1BK6A

Karyopherin alpha (yeast) + sv40 t antigen nls
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
422
structure length
422
Chain Sequence
LPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENIIKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIETYFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KARYOPHERIN ALPHA
publication title Crystallographic analysis of the recognition of a nuclear localization signal by the nuclear import factor karyopherin alpha.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Complex (protein transport/peptide)
total genus 165
structure length 422
sequence length 422
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00514 Arm Armadillo/beta-catenin-like repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 1bk6A00
4EVPA 4FZFA 4KZGA 2Z5OA 3C2HA 1XQRA 4BQKA 3BSBA 1EE5A 3K4EA 3BWTA 4DBAA 3W3UA 1W9CA 1JPWA 1EE4A 4H3HA 2OF3A 4FZAA 5SW9A 1TH1A 3K5YA 1IALA 4HTVA 1Q1SC 4MFVA 5BZ5A 4HM9A 2IX3A 5AEIA 4U5NA 4RZPA 4V3RA 3PSPA 3EG5B 3K7VA 2F31A 4U5SA 3QHEA 2NYLA 5LSWA 5KLRB 5E6QB 4U3JC 4V3QA 4JLQA 3ZIPA 3GVTA 3ZIRA 4DVGB 4PLQA 3O4XA 3UKWB 3UL0B 3WYFC 3ODRA 3OQSA 3OUWA 3TPOA 4U58A 5BZ1A 3IFQA 4DB8A 4UWXA 4CV5B 1IBRB 1BK6A 2IE3A 1V18A 4L7MA 2Z5MA 2Z5KA 4CB9A 2FV2A 2OT8A 4FQ3A 4FZDA 4CT6B 2X1GF 4K92A 1I7WA 3Q0SA 4RV1A 5EKFA 4U5UA 4ADYA 1UKLA 3ODSA 3H3DX 4I5NA 2BKUB 3L6XA 4UAFB 4CRVB 3C2GA 4FFBC 3LTMA 2GL7A 3DADA 1M5NS 3A6PA 3UVUA 3UL1B 2WTKA 3K5QA 2VGLB 3WPTA 2P8QA 4P6ZB 3OBVA 4E4VA 4YJEA 3ZKVA 1I7XA 1M1EA 4OIHA 3FEYC 4PLRA 2X19B 2C1MA 4Y5JA 4OO6A 3KNDA 3DW8A 5SVZA 4GMNA 5D5KC 3QMLC 3GNIA 4BA3A 4R0ZA 4I2ZA 1M8XA 5J3VA 4B18A 3FGAB 5KL8A 2PKGA 3ND2A 3VE6A 2YJYA 4TNMA 3ZINA 1M8YA 3NMXA 3LTJA 3NOWA 4U54A 3GQ2A 5EWPA 1M8WA 3K7WA 4QMJA 3L3QA 2Z6GA 3Q0NA 4EV8A 5H2WA 3WOYA 3GAEA 3GVOA 2IAEB 5HHGE 3V6YA 2VGLA 5DN7A 3NMWA 3QGBA 1EJYI 4HXTA 5CTTA 1M8ZA 3Q0QA 1QZ7A 3OPBA 1B3UA 2XA7A 3PSTA 1QBKB 1T08A 1U6GC 5KLTB 3QGCA 1WA5B 5BZVA 3IBVA 3EBBA 3L3FX 3C5WA 5FC8E 1UPLA 4LACA 3TPMA 3ZIQA 2Z5NA 1QGRA 3TT9A 3GS3A 3FGAA 2BAPA 1GCJA 5K6SA 3Q5UA 1PJNB 4ZDUA 1XQSA 4CT7B 3RZ9A 4QMHA 1Y2AC 3AU3A 1LUJA 1OYZA 1WA5C 3NMZA 1EJLI 3O2TA 3Q0OA 4U5OA 4CB8A 4EVTA 3V74A 4RXHB 4EV9A 3TJZB 3K64A 1BK5A 3EA5B 4QMIA 2IAEA 3GB8A 4DZSA 3UKYB 4JW2B 2Z5JA 2YNRA 3BX2A 3L6YA 4B8OA 4YGXA 2XA7B 1IQ1C 4EVAA 1QGKA 2JDQA 5EKGA 4UQIB 1O6OA 4IMIA 3TX7A 1Z2CB 2BNXA 4O27A 1G3JA 3BTRC 4DJSA 3O2QA 4YK6A 3T7UA 2Z6HA 2NYMA 4U5VA 4WV6A 2RU4B 2JAKA 4V3OA 5BZUA 4G3AA 2IW3A 4H3KA 4R11A 1W63A 4MFUA 5HUWC 4PVZA 3FEXC 