1BK6A

Karyopherin alpha (yeast) + sv40 t antigen nls
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
422
structure length
422
Chain Sequence
LPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENIIKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIETYFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of the recognition of a nuclear localization signal by the nuclear import factor karyopherin alpha.
pubmed doi rcsb
molecule keywords KARYOPHERIN ALPHA
molecule tags Complex (protein transport/peptide)
source organism Saccharomyces cerevisiae
total genus 165
structure length 422
sequence length 422
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00514 Arm Armadillo/beta-catenin-like repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 1bk6A00
1JPPA 3K5QA 4UAFB 3A6PA 3PSTA 4JW2B 5BZUA 1O6OA 4EVTA 3QG9A 4P6ZG 3TX7A 4HTVA 5CTTA 2OF3A 1IQ1C 3UL0B 3UKZB 3WOYA 1IB2A 4B8PA 5EWPA 1LRVA 3EBBA 1M8YA 3BCTA 4I5NA 1M8ZA 1BK5A 2IWHA 1JDHA 5BYMA 2BKUB 1QZ7A 3TJZB 1U6GC 4DJSA 2RU4B 3V71A 4BQKA 2QK1A 4PVZA 4EVAA 2P8QA 3FGAB 4PLSA 3OBVA 3QHEA 3O2QA 4V3QA 4UQIB 2IE3A 1EJYI 3OPBA 5HHGE 3GQ2A 5BZ1A 2Z6GA 2QNAA 3DADA 4OO6A 5SWFA 2X1GF 2NYMA 3PSPA 5K6SA 3NMWA 2Z5MA 3IBVA 3GRLA 2FV2A 5BZVA 3BWTA 3AU3A 4DBAA 4O27A 1LUJA 4CRVB 2H4MA 3EA5B 2C1TA 4HM9A 4RZPA 4ADYA 4KZGA 5EKFA 4U58A 4FZDA 1M8XA 3O2TA 3K5ZA 4QMIA 4CT7B 3ZHPA 1EE5A 1UKLA 3C2HA 2NYLA 4HNMA 4IMJA 1O6PA 3H3DX 1BK6A 2IW3A 3VWAA 3K7WA 4EV9A 1UN0A 1WA5C 3WYFC 1M5NS 2NYMB 3WOZA 3BSXA 3GAEA 4R0ZA 5HUWC 4YK6A 1GCJA 2QK2A 2IX3A 1W63A 4CB9A 3GVOA 1Q1SC 4K92A 2X19B 1XQSA 1QBKB 3K4EA 5BZ5A 3BTRC 4P6ZB 3Q0PA 4R11A 5KLTB 3ZIQA 1OYZA 4XZRB 3T7UA 5B56A 4DB9A 2YNRA 3K7VA 2Z5NA 4B18A 1G3JA 3O4XA 4DB8A 3VE6A 2JKTB 4HXTA 4E4VA 3NOWA 4RXHB 4B8JA 3Q0OA 3TPOA 2OT8A 4YJEA 4Y5JA 2IAEA 4UWXA 3NMXA 4UADA 4QMHA 5D5KC 1W63B 4FFBC 2BNXA 3UKXB 3LTJA 3RZXA 5E6QB 2DB0A 4LACA 4U5SA 3BX3A 3EG5B 3Q0RA 1Z2CB 5HUYC 2VGLA 5K9SA 3K61A 3L3FX 4EVPA 5SVZA 2XA7A 4K6JA 5KL1A 3FEYC 1M8WA 1I7WA 2JKRA 2PF4A 4D49A 3K64A 3UVUA 2NPPA 1QGRA 4B8OA 4IMIA 3L3QA 4I2ZA 2QMRA 4YJLA 2YJYA 4U3JC 1UPLA 2BCTA 4ZDUA 2F31A 1EE4A 4DVGB 4MZ6E 4CB8A 4PLRA 3LWWA 3O2SA 4FZAA 4A0CA 1TH1A 4U5VA 4U5NA 5J3VA 4MFUA 3Q0LA 5LSWA 2VGLB 5H2XA 4DZSA 1M1EA 4GMOA 1Q1TC 2XA7B 3GVTA 1WA5B 5EKGA 3LTMA 3ZIPA 1QGKA 4UAEA 3GS3A 5KLAA 4H3KA 3FGAA 2Z5KA 4H3HA 2IE4A 1IALA 2NPPB 1B3UA 3GB8A 3IFQA 3ODRA 1XM9A 1UPKA 2JDQA 5JJAA 2W3CA 3QMLC 3Q0QA 3QGBA 3TT9A 3FEXC 3DW8A 2NYLB 3C5WA 4FDDA 3Q5UA 3ODSA 3OUXA 4QMJA 4FZFA 3QGCA 2PKGA 