5WRNA

Human thymidylate synthase complexed with dcmp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
284
structure length
284
Chain Sequence
MPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase
publication title Human thymidylate synthase complexed with dCMP
rcsb
source organism Homo sapiens
total genus 97
structure length 284
sequence length 284
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2016-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 5wrnA00
1DNAA 1JU6A 3ED7A 1TDAA 1NCEA 3H9KA 1AIQA 4FQSA 4EZ8A 2TDDA 1TSWA 1BP6A 4JEFA 3C06A 3IROA 3DGAC 1SYNA 1JTUA 1F4DA 1SEJA 1B02A 3IK0A 3IJZA 1BIDA 5H3AA 1TSXA 3IHIA 4PSGA 1VZAA 3B9HA 3UM5A 4GYHA 3IRNA 3QG2A 1J3JC 2RDAA 1EVFA 1JMFA 1DDUA 1HW3A 1TVWA 1BO8A 4FOXA 4ISWA 4KYAA 4O7UA 4ISKA 4H0UA 1QZFA 5H39A 1TSVA 1EV8A 1KZJA 5FCTA 1HW4A 1VZBA 1F4GA 3BHLA 1B49A 1JMIA 1TLCA 3BFIA 1AJMA 1BO7A 4O1UA 1TDUA 1TSLA 3QGTA 1F4CA 4H1IA 1EV5A 3UM8A 3N5EA 1TSYA 3HB8A 1TSMA 2FTQA 3C0AA 1THYA 3GH2X 3I3RA 1TVUA 1HVYA 2G89A 1HZWA 2TSCA 1TSNA 3OB7A 3V8HA 2FTOX 1B5EA 3DL6A 3BNZA 3IX6A 4KNZA 4GEVA 4Q0DA 1F4EA 3N5EB 5BY6A 1AOBA 1LCEA 1BDUA 3BGXA 3EF9A 2ONBA 3KGBA 1QQQA 2VF0A 1BSPA 4E5OA 4EB4A 1TLSA 1BQ2A 1KZIA 4G2OX 2TDMA 3B5BA 3EHIX 1NJCA 1TVVA 4DPHA 4TMSA 1NJAA 3EJLA 3HJ3A 2TSRA 1FFLA 3EAWX 3HBBA 1J3KC 3CLBA 1BQ1A 1NJBA 4H0RA 4IRRA 4XSCA 4FOGA 1TSDA 1YPVA 5WRNA 3TMSA 1NJDA 1BSFA 3K2HA 2G8AA 2OIPA 3UM6A 3IK1A 5H38A 1TISA 3CL9A 3GG5A 3NRRA 4FGTA 2G8DA 4EILA 2G8XA 1I00A 1JTQA 1TJSA 1F4FA 3JSUA 1FWMA 1TYSA 1JUJA 1TDCA 1RTSA 3GH0A 3N5GA 2BBQA 3UWLA 3EDWX 3INVA 3IRMA 2G86A 4O1XA 4Q0EA 1TSZA 4DPDA 4O1XD 1VZDA 4ECKA 1EVGA 3BYXA 2KCEA 4GD7A 1BPJA 1BKOA 1NJEA 4E28A 1B5DA 2RD8B 3EGYX 1TDBA 4XSDA 3UWLB 4KPWA 5HS3A 3QJ7A 4UP1A 4FOAA 3EBUA 4EINA 3BHRA 4DQ1A 2VETA 4IQBA 3KJSA 1BKPA 1JMGA 3BZ0A 1VZCA 1JMHA 1BJGA 3KJRA 2AAZA 1AXWA 1JUTA 4LRRA 4KY4A 1LCBA 1CI7A 1F28A 5J7WA 1KCEA 1AN5A 3DG8C 4G6WX 1LCAA 1JG0A 4F2VA 1F4BA 1ZPRA 4DP3A 4XSEA 1TRGA 1J3IC 2A9WA 2FTNA 2RD8A 4IQQA 2H2QA 4KY8A 3DL5A 1VZEA 1BP0A
