3GG5A 1TDBA 1F4FA 1AJMA 1FWMA 1SYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JMG A;  2G89 A;  5J7W A;  3BHL A;  1BO7 A;  1BSP A;  3BNZ A;  1F4E A;  5H38 A;  3UM6 A;  1KZI A;  3B9H A;  3I3R A;  2A9W A;  1F4G A;  4XSD A;  2TSR A;  5H39 A;  3HJ3 A;  3IRO A;  3EAW X;  1BQ2 A;  1NJD A;  4G6W X;  3INV A;  1TSM A;  1BDU A;  3B5B A;  5HS3 A;  3GH0 A;  4F2V A;  1AN5 A;  1DNA A;  3QGT A;  1TVU A;  2G8A A;  1JU6 A;  3IHI A;  1TSD A;  1NJB A;  4O1U A;  1YPV A;  5FCT A;  4XSE A;  4Q0D A;  1TSZ A;  1HVY A;  4ISW A;  1F28 A;  1EVF A;  3C06 A;  4G2O X;  1NJE A;  1NCE A;  1F4D A;  1QQQ A;  4FOX A;  1TLS A;  3EHI X;  5H3A A;  3KGB A;  1QZF A;  1BP0 A;  3HBB A;  1J3K C;  1JUJ A;  1TRG A;  4KPW A;  3UWL A;  1BP6 A;  1BID A;  1TJS A;  1VZE A;  2KCE A;  1JTQ A;  3DGA C;  3BHR A;  3EGY X;  4DPD A;  4DP3 A;  1AXW A;  3GH2 X;  4E5O A;  3DL5 A;  4JEF A;  1EVG A;  1BKO A;  1VZC A;  3CL9 A;  1JUT A;  1B5E A;  1BQ1 A;  4Q0E A;  1J3I C;  2TDM A;  1TSY A;  2OIP A;  1TSN A;  2VF0 A;  1NJC A;  3BZ0 A;  4KYA A;  3V8H A;  1F4C A;  4GEV A;  1HZW A;  1EV5 A;  4O1X D;  5WRN A;  4DQ1 A;  1JMI A;  4ISK A;  4DPH A;  4FOG A;  4IRR A;  4PSG A;  1THY A;  1FFL A;  3IRN A;  4UP1 A;  3UM5 A;  4FOA A;  1VZA A;  2RD8 B;  1AIQ A;  1JTU A;  3ED7 A;  1LCB A;  4LRR A;  1BO8 A;  3HB8 A;  3EDW X;  3IRM A;  4ECK A;  1BKP A;  1NJA A;  4H0R A;  4IQB A;  4EB4 A;  1TSX A;  1TSW A;  2AAZ A;  3DG8 C;  4O1X A;  1HW4 A;  4GD7 A;  3TMS A;  3N5E A;  4EIL A;  1BSF A;  3IK1 A;  1BJG A;  3H9K A;  1TIS A;  1TSL A;  1VZB A;  2H2Q A;  3EF9 A;  3NRR A;  3QJ7 A;  4FQS A;  4IQQ A;  3UWL B;  1J3J C;  2TSC A;  4FGT A;  4EZ8 A;  1TDA A;  4KY4 A;  1TYS A;  2G86 A;  3QG2 A;  4KY8 A;  1JMF A;  3KJS A;  1LCA A;  3BYX A;  2FTN A;  2FTQ A;  3BFI A;  3BGX A;  3OB7 A;  1EV8 A;  1JMH A;  1JG0 A;  1AOB A;  1B49 A;  1TSV A;  1TDC A;  1LCE A;  2ONB A;  2TDD A;  3EJL A;  4TMS A;  3EBU A;  4KNZ A;  1DDU A;  2VET A;  4GYH A;  4O7U A;  1SEJ A;  2G8D A;  3K2H A;  3KJR A;  1TVV A;  1B02 A;  1KCE A;  1KZJ A;  3CLB A;  3C0A A;  4E28 A;  5BY6 A;  1RTS A;  1I00 A;  3JSU A;  1F4B A;  4H1I A;  1ZPR A;  1TVW A;  3IJZ A;  1HW3 A;  3UM8 A;  3N5E B;  3DL6 A;  3IK0 A;  2RD8 A;  2FTO X;  2RDA A;  1BPJ A;  3IX6 A;  1TDU A;  1VZD A;  2G8X A;  4H0U A;  4XSC A;  2BBQ A;  1TLC A;  3N5G A;  4EIN A;  1B5D A;  1CI7 A;  3GG5 A;  1TDB A;  1F4F A;  1AJM A;  1FWM A;  1SYN A; 
