5J7WA

Enterococcus faecalis thymidylate synthase complex with methotrexate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
313
structure length
280
Chain Sequence
MEEAYLALGKKILEEGHFKEDRTGTGTYSLFGYQMRFDLAKGFPLLTTKRVPFGLIKSELLWFLKGDTNIRYLLERNNHIWDEWAFEHQKFCDAILNDAEFAEKYGELGNIYGAQWRHWETKDGSFIDQLANVIEMIKTNPDSRRLIVSAWNPEDVPSMALPPCHTMFQFYVNEGKLSCQLYQRSADVFLGVPFNIASYALLTHLIAHETGLEVGEFVHTLGDAHLYQNHVEQMQEQLSREVRSFPTLVLNPDKASVFDFDMEDIKVEGYDPHPTIKAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase
publication title X-ray crystal structures of Enterococcus faecalis thymidylate synthase with folate binding site inhibitors.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 77
structure length 280
sequence length 313
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2016-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 5j7wA00
3BGXA 3N5EA 4KYAA 1JU6A 1F4DA 1BPJA 1LCAA 2RD8B 1NJCA 5HS3A 1B49A 1DDUA 2BBQA 3INVA 2FTNA 4KY8A 1NJEA 1LCEA 1JMGA 1TSYA 2G89A 1CI7A 3OB7A 3IHIA 3NRRA 4FOAA 4IQBA 4FQSA 1TRGA 1TSXA 4XSDA 2G8DA 5WRNA 1AOBA 3C0AA 1BDUA 3B9HA 3UWLB 3GH2X 4GEVA 2TSRA 4E5OA 2G8XA 1TISA 2OIPA 1HZWA 1F4FA 2H2QA 3HJ3A 2VF0A 1AIQA 1TLSA 3EBUA 3UM8A 3DG8C 1BSFA 3EHIX 4PSGA 4XSEA 1ZPRA 1TSZA 1EV8A 4JEFA 1BIDA 1J3JC 1JTQA 4IQQA 4Q0DA 3UM5A 3EJLA 1VZEA 3GG5A 3H9KA 1QZFA 3IRNA 4DPHA 1NJDA 4TMSA 1BSPA 3QGTA 4G2OX 1TSLA 3IRMA 2TDMA 4Q0EA 1F4BA 5J7WA 3IROA 4G6WX 1SEJA 3IK0A 2ONBA 2FTQA 4FGTA 1AXWA 1KZIA 1RTSA 3BHLA 1SYNA 1YPVA 3K2HA 2A9WA 1BP6A 1TVUA 1TDUA 5H38A 3UM6A 1HVYA 3QG2A 5H3AA 5BY6A 1BO8A 4IRRA 2RD8A 2KCEA 3BHRA 1AN5A 1BQ1A 3C06A 4GYHA 4ISWA 4KNZA 1TDBA 4KPWA 3B5BA 2TDDA 4EZ8A 1TJSA 1TSVA 1TVVA 3EDWX 3BFIA 5FCTA 1LCBA 1F4GA 1FWMA 2RDAA 1BJGA 1KZJA 3HBBA 4EILA 1I00A 2AAZA 3EGYX 3KGBA 1EVGA 3DL6A 4KY4A 1JG0A 1HW4A 1JUJA 1TYSA 3N5EB 3UWLA 3IX6A 4GD7A 3N5GA 4O1XA 1JMHA 3JSUA 1NCEA 1B5DA 3EAWX 1VZBA 4FOXA 1KCEA 4H0UA 4DQ1A 4DPDA 3TMSA 4ECKA 1EVFA 2G86A 3BZ0A 1JUTA 1JTUA 3DGAC 4EINA 1J3KC 1F28A 1TVWA 1HW3A 1B5EA 4XSCA 4LRRA 3GH0A 1BKPA 4FOGA 3BYXA 1AJMA 2G8AA 3BNZA 1TSNA 1TDAA 4F2VA 1NJBA 1TLCA 1B02A 1DNAA 1THYA 3QJ7A 1BP0A 1BQ2A 3HB8A 1BKOA 4H0RA 3CLBA 4O7UA 1TSDA 3DL5A 1EV5A 4H1IA 1F4CA 4DP3A 4EB4A 3IK1A 2VETA 4ISKA 2TSCA 1J3IC 2FTOX 3ED7A 1VZDA 1F4EA 1QQQA 3V8HA 4UP1A 1JMIA 1TSWA 4O1UA 1VZAA 4O1XD 1NJAA 1JMFA 1TDCA 3KJRA 3IJZA 5H39A 1BO7A 1TSMA 3CL9A 1VZCA 4E28A 1FFLA 3KJSA 3EF9A 3I3RA