chains in the Genus database with same CATH superfamily
1DNAA 1JU6A 3ED7A 1TDAA 1NCEA 3H9KA 1AIQA 4FQSA 4EZ8A 2TDDA 1TSWA 1BP6A 4JEFA 3C06A 3IROA 3DGAC 1SYNA 1JTUA 1F4DA 1SEJA 1B02A 3IK0A 3IJZA 1BIDA 5H3AA 1TSXA 3IHIA 4PSGA 1VZAA 3B9HA 3UM5A 4GYHA 3IRNA 3QG2A 1J3JC 2RDAA 1EVFA 1JMFA 1DDUA 1HW3A 1TVWA 1BO8A 4FOXA 4ISWA 4KYAA 4O7UA 4ISKA 4H0UA 1QZFA 5H39A 1TSVA 1EV8A 1KZJA 5FCTA 1HW4A 1VZBA 1F4GA 3BHLA 1B49A 1JMIA 1TLCA 3BFIA 1AJMA 1BO7A 4O1UA 1TDUA 1TSLA 3QGTA 1F4CA 4H1IA 1EV5A 3UM8A 3N5EA 1TSYA 3HB8A 1TSMA 2FTQA 3C0AA 1THYA 3GH2X 3I3RA 1TVUA 1HVYA 2G89A 1HZWA 2TSCA 1TSNA 3OB7A 3V8HA 2FTOX 1B5EA 3DL6A 3BNZA 3IX6A 4KNZA 4GEVA 4Q0DA 1F4EA 3N5EB 5BY6A 1AOBA 1LCEA 1BDUA 3BGXA 3EF9A 2ONBA 3KGBA 1QQQA 2VF0A 1BSPA 4E5OA 4EB4A 1TLSA 1BQ2A 1KZIA 4G2OX 2TDMA 3B5BA 3EHIX 1NJCA 1TVVA 4DPHA 4TMSA 1NJAA 3EJLA 3HJ3A 2TSRA 1FFLA 3EAWX 3HBBA 1J3KC 3CLBA 1BQ1A 1NJBA 4H0RA 4IRRA 4XSCA 4FOGA 1TSDA 1YPVA 5WRNA 3TMSA 1NJDA 1BSFA 3K2HA 2G8AA 2OIPA 3UM6A 3IK1A 5H38A 1TISA 3CL9A 3GG5A 3NRRA 4FGTA 2G8DA 4EILA 2G8XA 1I00A 1JTQA 1TJSA 1F4FA 3JSUA 1FWMA 1TYSA 1JUJA 1TDCA 1RTSA 3GH0A 3N5GA 2BBQA 3UWLA 3EDWX 3INVA 3IRMA 2G86A 4O1XA 4Q0EA 1TSZA 4DPDA 4O1XD 1VZDA 4ECKA 1EVGA 3BYXA 2KCEA 4GD7A 1BPJA 1BKOA 1NJEA 4E28A 1B5DA 2RD8B 3EGYX 1TDBA 4XSDA 3UWLB 4KPWA 5HS3A 3QJ7A 4UP1A 4FOAA 3EBUA 4EINA 3BHRA 4DQ1A 2VETA 4IQBA 3KJSA 1BKPA 1JMGA 3BZ0A 1VZCA 1JMHA 1BJGA 3KJRA 2AAZA 1AXWA 1JUTA 4LRRA 4KY4A 1LCBA 1CI7A 1F28A 5J7WA 1KCEA 1AN5A 3DG8C 4G6WX 1LCAA 1JG0A 4F2VA 1F4BA 1ZPRA 4DP3A 4XSEA 1TRGA 1J3IC 2A9WA 2FTNA 2RD8A 4IQQA 2H2QA 4KY8A 3DL5A 1VZEA 1BP0A
chains in the Genus database with same CATH topology
1DNAA 1JU6A 3ED7A 1TDAA 1NCEA 3H9KA 1AIQA 4FQSA 4EZ8A 2TDDA 1TSWA 1BP6A 4JEFA 3C06A 3IROA 3DGAC 1SYNA 1JTUA 1F4DA 1SEJA 1B02A 3IK0A 3IJZA 1BIDA 5H3AA 1TSXA 3IHIA 4PSGA 1VZAA 3B9HA 3UM5A 4GYHA 3IRNA 3QG2A 1J3JC 2RDAA 1EVFA 1JMFA 1DDUA 1HW3A 1TVWA 1BO8A 4FOXA 4ISWA 4KYAA 4O7UA 4ISKA 4H0UA 1QZFA 5H39A 1TSVA 1EV8A 1KZJA 5FCTA 1HW4A 1VZBA 1F4GA 3BHLA 1B49A 1JMIA 1TLCA 3BFIA 1AJMA 1BO7A 4O1UA 1TDUA 1TSLA 3QGTA 1F4CA 4H1IA 