1JPWA 2Z6HA 4I2WA 4CT6B 3UKYB 1T08A 4MFVA 4U5OA 3V6YA 5KL8A 3BSBA 4U5UA 2Q5DA 1IBRB 4NEEA 4YI0C 4U5LA 4BA3A 4L7MA 1PJMB 4CV5B 3BX2A 3C2GA 3K49A 3OUWA 3ZIRA 5SW9A 1Y2AC 4FQ3A 2GL7A 4JLQA 4R10A 4G3AA 2Z5OA 1XQRA 3K62A 3TJ3A 4WV6A 3WPTA 5DN7A 3ND2A 1EJLI 4GMNA 4YGXA 4RV1A 4CRUB 4DB6A 3KNDA 4EV8A 3UL1B 2YNSA 1V18A 3RZ9A 4CBAA 5AEIA 3ZINA 3TPMA 3ZKVA 2WTKA 2IAEB 3UKWB 1W9CA 4I5LA 3Q0MA 4MZ5E 1F59A 3V74A 3L6XA 2C1MA 2BAPA 3ZIOA 4PLQA 1PJNB 4V3RA 4V3OA 4D4EA 4NZWA 3L6YA 4BPLA 1HO8A 2JAKA 3OQSA 3K5YA 5KLRB 2JKTA 2Z5JA 2RU4A 3W3UA 3NMZA 4U54A 1I7XA 3GNIA 2JKRB 5H2WA 4TNMA 4OIHA 3Q0SA 3Q0NA 5FC8E 4UQIA
chains in the Genus database with same CATH superfamily
1JPPA 3K5QA 4UAFB 3A6PA 3PSTA 4JW2B 5BZUA 1O6OA 4EVTA 3QG9A 4P6ZG 3TX7A 4HTVA 5CTTA 2OF3A 4I6IA 1IQ1C 3UL0B 3UKZB 3WOYA 1IB2A 4B8PA 5EWPA 1LRVA 4I7IA 3EBBA 1M8YA 3BCTA 4I5NA 1M8ZA 1BK5A 2IWHA 1JDHA 5BYMA 2BKUB 1QZ7A 3TJZB 1U6GC 4DJSA 2RU4B 3V71A 4BQKA 2QK1A 4PVZA 4EVAA 5CL9A 2P8QA 3BVSA 3FGAB 4I37A 3OBVA 4PLSA 3QHEA 3O2QA 4V3QA 4UQIB 2IE3A 1EJYI 3OPBA 5HHGE 3GQ2A 5BZ1A 4L4IA 2Z6GA 4JKQA 2QNAA 3DADA 4OO6A 5SWFA 2X1GF 2NYMA 3PSPA 5K6SA 3NMWA 2Z5MA 3ZILA 3IBVA 3GRLA 2FV2A 5BZVA 3BWTA 3AU3A 4DBAA 4O27A 1LUJA 4CRVB 2H4MA 3EA5B 2C1TA 4HM9A 4RZPA 4ADYA 4KZGA 5EKFA 4U58A 4FZDA 1M8XA 3O2TA 3K5ZA 4QMIA 4CT7B 3ZHPA 1EE5A 5CL7A 1UKLA 3C2HA 2NYLA 4HNMA 4IMJA 1O6PA 3H3DX 1BK6A 2IW3A 3VWAA 4U2XD 3K7WA 4EV9A 1UN0A 1WA5C 3WYFC 1M5NS 2NYMB 3WOZA 3BSXA 3GAEA 4R0ZA 5HUWC 4YK6A 1GCJA 2QK2A 2IX3A 1W63A 4CB9A 3GVOA 1Q1SC 3VLEA 4I96A 4K92A 2X19B 1XQSA 1QBKB 3K4EA 5BZ5A 3BTRC 4P6ZB 3Q0PA 4JW3C 4R11A 5KLTB 3ZIQA 1OYZA 4XZRB 3SLAA 5CLCA 3T7UA 5B56A 4DB9A 2YNRA 4I0YA 3K7VA 2Z5NA 4B18A 1G3JA 3O4XA 4DB8A 3VE6A 2JKTB 1LSHA 4HXTA 4E4VA 3NOWA 4RXHB 4B8JA 3Q0OA 3TPOA 4FP7A 1N4KA 2OT8A 4YJEA 3JXZA 4Y5JA 2IAEA 4UWXA 5CL3A 3NMXA 5CLDA 4UADA 4QMHA 5CLAA 5D5KC 1W63B 4FFBC 2BNXA 3UKXB 3LTJA 3RZXA 5E6QB 2DB0A 4LACA 4U5SA 3BX3A 3EG5B 3Q0RA 1Z2CB 3UJ0A 5HUYC 2VGLA 3JX7A 5K9SA 3K61A 3L3FX 4EVPA 5SVZA 1TE4A 2XA7A 4K6JA 5CL6A 5KL1A 3FEYC 1M8WA 1I7WA 2JKRA 2PF4A 4D49A 3K64A 3UVUA 2NPPA 1QGRA 3VLDA 4B8OA 4IMIA 3L3QA 4I2ZA 2QMRA 4YJLA 4I3NA 2YJYA 4U3JC 1UPLA 2BCTA 4ZDUA 2F31A 1EE4A 4DVGB 4MZ6E 4CB8A 4PLRA 3LWWA 3O2SA 4FZAA 4A0CA 1TH1A 4U5VA 4U5NA 5J3VA 4MFUA 3Q0LA 5LSWA 2VGLB 5H2XA 4DZSA 1M1EA 4GMOA 1Q1TC 2XA7B 3GVTA 4I1EA 1WA5B 5EKGA 3LTMA 4I8MA 3ZIPA 1QGKA 4UAEA 3GS3A 5KLAA 3JY1A 4H3KA 3FGAA 2Z5KA 4H3HA 2IE4A 1IALA 2NPPB 1B3UA 3GB8A 3IFQA 3ODRA 1XM9A 1UPKA 3UJ4A 2JDQA 5JJAA 2W3CA 3QMLC 3Q0QA 