chains in the Genus database with same CATH superfamily
3BGXA 3N5EA 4KYAA 1JU6A 1F4DA 1BPJA 1LCAA 2RD8B 1NJCA 5HS3A 1B49A 1DDUA 2BBQA 3INVA 2FTNA 4KY8A 1NJEA 1LCEA 1JMGA 1TSYA 2G89A 1CI7A 3OB7A 3IHIA 3NRRA 4FOAA 4IQBA 4FQSA 1TRGA 1TSXA 4XSDA 2G8DA 5WRNA 1AOBA 3C0AA 1BDUA 3B9HA 3UWLB 3GH2X 4GEVA 2TSRA 4E5OA 2G8XA 1TISA 2OIPA 1HZWA 1F4FA 2H2QA 3HJ3A 2VF0A 1AIQA 1TLSA 3EBUA 3UM8A 3DG8C 1BSFA 3EHIX 4PSGA 4XSEA 1ZPRA 1TSZA 1EV8A 4JEFA 1BIDA 1J3JC 1JTQA 4IQQA 4Q0DA 3UM5A 3EJLA 1VZEA 3GG5A 3H9KA 1QZFA 3IRNA 4DPHA 1NJDA 4TMSA 1BSPA 3QGTA 4G2OX 1TSLA 3IRMA 2TDMA 4Q0EA 1F4BA 5J7WA 3IROA 4G6WX 1SEJA 3IK0A 2ONBA 2FTQA 4FGTA 1AXWA 1KZIA 1RTSA 3BHLA 1SYNA 1YPVA 3K2HA 2A9WA 1BP6A 1TVUA 1TDUA 5H38A 3UM6A 1HVYA 3QG2A 5H3AA 5BY6A 1BO8A 4IRRA 2RD8A 2KCEA 3BHRA 1AN5A 1BQ1A 3C06A 4GYHA 4ISWA 4KNZA 1TDBA 4KPWA 3B5BA 2TDDA 4EZ8A 1TJSA 1TSVA 1TVVA 3EDWX 3BFIA 5FCTA 1LCBA 1F4GA 1FWMA 2RDAA 1BJGA 1KZJA 3HBBA 4EILA 1I00A 2AAZA 3EGYX 3KGBA 1EVGA 3DL6A 4KY4A 1JG0A 1HW4A 1JUJA 1TYSA 3N5EB 3UWLA 3IX6A 4GD7A 3N5GA 4O1XA 1JMHA 3JSUA 1NCEA 1B5DA 3EAWX 1VZBA 4FOXA 1KCEA 4H0UA 4DQ1A 4DPDA 3TMSA 4ECKA 1EVFA 2G86A 3BZ0A 1JUTA 1JTUA 3DGAC 4EINA 1J3KC 1F28A 1TVWA 1HW3A 1B5EA 4XSCA 4LRRA 3GH0A 1BKPA 4FOGA 3BYXA 1AJMA 2G8AA 3BNZA 1TSNA 1TDAA 4F2VA 1NJBA 1TLCA 1B02A 1DNAA 1THYA 3QJ7A 1BP0A 1BQ2A 3HB8A 1BKOA 4H0RA 3CLBA 4O7UA 1TSDA 3DL5A 1EV5A 4H1IA 1F4CA 4DP3A 4EB4A 3IK1A 2VETA 4ISKA 2TSCA 1J3IC 2FTOX 3ED7A 1VZDA 1F4EA 1QQQA 3V8HA 4UP1A 1JMIA 1TSWA 4O1UA 1VZAA 4O1XD 1NJAA 1JMFA 1TDCA 3KJRA 3IJZA 5H39A 1BO7A 1TSMA 3CL9A 1VZCA 4E28A 1FFLA 3KJSA 3EF9A 3I3RA
chains in the Genus database with same CATH topology