1EV5A 3UM8A 3N5EA 1TSYA 3HB8A 1TSMA 2FTQA 3C0AA 1THYA 3GH2X 3I3RA 1TVUA 1HVYA 2G89A 1HZWA 2TSCA 1TSNA 3OB7A 3V8HA 2FTOX 1B5EA 3DL6A 3BNZA 3IX6A 4KNZA 4GEVA 4Q0DA 1F4EA 3N5EB 5BY6A 1AOBA 1LCEA 1BDUA 3BGXA 3EF9A 2ONBA 3KGBA 1QQQA 2VF0A 1BSPA 4E5OA 4EB4A 1TLSA 1BQ2A 1KZIA 4G2OX 2TDMA 3B5BA 3EHIX 1NJCA 1TVVA 4DPHA 4TMSA 1NJAA 3EJLA 3HJ3A 2TSRA 1FFLA 3EAWX 3HBBA 1J3KC 3CLBA 1BQ1A 1NJBA 4H0RA 4IRRA 4XSCA 4FOGA 1TSDA 1YPVA 5WRNA 3TMSA 1NJDA 1BSFA 3K2HA 2G8AA 2OIPA 3UM6A 3IK1A 5H38A 1TISA 3CL9A 3GG5A 3NRRA 4FGTA 2G8DA 4EILA 2G8XA 1I00A 1JTQA 1TJSA 1F4FA 3JSUA 1FWMA 1TYSA 1JUJA 1TDCA 1RTSA 3GH0A 3N5GA 2BBQA 3UWLA 3EDWX 3INVA 3IRMA 2G86A 4O1XA 4Q0EA 1TSZA 4DPDA 4O1XD 1VZDA 4ECKA 1EVGA 3BYXA 2KCEA 4GD7A 1BPJA 1BKOA 1NJEA 4E28A 1B5DA 2RD8B 3EGYX 1TDBA 4XSDA 3UWLB 4KPWA 5HS3A 3QJ7A 4UP1A 4FOAA 3EBUA 4EINA 3BHRA 4DQ1A 2VETA 4IQBA 3KJSA 1BKPA 1JMGA 3BZ0A 1VZCA 1JMHA 1BJGA 3KJRA 2AAZA 1AXWA 1JUTA 4LRRA 4KY4A 1LCBA 1CI7A 1F28A 5J7WA 1KCEA 1AN5A 3DG8C 4G6WX 1LCAA 1JG0A 4F2VA 1F4BA 1ZPRA 4DP3A 4XSEA 1TRGA 1J3IC 2A9WA 2FTNA 2RD8A 4IQQA 2H2QA 4KY8A 3DL5A 1VZEA 1BP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DNA A;  1JU6 A;  3ED7 A;  1TDA A;  1NCE A;  3H9K A;  1AIQ A;  4FQS A;  4EZ8 A;  2TDD A;  1TSW A;  1BP6 A;  4JEF A;  3C06 A;  3IRO A;  3DGA C;  1SYN A;  1JTU A;  1F4D A;  1SEJ A;  1B02 A;  3IK0 A;  3IJZ A;  1BID A;  5H3A A;  1TSX A;  3IHI A;  4PSG A;  1VZA A;  3B9H A;  3UM5 A;  4GYH A;  3IRN A;  3QG2 A;  1J3J C;  2RDA A;  1EVF A;  1JMF A;  1DDU A;  1HW3 A;  1TVW A;  1BO8 A;  4FOX A;  4ISW A;  4KYA A;  4O7U A;  4ISK A;  4H0U A;  1QZF A;  5H39 A;  1TSV A;  1EV8 A;  1KZJ A;  5FCT A;  1HW4 A;  1VZB A;  1F4G A;  3BHL A;  1B49 A;  1JMI A;  1TLC A;  3BFI A;  1AJM A;  1BO7 A;  4O1U A;  1TDU A;  1TSL A;  3QGT A;  1F4C A;  4H1I A;  1EV5 A;  3UM8 A;  3N5E A;  1TSY A;  3HB8 A;  1TSM A;  2FTQ A;  3C0A A;  1THY A;  3GH2 X;  3I3R A;  1TVU A;  1HVY A;  2G89 A;  1HZW A;  2TSC A;  1TSN A;  3OB7 A;  3V8H A;  2FTO X;  1B5E A;  3DL6 A;  3BNZ A;  3IX6 A;  4KNZ A;  4GEV A;  4Q0D A;  