3QGBA 3TT9A 3FEXC 3JXYA 3DW8A 2NYLB 4L4HA 3C5WA 4FDDA 3Q5UA 3ODSA 3OUXA 4QMJA 3VLFA 5CL5A 4FZFA 3QGCA 2PKGA 1JPWA 2Z6HA 4I2WA 4CT6B 3UKYB 1T08A 4MFVA 4U5OA 3V6YA 5KL8A 5CL8A 3BSBA 5CLBA 4U5UA 2Q5DA 1IBRB 4NEEA 4YI0C 4U5LA 4BA3A 4L7MA 1PJMB 4A3VA 3SL9A 4CV5B 3BX2A 3C2GA 3K49A 3OUWA 3ZIRA 5SW9A 2XOAA 1Y2AC 5CLEA 4FQ3A 2GL7A 4JLQA 4R10A 4G3AA 2Z5OA 1XQRA 3K62A 3TJ3A 4WV6A 3WPTA 5DN7A 3ND2A 1EJLI 5CL4A 4GMNA 3T8SA 4YGXA 4RV1A 3ZIKA 4A3TA 4CRUB 4DB6A 3KNDA 4EV8A 3UL1B 2YNSA 1V18A 3RZ9A 4CBAA 5AEIA 3ZINA 3TPMA 3ZKVA 2WTKA 2IAEB 3UKWB 1W9CA 4I5LA 3Q0MA 4JW2A 4MZ5E 1F59A 3V74A 3L6XA 2C1MA 5KUBA 2BAPA 3ZIOA 4PLQA 1PJNB 4V3RA 4V3OA 4D4EA 4NZWA 3L6YA 4BPLA 1HO8A 2JAKA 3OQSA 3K5YA 5KLRB 2JKTA 2Z5JA 2RU4A 3W3UA 3NMZA 4U54A 1I7XA 3GNIA 2JKRB 5H2WA 4TNMA 4OIHA 4I2SA 3Q0SA 3Q0NA 5FC8E 4UQIA
chains in the Genus database with same CATH topology
1JPPA 3K5QA 4UAFB 3A6PA 3PSTA 4JW2B 5BZUA 1O6OA 4EVTA 3QG9A 4P6ZG 3TX7A 4HTVA 5CTTA 2OF3A 4I6IA 1IQ1C 3UL0B 3UKZB 3WOYA 1IB2A 4B8PA 5EWPA 1LRVA 4I7IA 3EBBA 1M8YA 3BCTA 4I5NA 1M8ZA 1BK5A 2IWHA 1JDHA 5BYMA 2BKUB 1QZ7A 3TJZB 1U6GC 4DJSA 2RU4B 3V71A 4BQKA 2QK1A 4PVZA 4EVAA 5CL9A 2P8QA 3BVSA 3FGAB 4I37A 3OBVA 4PLSA 3QHEA 3O2QA 4V3QA 4UQIB 2IE3A 1EJYI 3OPBA 5HHGE 3GQ2A 5BZ1A 4L4IA 2Z6GA 4JKQA 2QNAA 3DADA 4OO6A 5SWFA 2X1GF 2NYMA 3PSPA 5K6SA 3NMWA 2Z5MA 3ZILA 3IBVA 3GRLA 2FV2A 5BZVA 3BWTA 3AU3A 4DBAA 4O27A 1LUJA 4CRVB 2H4MA 3EA5B 2C1TA 4HM9A 4RZPA 4ADYA 4KZGA 5EKFA 4U58A 4FZDA 1M8XA 3O2TA 3K5ZA 4QMIA 4CT7B 3ZHPA 1EE5A 5CL7A 1UKLA 3C2HA 2NYLA 4HNMA 4IMJA 1O6PA 3H3DX 1BK6A 2IW3A 3VWAA 4U2XD 3K7WA 4EV9A 1UN0A 1WA5C 3WYFC 1M5NS 2NYMB 3WOZA 3BSXA 3GAEA 4R0ZA 5HUWC 4YK6A 1GCJA 2QK2A 2IX3A 1W63A 4CB9A 3GVOA 1Q1SC 3VLEA 4I96A 4K92A 2X19B 1XQSA 1QBKB 3K4EA 5BZ5A 3BTRC 4P6ZB 3Q0PA 4JW3C 4R11A 5KLTB 3ZIQA 1OYZA 4XZRB 3SLAA 5CLCA 3T7UA 5B56A 4DB9A 2YNRA 4I0YA 3K7VA 2Z5NA 4B18A 1G3JA 3O4XA 4DB8A 3VE6A 2JKTB 4HXTA 4E4VA 3NOWA 4RXHB 4B8JA 3Q0OA 3TPOA 4FP7A 2OT8A 4YJEA 3JXZA 4Y5JA 2IAEA 4UWXA 5CL3A 3NMXA 5CLDA 4UADA 4QMHA 5CLAA 5D5KC 1W63B 4FFBC 2BNXA 3UKXB 3LTJA 3RZXA 5E6QB 2DB0A 4LACA 4U5SA 3BX3A 3EG5B 3Q0RA 1Z2CB 5HUYC 2VGLA 3JX7A 5K9SA 3K61A 3L3FX 4EVPA 5SVZA 1TE4A 2XA7A 4K6JA 5CL6A 5KL1A 3FEYC 1M8WA 1I7WA 2JKRA 2PF4A 4D49A 3K64A 3UVUA 2NPPA 1QGRA 3VLDA 4B8OA 4IMIA 3L3QA 4I2ZA 2QMRA 4YJLA 4I3NA 2YJYA 4U3JC 1UPLA 2BCTA 4ZDUA 2F31A 1EE4A 4DVGB 4MZ6E 4CB8A 4PLRA 3LWWA 3O2SA 4FZAA 4A0CA 1TH1A 4U5VA 4U5NA 5J3VA 4MFUA 3Q0LA 5LSWA 2VGLB 5H2XA 4DZSA 1M1EA 4GMOA 1Q1TC 2XA7B 3GVTA 4I1EA 1WA5B 5EKGA 