3BGXA 3N5EA 4KYAA 1JU6A 1F4DA 1BPJA 1LCAA 2RD8B 1NJCA 5HS3A 1B49A 1DDUA 2BBQA 3INVA 2FTNA 4KY8A 1NJEA 1LCEA 1JMGA 1TSYA 2G89A 1CI7A 3OB7A 3IHIA 3NRRA 4FOAA 4IQBA 4FQSA 1TRGA 1TSXA 4XSDA 2G8DA 5WRNA 1AOBA 3C0AA 1BDUA 3B9HA 3UWLB 3GH2X 4GEVA 2TSRA 4E5OA 2G8XA 1TISA 2OIPA 1HZWA 1F4FA 2H2QA 3HJ3A 2VF0A 1AIQA 1TLSA 3EBUA 3UM8A 3DG8C 1BSFA 3EHIX 4PSGA 4XSEA 1ZPRA 1TSZA 1EV8A 4JEFA 1BIDA 1J3JC 1JTQA 4IQQA 4Q0DA 3UM5A 3EJLA 1VZEA 3GG5A 3H9KA 1QZFA 3IRNA 4DPHA 1NJDA 4TMSA 1BSPA 3QGTA 4G2OX 1TSLA 3IRMA 2TDMA 4Q0EA 1F4BA 5J7WA 3IROA 4G6WX 1SEJA 3IK0A 2ONBA 2FTQA 4FGTA 1AXWA 1KZIA 1RTSA 3BHLA 1SYNA 1YPVA 3K2HA 2A9WA 1BP6A 1TVUA 1TDUA 5H38A 3UM6A 1HVYA 3QG2A 5H3AA 5BY6A 1BO8A 4IRRA 2RD8A 2KCEA 3BHRA 1AN5A 1BQ1A 3C06A 4GYHA 4ISWA 4KNZA 1TDBA 4KPWA 3B5BA 2TDDA 4EZ8A 1TJSA 1TSVA 1TVVA 3EDWX 3BFIA 5FCTA 1LCBA 1F4GA 1FWMA 2RDAA 1BJGA 1KZJA 3HBBA 4EILA 1I00A 2AAZA 3EGYX 3KGBA 1EVGA 3DL6A 4KY4A 1JG0A 1HW4A 1JUJA 1TYSA 3N5EB 3UWLA 3IX6A 4GD7A 3N5GA 4O1XA 1JMHA 3JSUA 1NCEA 1B5DA 3EAWX 1VZBA 4FOXA 1KCEA 4H0UA 4DQ1A 4DPDA 3TMSA 4ECKA 1EVFA 2G86A 3BZ0A 1JUTA 1JTUA 3DGAC 4EINA 1J3KC 1F28A 1TVWA 1HW3A 1B5EA 4XSCA 4LRRA 3GH0A 1BKPA 4FOGA 3BYXA 1AJMA 2G8AA 3BNZA 1TSNA 1TDAA 4F2VA 1NJBA 1TLCA 1B02A 1DNAA 1THYA 3QJ7A 1BP0A 1BQ2A 3HB8A 1BKOA 4H0RA 3CLBA 4O7UA 1TSDA 3DL5A 1EV5A 4H1IA 1F4CA 4DP3A 4EB4A 3IK1A 2VETA 4ISKA 2TSCA 1J3IC 2FTOX 3ED7A 1VZDA 1F4EA 1QQQA 3V8HA 4UP1A 1JMIA 1TSWA 4O1UA 1VZAA 4O1XD 1NJAA 1JMFA 1TDCA 3KJRA 3IJZA 5H39A 1BO7A 1TSMA 3CL9A 1VZCA 4E28A 1FFLA 3KJSA 3EF9A 3I3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BGX A;  3N5E A;  4KYA A;  1JU6 A;  1F4D A;  1BPJ A;  1LCA A;  2RD8 B;  1NJC A;  5HS3 A;  1B49 A;  1DDU A;  2BBQ A;  3INV A;  2FTN A;  4KY8 A;  1NJE A;  1LCE A;  1JMG A;  1TSY A;  2G89 A;  1CI7 A;  3OB7 A;  3IHI A;  3NRR A;  4FOA A;  4IQB A;  4FQS A;  1TRG A;  1TSX A;  4XSD A;  2G8D A;  5WRN A;  1AOB A;  3C0A A;  1BDU A;  3B9H A;  3UWL B;  3GH2 X;  4GEV A;  2TSR A;  4E5O A;  2G8X A;  1TIS A;  2OIP A;  1HZW A;  1F4F A;  2H2Q A;  3HJ3 A;  2VF0 A;  1AIQ A;  1TLS A;  3EBU A;  3UM8 A;  3DG8 C;  1BSF A;  3EHI X;  4PSG A;  4XSE A;  1ZPR A;  1TSZ A;  1EV8 A;  4JEF A;  1BID A;  1J3J C;  1JTQ A;  4IQQ A;  4Q0D A;  3UM5 A;  3EJL A;  1VZE A;  3GG5 A;  3H9K A;  1QZF A;  3IRN A;  4DPH A;  1NJD