3OUXA 4HNMA 4D49A 3TJ3A 4DB6A 4NEEA 2JKRA 4FDDA 1O6PA 3BSXA 2BCTA 3Q0PA 5SWFA 1JDHA 4B8JA 4YJLA 2JKTB 1IB2A 1JPPA 4MZ5E 1UN0A 2H4MA 4XZRB 5JJAA 4I2WA 4PLSA 1HO8A 3GRLA 2IE4A 3K61A 3Q0RA 4UQIA 4DB9A 2NPPB 4U5LA 4B8PA 3O2SA 1XM9A 2QNAA 4GMOA 1UPKA 4UAEA 2YNSA 4UADA 2RU4A 3UKZB 2NYMB 4I5LA 4K6JA 2W3CA 5KL1A 2C1TA 3K62A 4R10A 3BX3A 3Q0MA 3WOZA 3Q0LA 1LRVA 4CBAA 3K5ZA 4D4EA 4NZWA 5BYMA 3UKXB 3QG9A 3RZXA 3ZHPA 5HUYC 1W63B 5B56A 3ZIOA 3V71A 4BPLA 1Q1TC 5K9SA 4MZ6E 2QK1A 2Q5DA 4P6ZG 4IMJA 2JKRB 2JKTA 2QMRA 3LWWA 4A0CA 3K49A 4YI0C 5KLAA 3VWAA 2PF4A 2IWHA 4CRUB 5H2XA 2QK2A 2NYLB 3BCTA 1F59A 2NPPA 2DB0A 1PJMB
chains in the Genus database with same CATH superfamily
4EVPA 4FZFA 4KZGA 2Z5OA 3C2HA 1XQRA 4BQKA 3BSBA 1EE5A 3K4EA 3BWTA 4DBAA 3W3UA 1W9CA 5CLAA 1JPWA 1EE4A 4H3HA 2OF3A 4FZAA 5SW9A 1TH1A 3K5YA 3VLDA 1IALA 4HTVA 1Q1SC 4MFVA 5BZ5A 4HM9A 4A3VA 2IX3A 5AEIA 4U5NA 5CLBA 4RZPA 4V3RA 3PSPA 3EG5B 3K7VA 3UJ0A 2F31A 4I96A 4U5SA 3QHEA 5CLEA 2NYLA 3JX7A 5LSWA 5KLRB 5E6QB 4U3JC 4V3QA 4JLQA 3ZIPA 3GVTA 3ZIRA 4DVGB 4PLQA 3O4XA 3UKWB 3UL0B 3WYFC 3ODRA 3OQSA 3OUWA 3TPOA 4U58A 5BZ1A 3IFQA 4DB8A 4UWXA 4CV5B 1IBRB 1BK6A 2IE3A 1V18A 4L7MA 2Z5MA 2Z5KA 4CB9A 2FV2A 2OT8A 4FQ3A 4FZDA 4CT6B 2X1GF 4K92A 1I7WA 3Q0SA 4RV1A 5EKFA 4U5UA 4ADYA 3VLEA 1UKLA 3ODSA 3H3DX 3ZIKA 3SLAA 4I5NA 2BKUB 3L6XA 4UAFB 4I3NA 4CRVB 5CLCA 3C2GA 4FFBC 3LTMA 2GL7A 3DADA 1M5NS 3A6PA 3UVUA 3UL1B 2WTKA 5CL5A 4I0YA 3K5QA 2VGLB 3WPTA 2P8QA 4I7IA 3OBVA 4P6ZB 4E4VA 4YJEA 3ZKVA 1I7XA 4FP7A 1M1EA 4OIHA 3FEYC 4PLRA 2X19B 1LSHA 3JXYA 2C1MA 4Y5JA 4OO6A 3KNDA 3DW8A 5SVZA 4GMNA 4I37A 5D5KC 3QMLC 3GNIA 4BA3A 4R0ZA 4I2ZA 1M8XA 5CL7A 5J3VA 4B18A 3FGAB 4L4HA 5KL8A 2PKGA 3SL9A 4I2SA 3ND2A 3VE6A 5CL6A 2YJYA 4TNMA 3ZINA 1M8YA 3NMXA 3LTJA 3NOWA 4U54A 3GQ2A 5EWPA 1M8WA 5CL9A 3K7WA 4QMJA 3L3QA 2Z6GA 3Q0NA 4EV8A 5H2WA 3WOYA 3GAEA 3GVOA 2IAEB 5HHGE 3V6YA 2VGLA 5DN7A 3NMWA 3QGBA 1EJYI 4HXTA 5CTTA 1M8ZA 3Q0QA 1QZ7A 3OPBA 1B3UA 2XA7A 3PSTA 1QBKB 1T08A 1U6GC 5KLTB 3QGCA 1WA5B 5BZVA 3IBVA 4JW3C 3EBBA 3L3FX 3C5WA 3JY1A 5FC8E 1UPLA 3JXZA 4LACA 3TPMA 3ZIQA 2Z5NA 1QGRA 3TT9A 5CL3A 3GS3A 3FGAA 4I6IA 2BAPA 1GCJA 5K6SA 3Q5UA 1PJNB 4ZDUA 1XQSA 4CT7B 3RZ9A 4QMHA 1Y2AC 3T8SA 3AU3A 1LUJA 1OYZA 3ZILA 1WA5C 3NMZA 1EJLI 3O2TA 3Q0OA 4U5OA 4CB8A 4EVTA 3V74A 4RXHB 4EV9A 3TJZB 3K64A 1BK5A 3EA5B 4QMIA 2IAEA 5CLDA 3GB8A 4DZSA 1N4KA 3UKYB 4JW2B 2Z5JA 2YNRA 3BX2A 3L6YA 4B8OA 3VLFA 4YGXA 2XA7B 1IQ1C 4EVAA 1QGKA 2JDQA 5EKGA 4UQIB 1O6OA 4IMIA 3TX7A 1Z2CB 2BNXA 4O27A 1G3JA 3BTRC 4DJSA 3O2QA 4YK6A 3T7UA 