3LTMA 4I8MA 3ZIPA 1QGKA 4UAEA 3GS3A 5KLAA 3JY1A 4H3KA 3FGAA 2Z5KA 4H3HA 2IE4A 1IALA 2NPPB 1B3UA 3GB8A 3IFQA 3ODRA 1XM9A 1UPKA 2JDQA 5JJAA 2W3CA 3QMLC 3Q0QA 3QGBA 3TT9A 3FEXC 3JXYA 3DW8A 2NYLB 4L4HA 3C5WA 4FDDA 3Q5UA 3ODSA 3OUXA 4QMJA 3VLFA 5CL5A 4FZFA 3QGCA 2PKGA 1JPWA 2Z6HA 4I2WA 4CT6B 3UKYB 1T08A 4MFVA 4U5OA 3V6YA 5KL8A 5CL8A 3BSBA 5CLBA 4U5UA 2Q5DA 1IBRB 4NEEA 4YI0C 4U5LA 4BA3A 4L7MA 1PJMB 4A3VA 3SL9A 4CV5B 3BX2A 3C2GA 3K49A 3OUWA 3ZIRA 5SW9A 2XOAA 1Y2AC 5CLEA 4FQ3A 2GL7A 4JLQA 4R10A 4G3AA 2Z5OA 1XQRA 3K62A 3TJ3A 4WV6A 3WPTA 5DN7A 3ND2A 1EJLI 5CL4A 4GMNA 4YGXA 4RV1A 3ZIKA 4A3TA 4CRUB 4DB6A 3KNDA 4EV8A 3UL1B 2YNSA 1V18A 3RZ9A 4CBAA 5AEIA 3ZINA 3TPMA 3ZKVA 2WTKA 2IAEB 3UKWB 1W9CA 4I5LA 3Q0MA 4JW2A 4MZ5E 1F59A 3V74A 3L6XA 2C1MA 5KUBA 2BAPA 3ZIOA 4PLQA 1PJNB 4V3RA 4V3OA 4D4EA 4NZWA 3L6YA 4BPLA 1HO8A 2JAKA 3OQSA 3K5YA 5KLRB 2JKTA 2Z5JA 2RU4A 3W3UA 3NMZA 4U54A 1I7XA 3GNIA 2JKRB 5H2WA 4TNMA 4OIHA 4I2SA 3Q0SA 3Q0NA 5FC8E 4UQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JPP A;  3K5Q A;  4UAF B;  3A6P A;  3PST A;  4JW2 B;  5BZU A;  1O6O A;  4EVT A;  3QG9 A;  4P6Z G;  3TX7 A;  4HTV A;  5CTT A;  2OF3 A;  1IQ1 C;  3UL0 B;  3UKZ B;  3WOY A;  1IB2 A;  4B8P A;  5EWP A;  1LRV A;  3EBB A;  1M8Y A;  3BCT A;  4I5N A;  1M8Z A;  1BK5 A;  2IWH A;  1JDH A;  5BYM A;  2BKU B;  1QZ7 A;  3TJZ B;  1U6G C;  4DJS A;  2RU4 B;  3V71 A;  4BQK A;  2QK1 A;  4PVZ A;  4EVA A;  2P8Q A;  3FGA B;  4PLS A;  3OBV A;  3QHE A;  3O2Q A;  4V3Q A;  4UQI B;  2IE3 A;  1EJY I;  3OPB A;  5HHG E;  3GQ2 A;  5BZ1 A;  2Z6G A;  2QNA A;  3DAD A;  4OO6 A;  5SWF A;  2X1G F;  2NYM A;  3PSP A;  5K6S A;  3NMW A;  2Z5M A;  3IBV A;  3GRL A;  2FV2 A;  5BZV A;  3BWT A;  3AU3 A;  4DBA A;  4O27 A;  1LUJ A;  4CRV B;  2H4M A;  3EA5 B;  2C1T A;  4HM9 A;  4RZP A;  4ADY A;  4KZG A;  5EKF A;  4U58 A;  4FZD A;  1M8X A;  3O2T A;  3K5Z A;  4QMI A;  4CT7 B;  3ZHP A;  1EE5 A;  1UKL A;  3C2H A;  2NYL A;  4HNM A;  4IMJ A;  1O6P A;  3H3D X;  1BK6 A;  2IW3 A;  3VWA A;  3K7W A;  4EV9 A;  1UN0 A;  1WA5 C;  3WYF C;  1M5N S;  2NYM B;  3WOZ A;  3BSX A;  3GAE A;  4R0Z A;  5HUW C;  4YK6 A;  1GCJ A;  2QK2 A;  2IX3 A;  1W63 A;  4CB9 A;  3GVO A;  1Q1S C;  4K92 A;  2X19 B;  1XQS A;  1QBK B;  3K4E A;  5BZ5 A;  3BTR C;  4P6Z B;  3Q0P A;  4R11 A;  5KLT B;  3ZIQ A;  1OYZ A;  4XZR B;  3T7U A;  5B56 A;  4DB9 A;  2YNR A;  3K7V A;  2Z5N A;  4B18 A;  1G3J A;  3O4X A;  4DB8 A;  3VE6 A;  2JKT B;  4HXT A;  4E4V A;  3NOW A;  4RXH B;  4B8J A;  3Q0O A;  3TPO A;  2OT8 A;  4YJE A;  4Y5J A;  2IAE