1F4E A;  3N5E B;  5BY6 A;  1AOB A;  1LCE A;  1BDU A;  3BGX A;  3EF9 A;  2ONB A;  3KGB A;  1QQQ A;  2VF0 A;  1BSP A;  4E5O A;  4EB4 A;  1TLS A;  1BQ2 A;  1KZI A;  4G2O X;  2TDM A;  3B5B A;  3EHI X;  1NJC A;  1TVV A;  4DPH A;  4TMS A;  1NJA A;  3EJL A;  3HJ3 A;  2TSR A;  1FFL A;  3EAW X;  3HBB A;  1J3K C;  3CLB A;  1BQ1 A;  1NJB A;  4H0R A;  4IRR A;  4XSC A;  4FOG A;  1TSD A;  1YPV A;  5WRN A;  3TMS A;  1NJD A;  1BSF A;  3K2H A;  2G8A A;  2OIP A;  3UM6 A;  3IK1 A;  5H38 A;  1TIS A;  3CL9 A;  3GG5 A;  3NRR A;  4FGT A;  2G8D A;  4EIL A;  2G8X A;  1I00 A;  1JTQ A;  1TJS A;  1F4F A;  3JSU A;  1FWM A;  1TYS A;  1JUJ A;  1TDC A;  1RTS A;  3GH0 A;  3N5G A;  2BBQ A;  3UWL A;  3EDW X;  3INV A;  3IRM A;  2G86 A;  4O1X A;  4Q0E A;  1TSZ A;  4DPD A;  4O1X D;  1VZD A;  4ECK A;  1EVG A;  3BYX A;  2KCE A;  4GD7 A;  1BPJ A;  1BKO A;  1NJE A;  4E28 A;  1B5D A;  2RD8 B;  3EGY X;  1TDB A;  4XSD A;  3UWL B;  4KPW A;  5HS3 A;  3QJ7 A;  4UP1 A;  4FOA A;  3EBU A;  4EIN A;  3BHR A;  4DQ1 A;  2VET A;  4IQB A;  3KJS A;  1BKP A;  1JMG A;  3BZ0 A;  1VZC A;  1JMH A;  1BJG A;  3KJR A;  2AAZ A;  1AXW A;  1JUT A;  4LRR A;  4KY4 A;  1LCB A;  1CI7 A;  1F28 A;  5J7W A;  1KCE A;  1AN5 A;  3DG8 C;  4G6W X;  1LCA A;  1JG0 A;  4F2V A;  1F4B A;  1ZPR A;  4DP3 A;  4XSE A;  1TRG A;  1J3I C;  2A9W A;  2FTN A;  2RD8 A;  4IQQ A;  2H2Q A;  4KY8 A;  3DL5 A;  1VZE A;  1BP0 A; 
#chains in the Genus database with same CATH topology
 1DNA A;  1JU6 A;  3ED7 A;  1TDA A;  1NCE A;  3H9K A;  1AIQ A;  4FQS A;  4EZ8 A;  2TDD A;  1TSW A;  1BP6 A;  4JEF A;  3C06 A;  3IRO A;  3DGA C;  1SYN A;  1JTU A;  1F4D A;  1SEJ A;  1B02 A;  3IK0 A;  3IJZ A;  1BID A;  5H3A A;  1TSX A;  3IHI A;  4PSG A;  1VZA A;  3B9H A;  3UM5 A;  4GYH A;  3IRN A;  3QG2 A;  1J3J C;  2RDA A;  1EVF A;  1JMF A;  1DDU A;  1HW3 A;  1TVW A;  1BO8 A;  4FOX A;  4ISW A;  4KYA A;  4O7U A;  4ISK A;  4H0U A;  1QZF A;  5H39 A;  1TSV A;  1EV8 A;  1KZJ A;  5FCT A;  1HW4 A;  1VZB A;  1F4G A;  3BHL A;  1B49 A;  1JMI A;  1TLC A;  3BFI A;  1AJM A;  1BO7 A;  4O1U