2Z6HA 2NYMA 4U5VA 4WV6A 2RU4B 2JAKA 4V3OA 4I8MA 5BZUA 4G3AA 2IW3A 3BVSA 4H3KA 4R11A 4L4IA 1W63A 4MFUA 5HUWC 4PVZA 2XOAA 3FEXC 3OUXA 3UJ4A 4HNMA 1TE4A 4D49A 3TJ3A 4DB6A 4NEEA 2JKRA 4FDDA 1O6PA 3BSXA 2BCTA 3Q0PA 5SWFA 1JDHA 4JW2A 4B8JA 4YJLA 2JKTB 1IB2A 1JPPA 4MZ5E 1UN0A 2H4MA 4XZRB 5JJAA 4I2WA 4PLSA 1HO8A 3GRLA 2IE4A 5CL4A 3K61A 3Q0RA 4UQIA 4DB9A 2NPPB 4U5LA 4B8PA 4JKQA 3O2SA 1XM9A 2QNAA 4GMOA 1UPKA 4U2XD 4UAEA 2YNSA 4UADA 2RU4A 3UKZB 2NYMB 4I5LA 4K6JA 2W3CA 5KL1A 2C1TA 3K62A 4I1EA 4R10A 3BX3A 3Q0MA 3WOZA 3Q0LA 5KUBA 1LRVA 4CBAA 3K5ZA 4D4EA 4NZWA 5BYMA 3UKXB 3QG9A 3RZXA 3ZHPA 5HUYC 1W63B 5B56A 3ZIOA 3V71A 4BPLA 1Q1TC 5K9SA 4MZ6E 2QK1A 2Q5DA 4P6ZG 4IMJA 2JKRB 2JKTA 2QMRA 3LWWA 4A0CA 3K49A 4YI0C 5KLAA 3VWAA 2PF4A 2IWHA 4CRUB 4A3TA 5H2XA 5CL8A 2QK2A 2NYLB 3BCTA 1F59A 2NPPA 2DB0A 1PJMB
chains in the Genus database with same CATH topology
4EVPA 4FZFA 4KZGA 2Z5OA 3C2HA 1XQRA 4BQKA 3BSBA 1EE5A 3K4EA 3BWTA 4DBAA 3W3UA 1W9CA 5CLAA 1JPWA 1EE4A 4H3HA 2OF3A 4FZAA 5SW9A 1TH1A 3K5YA 3VLDA 1IALA 4HTVA 1Q1SC 4MFVA 5BZ5A 4HM9A 4A3VA 2IX3A 5AEIA 4U5NA 5CLBA 4RZPA 4V3RA 3PSPA 3EG5B 3K7VA 2F31A 4I96A 4U5SA 3QHEA 5CLEA 2NYLA 3JX7A 5LSWA 5KLRB 5E6QB 4U3JC 4V3QA 4JLQA 3ZIPA 3GVTA 3ZIRA 4DVGB 4PLQA 3O4XA 3UKWB 3UL0B 3WYFC 3ODRA 3OQSA 3OUWA 3TPOA 4U58A 5BZ1A 3IFQA 4DB8A 4UWXA 4CV5B 1IBRB 1BK6A 2IE3A 1V18A 4L7MA 2Z5MA 2Z5KA 4CB9A 2FV2A 2OT8A 4FQ3A 4FZDA 4CT6B 2X1GF 4K92A 1I7WA 3Q0SA 4RV1A 5EKFA 4U5UA 4ADYA 3VLEA 1UKLA 3ODSA 3H3DX 3ZIKA 3SLAA 4I5NA 2BKUB 3L6XA 4UAFB 4I3NA 4CRVB 5CLCA 3C2GA 4FFBC 3LTMA 2GL7A 3DADA 1M5NS 3A6PA 3UVUA 3UL1B 2WTKA 5CL5A 4I0YA 3K5QA 2VGLB 3WPTA 2P8QA 4I7IA 3OBVA 4P6ZB 4E4VA 4YJEA 3ZKVA 1I7XA 4FP7A 1M1EA 4OIHA 3FEYC 4PLRA 2X19B 3JXYA 2C1MA 4Y5JA 4OO6A 3KNDA 3DW8A 5SVZA 4GMNA 4I37A 5D5KC 3QMLC 3GNIA 4BA3A 4R0ZA 4I2ZA 1M8XA 5CL7A 5J3VA 4B18A 3FGAB 4L4HA 5KL8A 2PKGA 3SL9A 4I2SA 3ND2A 3VE6A 5CL6A 2YJYA 4TNMA 3ZINA 1M8YA 3NMXA 3LTJA 3NOWA 4U54A 3GQ2A 5EWPA 1M8WA 5CL9A 3K7WA 4QMJA 3L3QA 2Z6GA 3Q0NA 4EV8A 5H2WA 3WOYA 3GAEA 3GVOA 2IAEB 5HHGE 3V6YA 2VGLA 5DN7A 3NMWA 3QGBA 1EJYI 4HXTA 5CTTA 1M8ZA 3Q0QA 1QZ7A 3OPBA 1B3UA 2XA7A 3PSTA 1QBKB 1T08A 1U6GC 5KLTB 3QGCA 1WA5B 5BZVA 3IBVA 4JW3C 3EBBA 3L3FX 3C5WA 3JY1A 5FC8E 1UPLA 3JXZA 4LACA 3TPMA 3ZIQA 2Z5NA 1QGRA 3TT9A 5CL3A 3GS3A 3FGAA 4I6IA 2BAPA 1GCJA 5K6SA 3Q5UA 1PJNB 4ZDUA 1XQSA 4CT7B 3RZ9A 4QMHA 1Y2AC 3AU3A 1LUJA 1OYZA 3ZILA 1WA5C 3NMZA 1EJLI 3O2TA 3Q0OA 4U5OA 4CB8A 4EVTA 3V74A 4RXHB 4EV9A 3TJZB 3K64A 1BK5A 3EA5B 4QMIA 2IAEA 5CLDA 3GB8A 4DZSA 3UKYB 4JW2B 2Z5JA 