A;  4UWX A;  3NMX A;  4UAD A;  4QMH A;  5D5K C;  1W63 B;  4FFB C;  2BNX A;  3UKX B;  3LTJ A;  3RZX A;  5E6Q B;  2DB0 A;  4LAC A;  4U5S A;  3BX3 A;  3EG5 B;  3Q0R A;  1Z2C B;  5HUY C;  2VGL A;  5K9S A;  3K61 A;  3L3F X;  4EVP A;  5SVZ A;  2XA7 A;  4K6J A;  5KL1 A;  3FEY C;  1M8W A;  1I7W A;  2JKR A;  2PF4 A;  4D49 A;  3K64 A;  3UVU A;  2NPP A;  1QGR A;  4B8O A;  4IMI A;  3L3Q A;  4I2Z A;  2QMR A;  4YJL A;  2YJY A;  4U3J C;  1UPL A;  2BCT A;  4ZDU A;  2F31 A;  1EE4 A;  4DVG B;  4MZ6 E;  4CB8 A;  4PLR A;  3LWW A;  3O2S A;  4FZA A;  4A0C A;  1TH1 A;  4U5V A;  4U5N A;  5J3V A;  4MFU A;  3Q0L A;  5LSW A;  2VGL B;  5H2X A;  4DZS A;  1M1E A;  4GMO A;  1Q1T C;  2XA7 B;  3GVT A;  1WA5 B;  5EKG A;  3LTM A;  3ZIP A;  1QGK A;  4UAE A;  3GS3 A;  5KLA A;  4H3K A;  3FGA A;  2Z5K A;  4H3H A;  2IE4 A;  1IAL A;  2NPP B;  1B3U A;  3GB8 A;  3IFQ A;  3ODR A;  1XM9 A;  1UPK A;  2JDQ A;  5JJA A;  2W3C A;  3QML C;  3Q0Q A;  3QGB A;  3TT9 A;  3FEX C;  3DW8 A;  2NYL B;  3C5W A;  4FDD A;  3Q5U A;  3ODS A;  3OUX A;  4QMJ A;  4FZF A;  3QGC A;  2PKG A;  1JPW A;  2Z6H A;  4I2W A;  4CT6 B;  3UKY B;  1T08 A;  4MFV A;  4U5O A;  3V6Y A;  5KL8 A;  3BSB A;  4U5U A;  2Q5D A;  1IBR B;  4NEE A;  4YI0 C;  4U5L A;  4BA3 A;  4L7M A;  1PJM B;  4CV5 B;  3BX2 A;  3C2G A;  3K49 A;  3OUW A;  3ZIR A;  5SW9 A;  1Y2A C;  4FQ3 A;  2GL7 A;  4JLQ A;  4R10 A;  4G3A A;  2Z5O A;  1XQR A;  3K62 A;  3TJ3 A;  4WV6 A;  3WPT A;  5DN7 A;  3ND2 A;  1EJL I;  4GMN A;  4YGX A;  4RV1 A;  4CRU B;  4DB6 A;  3KND A;  4EV8 A;  3UL1 B;  2YNS A;  1V18 A;  3RZ9 A;  4CBA A;  5AEI A;  3ZIN A;  3TPM A;  3ZKV A;  2WTK A;  2IAE B;  3UKW B;  1W9C A;  4I5L A;  3Q0M A;  4MZ5 E;  1F59 A;  3V74 A;  3L6X A;  2C1M A;  2BAP A;  3ZIO A;  4PLQ A;  1PJN B;  4V3R A;  4V3O A;  4D4E A;  4NZW A;  3L6Y A;  4BPL A;  1HO8 A;  2JAK A;  3OQS A;  3K5Y A;  5KLR B;  2JKT A;  2Z5J A;  2RU4 A;  3W3U A;  3NMZ A;  4U54 A;  1I7X A;  3GNI A;  2JKR B;  5H2W A;  4TNM A;  4OIH A;  3Q0S A;  3Q0N A;  5FC8 E;  4UQI A; 
#chains in the Genus database with same CATH topology
 1JPP A;  3K5Q A;  4UAF B;  3A6P A;  3PST A;  4JW2 B;  5BZU A;  1O6O A;  4EVT A;  3QG9 A;  4P6Z G;  3TX7 A;  4HTV A;  5CTT A;  2OF3 A;  4I6I A;  1IQ1 C;  3UL0 B;  3UKZ B;  3WOY A;  1IB2 A;  4B8P A;  5EWP A;  1LRV A;  4I7I A;  3EBB A;  1M8Y A;  3BCT A;  4I5N A;  1M8Z A;  1BK5 A;  2IWH A;  1JDH A;  5BYM A;  2BKU B;  1QZ7 A;  3TJZ B;  1U6G C;  4DJS A;  2RU4 B;  3V71 A;  4BQK A;  2QK1 A;  4PVZ A;  4EVA A;  5CL9 A;  2P8Q A;  3BVS A;  3FGA B;  