A;  1TDU A;  1TSL A;  3QGT A;  1F4C A;  4H1I A;  1EV5 A;  3UM8 A;  3N5E A;  1TSY A;  3HB8 A;  1TSM A;  2FTQ A;  3C0A A;  1THY A;  3GH2 X;  3I3R A;  1TVU A;  1HVY A;  2G89 A;  1HZW A;  2TSC A;  1TSN A;  3OB7 A;  3V8H A;  2FTO X;  1B5E A;  3DL6 A;  3BNZ A;  3IX6 A;  4KNZ A;  4GEV A;  4Q0D A;  1F4E A;  3N5E B;  5BY6 A;  1AOB A;  1LCE A;  1BDU A;  3BGX A;  3EF9 A;  2ONB A;  3KGB A;  1QQQ A;  2VF0 A;  1BSP A;  4E5O A;  4EB4 A;  1TLS A;  1BQ2 A;  1KZI A;  4G2O X;  2TDM A;  3B5B A;  3EHI X;  1NJC A;  1TVV A;  4DPH A;  4TMS A;  1NJA A;  3EJL A;  3HJ3 A;  2TSR A;  1FFL A;  3EAW X;  3HBB A;  1J3K C;  3CLB A;  1BQ1 A;  1NJB A;  4H0R A;  4IRR A;  4XSC A;  4FOG A;  1TSD A;  1YPV A;  5WRN A;  3TMS A;  1NJD A;  1BSF A;  3K2H A;  2G8A A;  2OIP A;  3UM6 A;  3IK1 A;  5H38 A;  1TIS A;  3CL9 A;  3GG5 A;  3NRR A;  4FGT A;  2G8D A;  4EIL A;  2G8X A;  1I00 A;  1JTQ A;  1TJS A;  1F4F A;  3JSU A;  1FWM A;  1TYS A;  1JUJ A;  1TDC A;  1RTS A;  3GH0 A;  3N5G A;  2BBQ A;  3UWL A;  3EDW X;  3INV A;  3IRM A;  2G86 A;  4O1X A;  4Q0E A;  1TSZ A;  4DPD A;  4O1X D;  1VZD A;  4ECK A;  1EVG A;  3BYX A;  2KCE A;  4GD7 A;  1BPJ A;  1BKO A;  1NJE A;  4E28 A;  1B5D A;  2RD8 B;  3EGY X;  1TDB A;  4XSD A;  3UWL B;  4KPW A;  5HS3 A;  3QJ7 A;  4UP1 A;  4FOA A;  3EBU A;  4EIN A;  3BHR A;  4DQ1 A;  2VET A;  4IQB A;  3KJS A;  1BKP A;  1JMG A;  3BZ0 A;  1VZC A;  1JMH A;  1BJG A;  3KJR A;  2AAZ A;  1AXW A;  1JUT A;  4LRR A;  4KY4 A;  1LCB A;  1CI7 A;  1F28 A;  5J7W A;  1KCE A;  1AN5 A;  3DG8 C;  4G6W X;  1LCA A;  1JG0 A;  4F2V A;  1F4B A;  1ZPR A;  4DP3 A;  4XSE A;  1TRG A;  1J3I C;  2A9W A;  2FTN A;  2RD8 A;  4IQQ A;  2H2Q A;  4KY8 A;  3DL5 A;  1VZE A;  1BP0 A; 
#chains in the Genus database with same CATH homology