2YNRA 3BX2A 3L6YA 4B8OA 3VLFA 4YGXA 2XA7B 1IQ1C 4EVAA 1QGKA 2JDQA 5EKGA 4UQIB 1O6OA 4IMIA 3TX7A 1Z2CB 2BNXA 4O27A 1G3JA 3BTRC 4DJSA 3O2QA 4YK6A 3T7UA 2Z6HA 2NYMA 4U5VA 4WV6A 2RU4B 2JAKA 4V3OA 4I8MA 5BZUA 4G3AA 2IW3A 3BVSA 4H3KA 4R11A 4L4IA 1W63A 4MFUA 5HUWC 4PVZA 2XOAA 3FEXC 3OUXA 4HNMA 1TE4A 4D49A 3TJ3A 4DB6A 4NEEA 2JKRA 4FDDA 1O6PA 3BSXA 2BCTA 3Q0PA 5SWFA 1JDHA 4JW2A 4B8JA 4YJLA 2JKTB 1IB2A 1JPPA 4MZ5E 1UN0A 2H4MA 4XZRB 5JJAA 4I2WA 4PLSA 1HO8A 3GRLA 2IE4A 5CL4A 3K61A 3Q0RA 4UQIA 4DB9A 2NPPB 4U5LA 4B8PA 4JKQA 3O2SA 1XM9A 2QNAA 4GMOA 1UPKA 4U2XD 4UAEA 2YNSA 4UADA 2RU4A 3UKZB 2NYMB 4I5LA 4K6JA 2W3CA 5KL1A 2C1TA 3K62A 4I1EA 4R10A 3BX3A 3Q0MA 3WOZA 3Q0LA 5KUBA 1LRVA 4CBAA 3K5ZA 4D4EA 4NZWA 5BYMA 3UKXB 3QG9A 3RZXA 3ZHPA 5HUYC 1W63B 5B56A 3ZIOA 3V71A 4BPLA 1Q1TC 5K9SA 4MZ6E 2QK1A 2Q5DA 4P6ZG 4IMJA 2JKRB 2JKTA 2QMRA 3LWWA 4A0CA 3K49A 4YI0C 5KLAA 3VWAA 2PF4A 2IWHA 4CRUB 4A3TA 5H2XA 5CL8A 2QK2A 2NYLB 3BCTA 1F59A 2NPPA 2DB0A 1PJMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EVP A;  4FZF A;  4KZG A;  2Z5O A;  3C2H A;  1XQR A;  4BQK A;  3BSB A;  1EE5 A;  3K4E A;  3BWT A;  4DBA A;  3W3U A;  1W9C A;  1JPW A;  1EE4 A;  4H3H A;  2OF3 A;  4FZA A;  5SW9 A;  1TH1 A;  3K5Y A;  1IAL A;  4HTV A;  1Q1S C;  4MFV A;  5BZ5 A;  4HM9 A;  2IX3 A;  5AEI A;  4U5N A;  4RZP A;  4V3R A;  3PSP A;  3EG5 B;  3K7V A;  2F31 A;  4U5S A;  3QHE A;  2NYL A;  5LSW A;  5KLR B;  5E6Q B;  4U3J C;  4V3Q A;  4JLQ A;  3ZIP A;  3GVT A;  3ZIR A;  4DVG B;  4PLQ A;  3O4X A;  3UKW B;  3UL0 B;  3WYF C;  3ODR A;  3OQS A;  3OUW A;  3TPO A;  4U58 A;  5BZ1 A;  3IFQ A;  4DB8 A;  4UWX A;  4CV5 B;  1IBR B;  1BK6 A;  2IE3 A;  1V18 A;  4L7M A;  2Z5M A;  2Z5K A;  4CB9 A;  2FV2 A;  2OT8 A;  4FQ3 A;  4FZD A;  4CT6 B;  2X1G F;  4K92 A;  1I7W A;  3Q0S A;  4RV1 A;  5EKF A;  4U5U A;  4ADY A;  1UKL A;  3ODS A;  3H3D X;  4I5N A;  2BKU B;  3L6X A;  4UAF B;  4CRV B;  3C2G A;  4FFB C;  3LTM A;  2GL7 A;  3DAD A;  1M5N S;  3A6P A;  3UVU A;  3UL1 B;  2WTK A;  3K5Q A;  2VGL B;  3WPT A;  2P8Q A;  4P6Z B;  3OBV A;  4E4V A;  4YJE A;  3ZKV A;  1I7X A;  1M1E A;  4OIH A;  3FEY C;  4PLR A;  2X19 B;  2C1M A;  4Y5J A;  4OO6 A;  3KND A;  3DW8 A;  5SVZ A;  4GMN A;  5D5K C;  3QML C;  3GNI A;  4BA3 A;  4R0Z A;  4I2Z A;  1M8X A;  5J3V A;  4B18 A;  3FGA B;  5KL8 A;  2PKG A;  3ND2 A;  3VE6 A;  2YJY A;  4TNM A;  3ZIN A;  1M8Y A;  3NMX A;  3LTJ A;  3NOW A;  4U54 A;  3GQ2 A;  5EWP A;  1M8W A;  3K7W A;  4QMJ A;  3L3Q A;  2Z6G A;  3Q0N A;  4EV8 A;  5H2W A;  3WOY A;  3GAE A;  3GVO A;  