4I37 A;  3OBV A;  4PLS A;  3QHE A;  3O2Q A;  4V3Q A;  4UQI B;  2IE3 A;  1EJY I;  3OPB A;  5HHG E;  3GQ2 A;  5BZ1 A;  4L4I A;  2Z6G A;  4JKQ A;  2QNA A;  3DAD A;  4OO6 A;  5SWF A;  2X1G F;  2NYM A;  3PSP A;  5K6S A;  3NMW A;  2Z5M A;  3ZIL A;  3IBV A;  3GRL A;  2FV2 A;  5BZV A;  3BWT A;  3AU3 A;  4DBA A;  4O27 A;  1LUJ A;  4CRV B;  2H4M A;  3EA5 B;  2C1T A;  4HM9 A;  4RZP A;  4ADY A;  4KZG A;  5EKF A;  4U58 A;  4FZD A;  1M8X A;  3O2T A;  3K5Z A;  4QMI A;  4CT7 B;  3ZHP A;  1EE5 A;  5CL7 A;  1UKL A;  3C2H A;  2NYL A;  4HNM A;  4IMJ A;  1O6P A;  3H3D X;  1BK6 A;  2IW3 A;  3VWA A;  4U2X D;  3K7W A;  4EV9 A;  1UN0 A;  1WA5 C;  3WYF C;  1M5N S;  2NYM B;  3WOZ A;  3BSX A;  3GAE A;  4R0Z A;  5HUW C;  4YK6 A;  1GCJ A;  2QK2 A;  2IX3 A;  1W63 A;  4CB9 A;  3GVO A;  1Q1S C;  3VLE A;  4I96 A;  4K92 A;  2X19 B;  1XQS A;  1QBK B;  3K4E A;  5BZ5 A;  3BTR C;  4P6Z B;  3Q0P A;  4JW3 C;  4R11 A;  5KLT B;  3ZIQ A;  1OYZ A;  4XZR B;  3SLA A;  5CLC A;  3T7U A;  5B56 A;  4DB9 A;  2YNR A;  4I0Y A;  3K7V A;  2Z5N A;  4B18 A;  1G3J A;  3O4X A;  4DB8 A;  3VE6 A;  2JKT B;  1LSH A;  4HXT A;  4E4V A;  3NOW A;  4RXH B;  4B8J A;  3Q0O A;  3TPO A;  4FP7 A;  1N4K A;  2OT8 A;  4YJE A;  3JXZ A;  4Y5J A;  2IAE A;  4UWX A;  5CL3 A;  3NMX A;  5CLD A;  4UAD A;  4QMH A;  5CLA A;  5D5K C;  1W63 B;  4FFB C;  2BNX A;  3UKX B;  3LTJ A;  3RZX A;  5E6Q B;  2DB0 A;  4LAC A;  4U5S A;  3BX3 A;  3EG5 B;  3Q0R A;  1Z2C B;  3UJ0 A;  5HUY C;  2VGL A;  3JX7 A;  5K9S A;  3K61 A;  3L3F X;  4EVP A;  5SVZ A;  1TE4 A;  2XA7 A;  4K6J A;  5CL6 A;  5KL1 A;  3FEY C;  1M8W A;  1I7W A;  2JKR A;  2PF4 A;  4D49 A;  3K64 A;  3UVU A;  2NPP A;  1QGR A;  3VLD A;  4B8O A;  4IMI A;  3L3Q A;  4I2Z A;  2QMR A;  4YJL A;  4I3N A;  2YJY A;  4U3J C;  1UPL A;  2BCT A;  4ZDU A;  2F31 A;  1EE4 A;  4DVG B;  4MZ6 E;  4CB8 A;  4PLR A;  3LWW A;  3O2S A;  4FZA A;  4A0C A;  1TH1 A;  4U5V A;  4U5N A;  5J3V A;  4MFU A;  3Q0L A;  5LSW A;  2VGL B;  5H2X A;  4DZS A;  1M1E A;  4GMO A;  1Q1T C;  2XA7 B;  3GVT A;  4I1E A;  1WA5 B;  5EKG A;  3LTM A;  4I8M A;  3ZIP A;  1QGK A;  4UAE A;  3GS3 A;  5KLA A;  3JY1 A;  4H3K A;  3FGA A;  2Z5K A;  4H3H A;  2IE4 A;  1IAL A;  2NPP B;  1B3U A;  3GB8 A;  3IFQ A;  3ODR A;  1XM9 A;  1UPK A;  3UJ4 A;  2JDQ A;  5JJA A;  2W3C A;  3QML C;  3Q0Q A;  3QGB A;  3TT9 A;  3FEX C;  3JXY A;  3DW8 A;  2NYL B;  4L4H A;  3C5W A;  4FDD A;  3Q5U A;  3ODS A;  3OUX A;  4QMJ A;  3VLF A;  5CL5 A;  4FZF A;  3QGC A;  2PKG A;  1JPW A;  2Z6H A;  4I2W A;  4CT6 B;  3UKY B;  1T08 