A;  4TMS A;  1BSP A;  3QGT A;  4G2O X;  1TSL A;  3IRM A;  2TDM A;  4Q0E A;  1F4B A;  5J7W A;  3IRO A;  4G6W X;  1SEJ A;  3IK0 A;  2ONB A;  2FTQ A;  4FGT A;  1AXW A;  1KZI A;  1RTS A;  3BHL A;  1SYN A;  1YPV A;  3K2H A;  2A9W A;  1BP6 A;  1TVU A;  1TDU A;  5H38 A;  3UM6 A;  1HVY A;  3QG2 A;  5H3A A;  5BY6 A;  1BO8 A;  4IRR A;  2RD8 A;  2KCE A;  3BHR A;  1AN5 A;  1BQ1 A;  3C06 A;  4GYH A;  4ISW A;  4KNZ A;  1TDB A;  4KPW A;  3B5B A;  2TDD A;  4EZ8 A;  1TJS A;  1TSV A;  1TVV A;  3EDW X;  3BFI A;  5FCT A;  1LCB A;  1F4G A;  1FWM A;  2RDA A;  1BJG A;  1KZJ A;  3HBB A;  4EIL A;  1I00 A;  2AAZ A;  3EGY X;  3KGB A;  1EVG A;  3DL6 A;  4KY4 A;  1JG0 A;  1HW4 A;  1JUJ A;  1TYS A;  3N5E B;  3UWL A;  3IX6 A;  4GD7 A;  3N5G A;  4O1X A;  1JMH A;  3JSU A;  1NCE A;  1B5D A;  3EAW X;  1VZB A;  4FOX A;  1KCE A;  4H0U A;  4DQ1 A;  4DPD A;  3TMS A;  4ECK A;  1EVF A;  2G86 A;  3BZ0 A;  1JUT A;  1JTU A;  3DGA C;  4EIN A;  1J3K C;  1F28 A;  1TVW A;  1HW3 A;  1B5E A;  4XSC A;  4LRR A;  3GH0 A;  1BKP A;  4FOG A;  3BYX A;  1AJM A;  2G8A A;  3BNZ A;  1TSN A;  1TDA A;  4F2V A;  1NJB A;  1TLC A;  1B02 A;  1DNA A;  1THY A;  3QJ7 A;  1BP0 A;  1BQ2 A;  3HB8 A;  1BKO A;  4H0R A;  3CLB A;  4O7U A;  1TSD A;  3DL5 A;  1EV5 A;  4H1I A;  1F4C A;  4DP3 A;  4EB4 A;  3IK1 A;  2VET A;  4ISK A;  2TSC A;  1J3I C;  2FTO X;  3ED7 A;  1VZD A;  1F4E A;  1QQQ A;  3V8H A;  4UP1 A;  1JMI A;  1TSW A;  4O1U A;  1VZA A;  4O1X D;  1NJA A;  1JMF A;  1TDC A;  3KJR A;  3IJZ A;  5H39 A;  1BO7 A;  1TSM A;  3CL9 A;  1VZC A;  4E28 A;  1FFL A;  3KJS A;  3EF9 A;  3I3R A; 
#chains in the Genus database with same CATH topology
 3BGX A;  3N5E A;  4KYA A;  1JU6 A;  1F4D A;  1BPJ A;  1LCA A;  2RD8 B;  1NJC A;  5HS3 A;  1B49 A;  1DDU A;  2BBQ A;  3INV A;  2FTN A;  4KY8 A;  1NJE A;  1LCE A;  1JMG A;  1TSY A;  2G89 A;  1CI7 A;  3OB7 A;  3IHI A;  3NRR A;  4FOA A;  4IQB A;  4FQS A;  1TRG A;  1TSX A;  4XSD A;  2G8D A;  5WRN A;  1AOB A;  3C0A A;  1BDU A;  3B9H A;  3UWL B;  3GH2 X;  4GEV A;  2TSR A;  4E5O A;  2G8X A;  1TIS A;  2OIP A;  1HZW A;  1F4F A;  2H2Q A;  3HJ3 A;  2VF0 A;  1AIQ A;  