2IAE B;  5HHG E;  3V6Y A;  2VGL A;  5DN7 A;  3NMW A;  3QGB A;  1EJY I;  4HXT A;  5CTT A;  1M8Z A;  3Q0Q A;  1QZ7 A;  3OPB A;  1B3U A;  2XA7 A;  3PST A;  1QBK B;  1T08 A;  1U6G C;  5KLT B;  3QGC A;  1WA5 B;  5BZV A;  3IBV A;  3EBB A;  3L3F X;  3C5W A;  5FC8 E;  1UPL A;  4LAC A;  3TPM A;  3ZIQ A;  2Z5N A;  1QGR A;  3TT9 A;  3GS3 A;  3FGA A;  2BAP A;  1GCJ A;  5K6S A;  3Q5U A;  1PJN B;  4ZDU A;  1XQS A;  4CT7 B;  3RZ9 A;  4QMH A;  1Y2A C;  3AU3 A;  1LUJ A;  1OYZ A;  1WA5 C;  3NMZ A;  1EJL I;  3O2T A;  3Q0O A;  4U5O A;  4CB8 A;  4EVT A;  3V74 A;  4RXH B;  4EV9 A;  3TJZ B;  3K64 A;  1BK5 A;  3EA5 B;  4QMI A;  2IAE A;  3GB8 A;  4DZS A;  3UKY B;  4JW2 B;  2Z5J A;  2YNR A;  3BX2 A;  3L6Y A;  4B8O A;  4YGX A;  2XA7 B;  1IQ1 C;  4EVA A;  1QGK A;  2JDQ A;  5EKG A;  4UQI B;  1O6O A;  4IMI A;  3TX7 A;  1Z2C B;  2BNX A;  4O27 A;  1G3J A;  3BTR C;  4DJS A;  3O2Q A;  4YK6 A;  3T7U A;  2Z6H A;  2NYM A;  4U5V A;  4WV6 A;  2RU4 B;  2JAK A;  4V3O A;  5BZU A;  4G3A A;  2IW3 A;  4H3K A;  4R11 A;  1W63 A;  4MFU A;  5HUW C;  4PVZ A;  3FEX C;  3OUX A;  4HNM A;  4D49 A;  3TJ3 A;  4DB6 A;  4NEE A;  2JKR A;  4FDD A;  1O6P A;  3BSX A;  2BCT A;  3Q0P A;  5SWF A;  1JDH A;  4B8J A;  4YJL A;  2JKT B;  1IB2 A;  1JPP A;  4MZ5 E;  1UN0 A;  2H4M A;  4XZR B;  5JJA A;  4I2W A;  4PLS A;  1HO8 A;  3GRL A;  2IE4 A;  3K61 A;  3Q0R A;  4UQI A;  4DB9 A;  2NPP B;  4U5L A;  4B8P A;  3O2S A;  1XM9 A;  2QNA A;  4GMO A;  1UPK A;  4UAE A;  2YNS A;  4UAD A;  2RU4 A;  3UKZ B;  2NYM B;  4I5L A;  4K6J A;  2W3C A;  5KL1 A;  2C1T A;  3K62 A;  4R10 A;  3BX3 A;  3Q0M A;  3WOZ A;  3Q0L A;  1LRV A;  4CBA A;  3K5Z A;  4D4E A;  4NZW A;  5BYM A;  3UKX B;  3QG9 A;  3RZX A;  3ZHP A;  5HUY C;  1W63 B;  5B56 A;  3ZIO A;  3V71 A;  4BPL A;  1Q1T C;  5K9S A;  4MZ6 E;  2QK1 A;  2Q5D A;  4P6Z G;  4IMJ A;  2JKR B;  2JKT A;  2QMR A;  3LWW A;  4A0C A;  3K49 A;  4YI0 C;  5KLA A;  3VWA A;  2PF4 A;  2IWH A;  4CRU B;  5H2X A;  2QK2 A;  2NYL B;  3BCT A;  1F59 A;  2NPP A;  2DB0 A;  1PJM B; 
#chains in the Genus database with same CATH topology
 4EVP A;  4FZF A;  4KZG A;  2Z5O A;  3C2H A;  1XQR A;  4BQK A;  3BSB A;  1EE5 A;  3K4E A;  3BWT A;  4DBA A;  3W3U A;  1W9C A;  5CLA A;  1JPW A;  1EE4 A;  4H3H A;  2OF3 A;  4FZA A;  5SW9 A;  1TH1 A;  3K5Y A;  3VLD A;  1IAL A;  4HTV A;  1Q1S C;  4MFV A;  5BZ5 A;  4HM9 A;  4A3V A;  2IX3 A;  5AEI A;  4U5N A;  5CLB A;  4RZP A;  4V3R A;  3PSP A;  3EG5 B;  3K7V A;  3UJ0 A;  2F31 A;  4I96 A;  4U5S A;  3QHE A;  5CLE A;  2NYL A;  3JX7 A;  5LSW