A;  4MFV A;  4U5O A;  3V6Y A;  5KL8 A;  5CL8 A;  3BSB A;  5CLB A;  4U5U A;  2Q5D A;  1IBR B;  4NEE A;  4YI0 C;  4U5L A;  4BA3 A;  4L7M A;  1PJM B;  4A3V A;  3SL9 A;  4CV5 B;  3BX2 A;  3C2G A;  3K49 A;  3OUW A;  3ZIR A;  5SW9 A;  2XOA A;  1Y2A C;  5CLE A;  4FQ3 A;  2GL7 A;  4JLQ A;  4R10 A;  4G3A A;  2Z5O A;  1XQR A;  3K62 A;  3TJ3 A;  4WV6 A;  3WPT A;  5DN7 A;  3ND2 A;  1EJL I;  5CL4 A;  4GMN A;  3T8S A;  4YGX A;  4RV1 A;  3ZIK A;  4A3T A;  4CRU B;  4DB6 A;  3KND A;  4EV8 A;  3UL1 B;  2YNS A;  1V18 A;  3RZ9 A;  4CBA A;  5AEI A;  3ZIN A;  3TPM A;  3ZKV A;  2WTK A;  2IAE B;  3UKW B;  1W9C A;  4I5L A;  3Q0M A;  4JW2 A;  4MZ5 E;  1F59 A;  3V74 A;  3L6X A;  2C1M A;  5KUB A;  2BAP A;  3ZIO A;  4PLQ A;  1PJN B;  4V3R A;  4V3O A;  4D4E A;  4NZW A;  3L6Y A;  4BPL A;  1HO8 A;  2JAK A;  3OQS A;  3K5Y A;  5KLR B;  2JKT A;  2Z5J A;  2RU4 A;  3W3U A;  3NMZ A;  4U54 A;  1I7X A;  3GNI A;  2JKR B;  5H2W A;  4TNM A;  4OIH A;  4I2S A;  3Q0S A;  3Q0N A;  5FC8 E;  4UQI A; 
#chains in the Genus database with same CATH homology
 1JPP A;  3K5Q A;  4UAF B;  3A6P A;  3PST A;  4JW2 B;  5BZU A;  1O6O A;  4EVT A;  3QG9 A;  4P6Z G;  3TX7 A;  4HTV A;  5CTT A;  2OF3 A;  4I6I A;  1IQ1 C;  3UL0 B;  3UKZ B;  3WOY A;  1IB2 A;  4B8P A;  5EWP A;  1LRV A;  4I7I A;  3EBB A;  1M8Y A;  3BCT A;  4I5N A;  1M8Z A;  1BK5 A;  2IWH A;  1JDH A;  5BYM A;  2BKU B;  1QZ7 A;  3TJZ B;  1U6G C;  4DJS A;  2RU4 B;  3V71 A;  4BQK A;  2QK1 A;  4PVZ A;  4EVA A;  5CL9 A;  2P8Q A;  3BVS A;  3FGA B;  4I37 A;  3OBV A;  4PLS A;  3QHE A;  3O2Q A;  4V3Q A;  4UQI B;  2IE3 A;  1EJY I;  3OPB A;  5HHG E;  3GQ2 A;  5BZ1 A;  4L4I A;  2Z6G A;  4JKQ A;  2QNA A;  3DAD A;  4OO6 A;  5SWF A;  2X1G F;  2NYM A;  3PSP A;  5K6S A;  3NMW A;  2Z5M A;  3ZIL A;  3IBV A;  3GRL A;  2FV2 A;  5BZV A;  3BWT A;  3AU3 A;  4DBA A;  4O27 A;  1LUJ A;  4CRV B;  2H4M A;  3EA5 B;  2C1T A;  4HM9 A;  4RZP A;  4ADY A;  4KZG A;  5EKF A;  4U58 A;  4FZD A;  1M8X A;  3O2T A;  3K5Z A;  4QMI A;  4CT7 B;  3ZHP A;  1EE5 A;  5CL7 A;  1UKL A;  3C2H A;  2NYL A;  4HNM A;  4IMJ A;  1O6P A;  3H3D X;  1BK6 A;  2IW3 A;  3VWA A;  4U2X D;  3K7W A;  4EV9 A;  1UN0 A;  1WA5 C;  3WYF C;  1M5N S;  2NYM B;  3WOZ A;  3BSX A;  3GAE A;  4R0Z A;  5HUW C;  4YK6 A;  1GCJ A;  2QK2 A;  2IX3 A;  1W63 A;  4CB9 A;  3GVO A;  1Q1S C;  3VLE A;  4I96 A;  4K92 A;  2X19 B;  1XQS A;  1QBK B;  3K4E A;  5BZ5 A;  3BTR C;  4P6Z B;  3Q0P A;  4JW3 C;  4R11 A;  5KLT B;  3ZIQ A;  1OYZ A;  4XZR B;  3SLA A;  5CLC A;  3T7U A;  5B56 A;  4DB9 A;  