#chains in the Genus database with same CATH topology
 1JMG A;  2G89 A;  5J7W A;  3BHL A;  1BO7 A;  1BSP A;  3BNZ A;  1F4E A;  5H38 A;  3UM6 A;  1KZI A;  3B9H A;  3I3R A;  2A9W A;  1F4G A;  4XSD A;  2TSR A;  5H39 A;  3HJ3 A;  3IRO A;  3EAW X;  1BQ2 A;  1NJD A;  4G6W X;  3INV A;  1TSM A;  1BDU A;  3B5B A;  5HS3 A;  3GH0 A;  4F2V A;  1AN5 A;  1DNA A;  3QGT A;  1TVU A;  2G8A A;  1JU6 A;  3IHI A;  1TSD A;  1NJB A;  4O1U A;  1YPV A;  5FCT A;  4XSE A;  4Q0D A;  1TSZ A;  1HVY A;  4ISW A;  1F28 A;  1EVF A;  3C06 A;  4G2O X;  1NJE A;  1NCE A;  1F4D A;  1QQQ A;  4FOX A;  1TLS A;  3EHI X;  5H3A A;  3KGB A;  1QZF A;  1BP0 A;  3HBB A;  1J3K C;  1JUJ A;  1TRG A;  4KPW A;  3UWL A;  1BP6 A;  1BID A;  1TJS A;  1VZE A;  2KCE A;  1JTQ A;  3DGA C;  3BHR A;  3EGY X;  4DPD A;  4DP3 A;  1AXW A;  3GH2 X;  4E5O A;  3DL5 A;  4JEF A;  1EVG A;  1BKO A;  1VZC A;  3CL9 A;  1JUT A;  1B5E A;  1BQ1 A;  4Q0E A;  1J3I C;  2TDM A;  1TSY A;  2OIP A;  1TSN A;  2VF0 A;  1NJC A;  3BZ0 A;  4KYA A;  3V8H A;  1F4C A;  4GEV A;  1HZW A;  1EV5 A;  4O1X D;  5WRN A;  4DQ1 A;  1JMI A;  4ISK A;  4DPH A;  4FOG A;  4IRR A;  4PSG A;  1THY A;  1FFL A;  3IRN A;  4UP1 A;  3UM5 A;  4FOA A;  1VZA A;  2RD8 B;  1AIQ A;  1JTU A;  3ED7 A;  1LCB A;  4LRR A;  1BO8 A;  3HB8 A;  3EDW X;  3IRM A;  4ECK A;  1BKP A;  1NJA A;  4H0R A;  4IQB A;  4EB4 A;  1TSX A;  1TSW A;  2AAZ A;  3DG8 C;  4O1X A;  1HW4 A;  4GD7 A;  3TMS A;  3N5E A;  4EIL A;  1BSF A;  3IK1 A;  1BJG A;  3H9K A;  1TIS A;  1TSL A;  1VZB A;  2H2Q A;  3EF9 A;  3NRR A;  3QJ7 A;  4FQS A;  4IQQ A;  3UWL B;  1J3J C;  2TSC A;  4FGT A;  4EZ8 A;  1TDA A;  4KY4 A;  1TYS A;  2G86 A;  3QG2 A;  4KY8 A;  1JMF A;  3KJS A;  1LCA A;  3BYX A;  2FTN A;  2FTQ A;  3BFI A;  3BGX A;  3OB7 A;  1EV8 A;  1JMH A;  1JG0 A;  1AOB A;  1B49 A;  1TSV A;  1TDC A;  1LCE A;  2ONB A;  2TDD A;  3EJL A;  4TMS A;  3EBU A;  4KNZ A;  1DDU A;  2VET A;  4GYH A;  4O7U A;  1SEJ A;  2G8D A;  3K2H A;  3KJR A;  1TVV A;  1B02 A;  1KCE A;  1KZJ A;  3CLB A;  3C0A A;  4E28 A;  5BY6 A;  1RTS A;  1I00 A;  3JSU A;  1F4B A;  4H1I A;  1ZPR A;  1TVW A;  3IJZ A;  1HW3 A;  3UM8 A;  3N5E B;  3DL6 A;  3IK0 A;  2RD8 A;  2FTO X;  2RDA A;  1BPJ A;  3IX6 A;  1TDU A;  1VZD A;  2G8X A;  4H0U A;  4XSC A;  2BBQ A;  1TLC A;  3N5G A;  4EIN A;  1B5D A;  1CI7 A;  3GG5 A;  1TDB A;  1F4F A;  1AJM A;  1FWM A;  1SYN A; 