1TLS A;  3EBU A;  3UM8 A;  3DG8 C;  1BSF A;  3EHI X;  4PSG A;  4XSE A;  1ZPR A;  1TSZ A;  1EV8 A;  4JEF A;  1BID A;  1J3J C;  1JTQ A;  4IQQ A;  4Q0D A;  3UM5 A;  3EJL A;  1VZE A;  3GG5 A;  3H9K A;  1QZF A;  3IRN A;  4DPH A;  1NJD A;  4TMS A;  1BSP A;  3QGT A;  4G2O X;  1TSL A;  3IRM A;  2TDM A;  4Q0E A;  1F4B A;  5J7W A;  3IRO A;  4G6W X;  1SEJ A;  3IK0 A;  2ONB A;  2FTQ A;  4FGT A;  1AXW A;  1KZI A;  1RTS A;  3BHL A;  1SYN A;  1YPV A;  3K2H A;  2A9W A;  1BP6 A;  1TVU A;  1TDU A;  5H38 A;  3UM6 A;  1HVY A;  3QG2 A;  5H3A A;  5BY6 A;  1BO8 A;  4IRR A;  2RD8 A;  2KCE A;  3BHR A;  1AN5 A;  1BQ1 A;  3C06 A;  4GYH A;  4ISW A;  4KNZ A;  1TDB A;  4KPW A;  3B5B A;  2TDD A;  4EZ8 A;  1TJS A;  1TSV A;  1TVV A;  3EDW X;  3BFI A;  5FCT A;  1LCB A;  1F4G A;  1FWM A;  2RDA A;  1BJG A;  1KZJ A;  3HBB A;  4EIL A;  1I00 A;  2AAZ A;  3EGY X;  3KGB A;  1EVG A;  3DL6 A;  4KY4 A;  1JG0 A;  1HW4 A;  1JUJ A;  1TYS A;  3N5E B;  3UWL A;  3IX6 A;  4GD7 A;  3N5G A;  4O1X A;  1JMH A;  3JSU A;  1NCE A;  1B5D A;  3EAW X;  1VZB A;  4FOX A;  1KCE A;  4H0U A;  4DQ1 A;  4DPD A;  3TMS A;  4ECK A;  1EVF A;  2G86 A;  3BZ0 A;  1JUT A;  1JTU A;  3DGA C;  4EIN A;  1J3K C;  1F28 A;  1TVW A;  1HW3 A;  1B5E A;  4XSC A;  4LRR A;  3GH0 A;  1BKP A;  4FOG A;  3BYX A;  1AJM A;  2G8A A;  3BNZ A;  1TSN A;  1TDA A;  4F2V A;  1NJB A;  1TLC A;  1B02 A;  1DNA A;  1THY A;  3QJ7 A;  1BP0 A;  1BQ2 A;  3HB8 A;  1BKO A;  4H0R A;  3CLB A;  4O7U A;  1TSD A;  3DL5 A;  1EV5 A;  4H1I A;  1F4C A;  4DP3 A;  4EB4 A;  3IK1 A;  2VET A;  4ISK A;  2TSC A;  1J3I C;  2FTO X;  3ED7 A;  1VZD A;  1F4E A;  1QQQ A;  3V8H A;  4UP1 A;  1JMI A;  1TSW A;  4O1U A;  1VZA A;  4O1X D;  1NJA A;  1JMF A;  1TDC A;  3KJR A;  3IJZ A;  5H39 A;  1BO7 A;  1TSM A;  3CL9 A;  1VZC A;  4E28 A;  1FFL A;  3KJS A;  3EF9 A;  3I3R A; 
#chains in the Genus database with same CATH homology