A;  5KLR B;  5E6Q B;  4U3J C;  4V3Q A;  4JLQ A;  3ZIP A;  3GVT A;  3ZIR A;  4DVG B;  4PLQ A;  3O4X A;  3UKW B;  3UL0 B;  3WYF C;  3ODR A;  3OQS A;  3OUW A;  3TPO A;  4U58 A;  5BZ1 A;  3IFQ A;  4DB8 A;  4UWX A;  4CV5 B;  1IBR B;  1BK6 A;  2IE3 A;  1V18 A;  4L7M A;  2Z5M A;  2Z5K A;  4CB9 A;  2FV2 A;  2OT8 A;  4FQ3 A;  4FZD A;  4CT6 B;  2X1G F;  4K92 A;  1I7W A;  3Q0S A;  4RV1 A;  5EKF A;  4U5U A;  4ADY A;  3VLE A;  1UKL A;  3ODS A;  3H3D X;  3ZIK A;  3SLA A;  4I5N A;  2BKU B;  3L6X A;  4UAF B;  4I3N A;  4CRV B;  5CLC A;  3C2G A;  4FFB C;  3LTM A;  2GL7 A;  3DAD A;  1M5N S;  3A6P A;  3UVU A;  3UL1 B;  2WTK A;  5CL5 A;  4I0Y A;  3K5Q A;  2VGL B;  3WPT A;  2P8Q A;  4I7I A;  3OBV A;  4P6Z B;  4E4V A;  4YJE A;  3ZKV A;  1I7X A;  4FP7 A;  1M1E A;  4OIH A;  3FEY C;  4PLR A;  2X19 B;  1LSH A;  3JXY A;  2C1M A;  4Y5J A;  4OO6 A;  3KND A;  3DW8 A;  5SVZ A;  4GMN A;  4I37 A;  5D5K C;  3QML C;  3GNI A;  4BA3 A;  4R0Z A;  4I2Z A;  1M8X A;  5CL7 A;  5J3V A;  4B18 A;  3FGA B;  4L4H A;  5KL8 A;  2PKG A;  3SL9 A;  4I2S A;  3ND2 A;  3VE6 A;  5CL6 A;  2YJY A;  4TNM A;  3ZIN A;  1M8Y A;  3NMX A;  3LTJ A;  3NOW A;  4U54 A;  3GQ2 A;  5EWP A;  1M8W A;  5CL9 A;  3K7W A;  4QMJ A;  3L3Q A;  2Z6G A;  3Q0N A;  4EV8 A;  5H2W A;  3WOY A;  3GAE A;  3GVO A;  2IAE B;  5HHG E;  3V6Y A;  2VGL A;  5DN7 A;  3NMW A;  3QGB A;  1EJY I;  4HXT A;  5CTT A;  1M8Z A;  3Q0Q A;  1QZ7 A;  3OPB A;  1B3U A;  2XA7 A;  3PST A;  1QBK B;  1T08 A;  1U6G C;  5KLT B;  3QGC A;  1WA5 B;  5BZV A;  3IBV A;  4JW3 C;  3EBB A;  3L3F X;  3C5W A;  3JY1 A;  5FC8 E;  1UPL A;  3JXZ A;  4LAC A;  3TPM A;  3ZIQ A;  2Z5N A;  1QGR A;  3TT9 A;  5CL3 A;  3GS3 A;  3FGA A;  4I6I A;  2BAP A;  1GCJ A;  5K6S A;  3Q5U A;  1PJN B;  4ZDU A;  1XQS A;  4CT7 B;  3RZ9 A;  4QMH A;  1Y2A C;  3T8S A;  3AU3 A;  1LUJ A;  1OYZ A;  3ZIL A;  1WA5 C;  3NMZ A;  1EJL I;  3O2T A;  3Q0O A;  4U5O A;  4CB8 A;  4EVT A;  3V74 A;  4RXH B;  4EV9 A;  3TJZ B;  3K64 A;  1BK5 A;  3EA5 B;  4QMI A;  2IAE A;  5CLD A;  3GB8 A;  4DZS A;  1N4K A;  3UKY B;  4JW2 B;  2Z5J A;  2YNR A;  3BX2 A;  3L6Y A;  4B8O A;  3VLF A;  4YGX A;  2XA7 B;  1IQ1 C;  4EVA A;  1QGK A;  2JDQ A;  5EKG A;  4UQI B;  1O6O A;  4IMI A;  3TX7 A;  1Z2C B;  2BNX A;  4O27 A;  1G3J A;  3BTR C;  4DJS A;  3O2Q A;  4YK6 A;  3T7U A;  2Z6H A;  2NYM A;  4U5V A;  4WV6 A;  2RU4 B;  2JAK A;  4V3O A;  4I8M A;  5BZU A;  4G3A A;  2IW3 A;  3BVS A;  4H3K A;  4R11 A;  4L4I A;  1W63 A;  4MFU A;  5HUW C;  4PVZ A;  2XOA A;  3FEX C;  3OUX A;  3UJ4 A;  4HNM A;  1TE4 