 1DNA A;  1JU6 A;  3ED7 A;  1TDA A;  1NCE A;  3H9K A;  1AIQ A;  4FQS A;  4EZ8 A;  2TDD A;  1TSW A;  1BP6 A;  4JEF A;  3C06 A;  3IRO A;  3DGA C;  1SYN A;  1JTU A;  1F4D A;  1SEJ A;  1B02 A;  3IK0 A;  3IJZ A;  1BID A;  5H3A A;  1TSX A;  3IHI A;  4PSG A;  1VZA A;  3B9H A;  3UM5 A;  4GYH A;  3IRN A;  3QG2 A;  1J3J C;  2RDA A;  1EVF A;  1JMF A;  1DDU A;  1HW3 A;  1TVW A;  1BO8 A;  4FOX A;  4ISW A;  4KYA A;  4O7U A;  4ISK A;  4H0U A;  1QZF A;  5H39 A;  1TSV A;  1EV8 A;  1KZJ A;  5FCT A;  1HW4 A;  1VZB A;  1F4G A;  3BHL A;  1B49 A;  1JMI A;  1TLC A;  3BFI A;  1AJM A;  1BO7 A;  4O1U A;  1TDU A;  1TSL A;  3QGT A;  1F4C A;  4H1I A;  1EV5 A;  3UM8 A;  3N5E A;  1TSY A;  3HB8 A;  1TSM A;  2FTQ A;  3C0A A;  1THY A;  3GH2 X;  3I3R A;  1TVU A;  1HVY A;  2G89 A;  1HZW A;  2TSC A;  1TSN A;  3OB7 A;  3V8H A;  2FTO X;  1B5E A;  3DL6 A;  3BNZ A;  3IX6 A;  4KNZ A;  4GEV A;  4Q0D A;  1F4E A;  3N5E B;  5BY6 A;  1AOB A;  1LCE A;  1BDU A;  3BGX A;  3EF9 A;  2ONB A;  3KGB A;  1QQQ A;  2VF0 A;  1BSP A;  4E5O A;  4EB4 A;  1TLS A;  1BQ2 A;  1KZI A;  4G2O X;  2TDM A;  3B5B A;  3EHI X;  1NJC A;  1TVV A;  4DPH A;  4TMS A;  1NJA A;  3EJL A;  3HJ3 A;  2TSR A;  1FFL A;  3EAW X;  3HBB A;  1J3K C;  3CLB A;  1BQ1 A;  1NJB A;  4H0R A;  4IRR A;  4XSC A;  4FOG A;  1TSD A;  1YPV A;  5WRN A;  3TMS A;  1NJD A;  1BSF A;  3K2H A;  2G8A A;  2OIP A;  3UM6 A;  3IK1 A;  5H38 A;  1TIS A;  3CL9 A;  3GG5 A;  3NRR A;  4FGT A;  2G8D A;  4EIL A;  2G8X A;  1I00 A;  1JTQ A;  1TJS A;  1F4F A;  3JSU A;  1FWM A;  1TYS A;  1JUJ A;  1TDC A;  1RTS A;  3GH0 A;  3N5G A;  2BBQ A;  3UWL A;  3EDW X;  3INV A;  3IRM A;  2G86 A;  4O1X A;  4Q0E A;  1TSZ A;  4DPD A;  4O1X D;  1VZD A;  4ECK A;  1EVG A;  3BYX A;  2KCE A;  4GD7 A;  1BPJ A;  1BKO A;  1NJE A;  4E28 A;  1B5D A;  2RD8 B;  3EGY X;  1TDB A;  4XSD A;  3UWL B;  4KPW A;  5HS3 A;  3QJ7 A;  4UP1 A;  4FOA A;  3EBU A;  4EIN A;  3BHR A;  4DQ1 A;  2VET A;  4IQB A;  3KJS A;  1BKP A;  1JMG A;  3BZ0 A;  1VZC A;  1JMH A;  1BJG A;  3KJR A;  2AAZ A;  1AXW A;  1JUT A;  4LRR A;  4KY4 A;  1LCB A;  1CI7 A;  1F28 A;  5J7W A;  1KCE A;  1AN5 A;  3DG8 C;  4G6W X;  1LCA A;  1JG0 A;  4F2V A;  1F4B A;  1ZPR A;  4DP3 A;  4XSE A;  1TRG A;  1J3I C;  2A9W A;  2FTN A;  2RD8 A;  4IQQ A;  2H2Q A;  4KY8 A;  3DL5 A;  1VZE A;  1BP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...