 3BGX A;  3N5E A;  4KYA A;  1JU6 A;  1F4D A;  1BPJ A;  1LCA A;  2RD8 B;  1NJC A;  5HS3 A;  1B49 A;  1DDU A;  2BBQ A;  3INV A;  2FTN A;  4KY8 A;  1NJE A;  1LCE A;  1JMG A;  1TSY A;  2G89 A;  1CI7 A;  3OB7 A;  3IHI A;  3NRR A;  4FOA A;  4IQB A;  4FQS A;  1TRG A;  1TSX A;  4XSD A;  2G8D A;  5WRN A;  1AOB A;  3C0A A;  1BDU A;  3B9H A;  3UWL B;  3GH2 X;  4GEV A;  2TSR A;  4E5O A;  2G8X A;  1TIS A;  2OIP A;  1HZW A;  1F4F A;  2H2Q A;  3HJ3 A;  2VF0 A;  1AIQ A;  1TLS A;  3EBU A;  3UM8 A;  3DG8 C;  1BSF A;  3EHI X;  4PSG A;  4XSE A;  1ZPR A;  1TSZ A;  1EV8 A;  4JEF A;  1BID A;  1J3J C;  1JTQ A;  4IQQ A;  4Q0D A;  3UM5 A;  3EJL A;  1VZE A;  3GG5 A;  3H9K A;  1QZF A;  3IRN A;  4DPH A;  1NJD A;  4TMS A;  1BSP A;  3QGT A;  4G2O X;  1TSL A;  3IRM A;  2TDM A;  4Q0E A;  1F4B A;  5J7W A;  3IRO A;  4G6W X;  1SEJ A;  3IK0 A;  2ONB A;  2FTQ A;  4FGT A;  1AXW A;  1KZI A;  1RTS A;  3BHL A;  1SYN A;  1YPV A;  3K2H A;  2A9W A;  1BP6 A;  1TVU A;  1TDU A;  5H38 A;  3UM6 A;  1HVY A;  3QG2 A;  5H3A A;  5BY6 A;  1BO8 A;  4IRR A;  2RD8 A;  2KCE A;  3BHR A;  1AN5 A;  1BQ1 A;  3C06 A;  4GYH A;  4ISW A;  4KNZ A;  1TDB A;  4KPW A;  3B5B A;  2TDD A;  4EZ8 A;  1TJS A;  1TSV A;  1TVV A;  3EDW X;  3BFI A;  5FCT A;  1LCB A;  1F4G A;  1FWM A;  2RDA A;  1BJG A;  1KZJ A;  3HBB A;  4EIL A;  1I00 A;  2AAZ A;  3EGY X;  3KGB A;  1EVG A;  3DL6 A;  4KY4 A;  1JG0 A;  1HW4 A;  1JUJ A;  1TYS A;  3N5E B;  3UWL A;  3IX6 A;  4GD7 A;  3N5G A;  4O1X A;  1JMH A;  3JSU A;  1NCE A;  1B5D A;  3EAW X;  1VZB A;  4FOX A;  1KCE A;  4H0U A;  4DQ1 A;  4DPD A;  3TMS A;  4ECK A;  1EVF A;  2G86 A;  3BZ0 A;  1JUT A;  1JTU A;  3DGA C;  4EIN A;  1J3K C;  1F28 A;  1TVW A;  1HW3 A;  1B5E A;  4XSC A;  4LRR A;  3GH0 A;  1BKP A;  4FOG A;  3BYX A;  1AJM A;  2G8A A;  3BNZ A;  1TSN A;  1TDA A;  4F2V A;  1NJB A;  1TLC A;  1B02 A;  1DNA A;  1THY A;  3QJ7 A;  1BP0 A;  1BQ2 A;  3HB8 A;  1BKO A;  4H0R A;  3CLB A;  4O7U A;  1TSD A;  3DL5 A;  1EV5 A;  4H1I A;  1F4C A;  4DP3 A;  4EB4 A;  3IK1 A;  2VET A;  4ISK A;  2TSC A;  1J3I C;  2FTO X;  3ED7 A;  1VZD A;  1F4E A;  1QQQ A;  3V8H A;  4UP1 A;  1JMI A;  1TSW A;  4O1U A;  1VZA A;  4O1X D;  1NJA A;  1JMF A;  1TDC A;  3KJR A;  3IJZ A;  5H39 A;  1BO7 A;  1TSM A;  3CL9 A;  1VZC A;  4E28 A;  1FFL A;  3KJS A;  3EF9 A;  3I3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...