A;  4D49 A;  3TJ3 A;  4DB6 A;  4NEE A;  2JKR A;  4FDD A;  1O6P A;  3BSX A;  2BCT A;  3Q0P A;  5SWF A;  1JDH A;  4JW2 A;  4B8J A;  4YJL A;  2JKT B;  1IB2 A;  1JPP A;  4MZ5 E;  1UN0 A;  2H4M A;  4XZR B;  5JJA A;  4I2W A;  4PLS A;  1HO8 A;  3GRL A;  2IE4 A;  5CL4 A;  3K61 A;  3Q0R A;  4UQI A;  4DB9 A;  2NPP B;  4U5L A;  4B8P A;  4JKQ A;  3O2S A;  1XM9 A;  2QNA A;  4GMO A;  1UPK A;  4U2X D;  4UAE A;  2YNS A;  4UAD A;  2RU4 A;  3UKZ B;  2NYM B;  4I5L A;  4K6J A;  2W3C A;  5KL1 A;  2C1T A;  3K62 A;  4I1E A;  4R10 A;  3BX3 A;  3Q0M A;  3WOZ A;  3Q0L A;  5KUB A;  1LRV A;  4CBA A;  3K5Z A;  4D4E A;  4NZW A;  5BYM A;  3UKX B;  3QG9 A;  3RZX A;  3ZHP A;  5HUY C;  1W63 B;  5B56 A;  3ZIO A;  3V71 A;  4BPL A;  1Q1T C;  5K9S A;  4MZ6 E;  2QK1 A;  2Q5D A;  4P6Z G;  4IMJ A;  2JKR B;  2JKT A;  2QMR A;  3LWW A;  4A0C A;  3K49 A;  4YI0 C;  5KLA A;  3VWA A;  2PF4 A;  2IWH A;  4CRU B;  4A3T A;  5H2X A;  5CL8 A;  2QK2 A;  2NYL B;  3BCT A;  1F59 A;  2NPP A;  2DB0 A;  1PJM B; 
#chains in the Genus database with same CATH homology
 4EVP A;  4FZF A;  4KZG A;  2Z5O A;  3C2H A;  1XQR A;  4BQK A;  3BSB A;  1EE5 A;  3K4E A;  3BWT A;  4DBA A;  3W3U A;  1W9C A;  5CLA A;  1JPW A;  1EE4 A;  4H3H A;  2OF3 A;  4FZA A;  5SW9 A;  1TH1 A;  3K5Y A;  3VLD A;  1IAL A;  4HTV A;  1Q1S C;  4MFV A;  5BZ5 A;  4HM9 A;  4A3V A;  2IX3 A;  5AEI A;  4U5N A;  5CLB A;  4RZP A;  4V3R A;  3PSP A;  3EG5 B;  3K7V A;  2F31 A;  4I96 A;  4U5S A;  3QHE A;  5CLE A;  2NYL A;  3JX7 A;  5LSW A;  5KLR B;  5E6Q B;  4U3J C;  4V3Q A;  4JLQ A;  3ZIP A;  3GVT A;  3ZIR A;  4DVG B;  4PLQ A;  3O4X A;  3UKW B;  3UL0 B;  3WYF C;  3ODR A;  3OQS A;  3OUW A;  3TPO A;  4U58 A;  5BZ1 A;  3IFQ A;  4DB8 A;  4UWX A;  4CV5 B;  1IBR B;  1BK6 A;  2IE3 A;  1V18 A;  4L7M A;  2Z5M A;  2Z5K A;  4CB9 A;  2FV2 A;  2OT8 A;  4FQ3 A;  4FZD A;  4CT6 B;  2X1G F;  4K92 A;  1I7W A;  3Q0S A;  4RV1 A;  5EKF A;  4U5U A;  4ADY A;  3VLE A;  1UKL A;  3ODS A;  3H3D X;  3ZIK A;  3SLA A;  4I5N A;  2BKU B;  3L6X A;  4UAF B;  4I3N A;  4CRV B;  5CLC A;  3C2G A;  4FFB C;  3LTM A;  2GL7 A;  3DAD A;  1M5N S;  3A6P A;  3UVU A;  3UL1 B;  2WTK A;  5CL5 A;  4I0Y A;  3K5Q A;  2VGL B;  3WPT A;  2P8Q A;  4I7I A;  3OBV A;  4P6Z B;  4E4V A;  4YJE A;  3ZKV A;  1I7X A;  4FP7 A;  1M1E A;  4OIH A;  3FEY C;  4PLR A;  2X19 B;  3JXY A;  2C1M A;  4Y5J A;  4OO6 A;  3KND A;  3DW8 A;  5SVZ A;  4GMN A;  4I37 A;  5D5K C;  3QML C;  3GNI A;  4BA3 A;  4R0Z A;  4I2Z A;  1M8X A;  5CL7 A;  5J3V A;  4B18 A;  3FGA B;  4L4H A;  5KL8 A;  