2YNR A;  4I0Y A;  3K7V A;  2Z5N A;  4B18 A;  1G3J A;  3O4X A;  4DB8 A;  3VE6 A;  2JKT B;  4HXT A;  4E4V A;  3NOW A;  4RXH B;  4B8J A;  3Q0O A;  3TPO A;  4FP7 A;  2OT8 A;  4YJE A;  3JXZ A;  4Y5J A;  2IAE A;  4UWX A;  5CL3 A;  3NMX A;  5CLD A;  4UAD A;  4QMH A;  5CLA A;  5D5K C;  1W63 B;  4FFB C;  2BNX A;  3UKX B;  3LTJ A;  3RZX A;  5E6Q B;  2DB0 A;  4LAC A;  4U5S A;  3BX3 A;  3EG5 B;  3Q0R A;  1Z2C B;  5HUY C;  2VGL A;  3JX7 A;  5K9S A;  3K61 A;  3L3F X;  4EVP A;  5SVZ A;  1TE4 A;  2XA7 A;  4K6J A;  5CL6 A;  5KL1 A;  3FEY C;  1M8W A;  1I7W A;  2JKR A;  2PF4 A;  4D49 A;  3K64 A;  3UVU A;  2NPP A;  1QGR A;  3VLD A;  4B8O A;  4IMI A;  3L3Q A;  4I2Z A;  2QMR A;  4YJL A;  4I3N A;  2YJY A;  4U3J C;  1UPL A;  2BCT A;  4ZDU A;  2F31 A;  1EE4 A;  4DVG B;  4MZ6 E;  4CB8 A;  4PLR A;  3LWW A;  3O2S A;  4FZA A;  4A0C A;  1TH1 A;  4U5V A;  4U5N A;  5J3V A;  4MFU A;  3Q0L A;  5LSW A;  2VGL B;  5H2X A;  4DZS A;  1M1E A;  4GMO A;  1Q1T C;  2XA7 B;  3GVT A;  4I1E A;  1WA5 B;  5EKG A;  3LTM A;  4I8M A;  3ZIP A;  1QGK A;  4UAE A;  3GS3 A;  5KLA A;  3JY1 A;  4H3K A;  3FGA A;  2Z5K A;  4H3H A;  2IE4 A;  1IAL A;  2NPP B;  1B3U A;  3GB8 A;  3IFQ A;  3ODR A;  1XM9 A;  1UPK A;  2JDQ A;  5JJA A;  2W3C A;  3QML C;  3Q0Q A;  3QGB A;  3TT9 A;  3FEX C;  3JXY A;  3DW8 A;  2NYL B;  4L4H A;  3C5W A;  4FDD A;  3Q5U A;  3ODS A;  3OUX A;  4QMJ A;  3VLF A;  5CL5 A;  4FZF A;  3QGC A;  2PKG A;  1JPW A;  2Z6H A;  4I2W A;  4CT6 B;  3UKY B;  1T08 A;  4MFV A;  4U5O A;  3V6Y A;  5KL8 A;  5CL8 A;  3BSB A;  5CLB A;  4U5U A;  2Q5D A;  1IBR B;  4NEE A;  4YI0 C;  4U5L A;  4BA3 A;  4L7M A;  1PJM B;  4A3V A;  3SL9 A;  4CV5 B;  3BX2 A;  3C2G A;  3K49 A;  3OUW A;  3ZIR A;  5SW9 A;  2XOA A;  1Y2A C;  5CLE A;  4FQ3 A;  2GL7 A;  4JLQ A;  4R10 A;  4G3A A;  2Z5O A;  1XQR A;  3K62 A;  3TJ3 A;  4WV6 A;  3WPT A;  5DN7 A;  3ND2 A;  1EJL I;  5CL4 A;  4GMN A;  4YGX A;  4RV1 A;  3ZIK A;  4A3T A;  4CRU B;  4DB6 A;  3KND A;  4EV8 A;  3UL1 B;  2YNS A;  1V18 A;  3RZ9 A;  4CBA A;  5AEI A;  3ZIN A;  3TPM A;  3ZKV A;  2WTK A;  2IAE B;  3UKW B;  1W9C A;  4I5L A;  3Q0M A;  4JW2 A;  4MZ5 E;  1F59 A;  3V74 A;  3L6X A;  2C1M A;  5KUB A;  2BAP A;  3ZIO A;  4PLQ A;  1PJN B;  4V3R A;  4V3O A;  4D4E A;  4NZW A;  3L6Y A;  4BPL A;  1HO8 A;  2JAK A;  3OQS A;  3K5Y A;  5KLR B;  2JKT A;  2Z5J A;  2RU4 A;  3W3U A;  3NMZ A;  4U54 A;  1I7X A;  3GNI A;  2JKR B;  5H2W A;  4TNM A;  4OIH A;  4I2S A;  3Q0S A;  3Q0N A;  5FC8 E;  4UQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...