#chains in the Genus database with same CATH homology
 1JMG A;  2G89 A;  5J7W A;  3BHL A;  1BO7 A;  1BSP A;  3BNZ A;  1F4E A;  5H38 A;  3UM6 A;  1KZI A;  3B9H A;  3I3R A;  2A9W A;  1F4G A;  4XSD A;  2TSR A;  5H39 A;  3HJ3 A;  3IRO A;  3EAW X;  1BQ2 A;  1NJD A;  4G6W X;  3INV A;  1TSM A;  1BDU A;  3B5B A;  5HS3 A;  3GH0 A;  4F2V A;  1AN5 A;  1DNA A;  3QGT A;  1TVU A;  2G8A A;  1JU6 A;  3IHI A;  1TSD A;  1NJB A;  4O1U A;  1YPV A;  5FCT A;  4XSE A;  4Q0D A;  1TSZ A;  1HVY A;  4ISW A;  1F28 A;  1EVF A;  3C06 A;  4G2O X;  1NJE A;  1NCE A;  1F4D A;  1QQQ A;  4FOX A;  1TLS A;  3EHI X;  5H3A A;  3KGB A;  1QZF A;  1BP0 A;  3HBB A;  1J3K C;  1JUJ A;  1TRG A;  4KPW A;  3UWL A;  1BP6 A;  1BID A;  1TJS A;  1VZE A;  2KCE A;  1JTQ A;  3DGA C;  3BHR A;  3EGY X;  4DPD A;  4DP3 A;  1AXW A;  3GH2 X;  4E5O A;  3DL5 A;  4JEF A;  1EVG A;  1BKO A;  1VZC A;  3CL9 A;  1JUT A;  1B5E A;  1BQ1 A;  4Q0E A;  1J3I C;  2TDM A;  1TSY A;  2OIP A;  1TSN A;  2VF0 A;  1NJC A;  3BZ0 A;  4KYA A;  3V8H A;  1F4C A;  4GEV A;  1HZW A;  1EV5 A;  4O1X D;  5WRN A;  4DQ1 A;  1JMI A;  4ISK A;  4DPH A;  4FOG A;  4IRR A;  4PSG A;  1THY A;  1FFL A;  3IRN A;  4UP1 A;  3UM5 A;  4FOA A;  1VZA A;  2RD8 B;  1AIQ A;  1JTU A;  3ED7 A;  1LCB A;  4LRR A;  1BO8 A;  3HB8 A;  3EDW X;  3IRM A;  4ECK A;  1BKP A;  1NJA A;  4H0R A;  4IQB A;  4EB4 A;  1TSX A;  1TSW A;  2AAZ A;  3DG8 C;  4O1X A;  1HW4 A;  4GD7 A;  3TMS A;  3N5E A;  4EIL A;  1BSF A;  3IK1 A;  1BJG A;  3H9K A;  1TIS A;  1TSL A;  1VZB A;  2H2Q A;  3EF9 A;  3NRR A;  3QJ7 A;  4FQS A;  4IQQ A;  3UWL B;  1J3J C;  2TSC A;  4FGT A;  4EZ8 A;  1TDA A;  4KY4 A;  1TYS A;  2G86 A;  3QG2 A;  4KY8 A;  1JMF A;  3KJS A;  1LCA A;  3BYX A;  2FTN A;  2FTQ A;  3BFI A;  3BGX A;  3OB7 A;  1EV8 A;  1JMH A;  1JG0 A;  1AOB A;  1B49 A;  1TSV A;  1TDC A;  1LCE A;  2ONB A;  2TDD A;  3EJL A;  4TMS A;  3EBU A;  4KNZ A;  1DDU A;  2VET A;  4GYH A;  4O7U A;  1SEJ A;  2G8D A;  3K2H A;  3KJR A;  1TVV A;  1B02 A;  1KCE A;  1KZJ A;  3CLB A;  3C0A A;  4E28 A;  5BY6 A;  1RTS A;  1I00 A;  3JSU A;  1F4B A;  4H1I A;  1ZPR A;  1TVW A;  3IJZ A;  1HW3 A;  3UM8 A;  3N5E B;  3DL6 A;  3IK0 A;  2RD8 A;  2FTO X;  2RDA A;  1BPJ A;  3IX6 A;  1TDU A;  1VZD A;  2G8X A;  4H0U A;  4XSC A;  2BBQ A;  1TLC A;  3N5G A;  4EIN A;  1B5D A;  1CI7 A;  3GG5 A;  1TDB A;  1F4F A;  1AJM A;  1FWM A;  1SYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...