2PKG A;  3SL9 A;  4I2S A;  3ND2 A;  3VE6 A;  5CL6 A;  2YJY A;  4TNM A;  3ZIN A;  1M8Y A;  3NMX A;  3LTJ A;  3NOW A;  4U54 A;  3GQ2 A;  5EWP A;  1M8W A;  5CL9 A;  3K7W A;  4QMJ A;  3L3Q A;  2Z6G A;  3Q0N A;  4EV8 A;  5H2W A;  3WOY A;  3GAE A;  3GVO A;  2IAE B;  5HHG E;  3V6Y A;  2VGL A;  5DN7 A;  3NMW A;  3QGB A;  1EJY I;  4HXT A;  5CTT A;  1M8Z A;  3Q0Q A;  1QZ7 A;  3OPB A;  1B3U A;  2XA7 A;  3PST A;  1QBK B;  1T08 A;  1U6G C;  5KLT B;  3QGC A;  1WA5 B;  5BZV A;  3IBV A;  4JW3 C;  3EBB A;  3L3F X;  3C5W A;  3JY1 A;  5FC8 E;  1UPL A;  3JXZ A;  4LAC A;  3TPM A;  3ZIQ A;  2Z5N A;  1QGR A;  3TT9 A;  5CL3 A;  3GS3 A;  3FGA A;  4I6I A;  2BAP A;  1GCJ A;  5K6S A;  3Q5U A;  1PJN B;  4ZDU A;  1XQS A;  4CT7 B;  3RZ9 A;  4QMH A;  1Y2A C;  3AU3 A;  1LUJ A;  1OYZ A;  3ZIL A;  1WA5 C;  3NMZ A;  1EJL I;  3O2T A;  3Q0O A;  4U5O A;  4CB8 A;  4EVT A;  3V74 A;  4RXH B;  4EV9 A;  3TJZ B;  3K64 A;  1BK5 A;  3EA5 B;  4QMI A;  2IAE A;  5CLD A;  3GB8 A;  4DZS A;  3UKY B;  4JW2 B;  2Z5J A;  2YNR A;  3BX2 A;  3L6Y A;  4B8O A;  3VLF A;  4YGX A;  2XA7 B;  1IQ1 C;  4EVA A;  1QGK A;  2JDQ A;  5EKG A;  4UQI B;  1O6O A;  4IMI A;  3TX7 A;  1Z2C B;  2BNX A;  4O27 A;  1G3J A;  3BTR C;  4DJS A;  3O2Q A;  4YK6 A;  3T7U A;  2Z6H A;  2NYM A;  4U5V A;  4WV6 A;  2RU4 B;  2JAK A;  4V3O A;  4I8M A;  5BZU A;  4G3A A;  2IW3 A;  3BVS A;  4H3K A;  4R11 A;  4L4I A;  1W63 A;  4MFU A;  5HUW C;  4PVZ A;  2XOA A;  3FEX C;  3OUX A;  4HNM A;  1TE4 A;  4D49 A;  3TJ3 A;  4DB6 A;  4NEE A;  2JKR A;  4FDD A;  1O6P A;  3BSX A;  2BCT A;  3Q0P A;  5SWF A;  1JDH A;  4JW2 A;  4B8J A;  4YJL A;  2JKT B;  1IB2 A;  1JPP A;  4MZ5 E;  1UN0 A;  2H4M A;  4XZR B;  5JJA A;  4I2W A;  4PLS A;  1HO8 A;  3GRL A;  2IE4 A;  5CL4 A;  3K61 A;  3Q0R A;  4UQI A;  4DB9 A;  2NPP B;  4U5L A;  4B8P A;  4JKQ A;  3O2S A;  1XM9 A;  2QNA A;  4GMO A;  1UPK A;  4U2X D;  4UAE A;  2YNS A;  4UAD A;  2RU4 A;  3UKZ B;  2NYM B;  4I5L A;  4K6J A;  2W3C A;  5KL1 A;  2C1T A;  3K62 A;  4I1E A;  4R10 A;  3BX3 A;  3Q0M A;  3WOZ A;  3Q0L A;  5KUB A;  1LRV A;  4CBA A;  3K5Z A;  4D4E A;  4NZW A;  5BYM A;  3UKX B;  3QG9 A;  3RZX A;  3ZHP A;  5HUY C;  1W63 B;  5B56 A;  3ZIO A;  3V71 A;  4BPL A;  1Q1T C;  5K9S A;  4MZ6 E;  2QK1 A;  2Q5D A;  4P6Z G;  4IMJ A;  2JKR B;  2JKT A;  2QMR A;  3LWW A;  4A0C A;  3K49 A;  4YI0 C;  5KLA A;  3VWA A;  2PF4 A;  2IWH A;  4CRU B;  4A3T A;  5H2X A;  5CL8 A;  2QK2 A;  2NYL B;  3BCT A;  1F59 A;  2NPP A;  2DB0 A;  1PJM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...