3SLAA

X-ray structure of first four repeats of human beta-catenin
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
166
structure length
166
Chain Sequence
NYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Catenin beta-1
publication title An intrinsically labile alpha-helix abutting the BCL9-binding site of beta-catenin is required for its inhibition by carnosic acid.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 166
sequence length 166
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00514 Arm Armadillo/beta-catenin-like repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.110 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3slaA00
3SL9A 4JW3C 4U2XD 3SLAA 4JW2A 1TE4A
chains in the Genus database with same CATH superfamily
1QGKA 4DB8A 3RZXA 2PF4A 3JY1A 1UPLA 1XM9A 1XQSA 3JXYA 3VLFA 3NMWA 2IWHA 3ZILA 4OIHA 4FP7A 3VE6A 4DBAA 3Q0MA 3RZ9A 4I2SA 1LUJA 5KLAA 4ZDUA 2X1GF 2JDQA 4U58A 5BYMA 4U2XD 4CRVB 3K64A 4YK6A 2IW3A 3EA5B 3O2QA 3T7UA 4RZPA 5CL8A 2W3CA 3ND2A 5CLDA 1EE5A 3OPBA 3EG5B 4JW2B 1N4KA 4JLQA 4DZSA 4L4IA 4CV5B 3UL1B 1M1EA 3OUWA 3WYFC 3L3QA 4EVTA 3C2GA 4U3JC 3Q0NA 1V18A 2Z5MA 3SLAA 1UKLA 1QBKB 5KLRB 1F59A 3A6PA 2XA7B 3L6YA 3Q0QA 1HO8A 2JAKA 3O2SA 5BZVA 1W9CA 4FFBC 3K49A 1OYZA 5CLBA 1QZ7A 2XOAA 1M8ZA 3K62A 4RV1A 3OQSA 2P8QA 3VLEA 3TX7A 2BAPA 4NZWA 3O4XA 4FZDA 3V71A 3C2HA 4YJLA 1TE4A 4I8MA 5EKGA 4I7IA 3BTRC 1Z2CB 4CBAA 1UPKA 2DB0A 4DB9A 4FZFA 1UN0A 2BKUB 3LTJA 4MZ5E 3VWAA 4HNMA 5CL4A 3L3FX 3BVSA 4UADA 4UQIB 5CLEA 2Z6GA 5KUBA 5CL6A 2YNRA 1BK5A 4I0YA 4B18A 1B3UA 4QMHA 5SVZA 2Z6HA 1IBRB 4U5OA 1PJNB 2OF3A 3FEYC 4BA3A 3H3DX 3TJ3A 2FV2A 5DN7A 3DADA 3BX2A 4IMIA 1XQRA 2QK2A 2NPPB 4JKQA 4U5LA 4R0ZA 1Y2AC 5CL5A 3OBVA 4P6ZB 3T8SA 4I6IA 1M8YA 3AU3A 4L4HA 4CT6B 4RXHB 3LTMA 4D4EA 5E6QB 2PKGA 2C1TA 3K4EA 1WA5C 3ZIRA 3FGAB 1JPPA 3K7VA 4JW3C 4GMOA 2VGLB 4B8PA 3ODRA 5KLTB 4H3KA 3GAEA 2NYMA 3K5QA 3IFQA 4MFUA 2IE4A 1M8WA 3W3UA 2NPPA 3UL0B 1EJLI 4CB8A 5CTTA 1U6GC 3Q0RA 4U54A 2NYLB 3OUXA 1LRVA 5CL9A 4YI0C 1WA5B 2IAEB 2JKRB 1PJMB 3NMXA 1W63B 3SL9A 3ZIQA 3NMZA 3ZIKA 4LACA 5BZUA 5CL3A 3EBBA 3GS3A 2VGLA 4Y5JA 5CL7A 3WOYA 3Q0SA 3JXZA 4JW2A 1G3JA 4V3RA 3V6YA 3GVTA 4U5VA 3TJZB 2JKTB 4V3QA 1IQ1C 3UKXB 4EV9A 4U5SA 4FDDA 4I5NA 4HXTA 2NYLA 3L6XA 4L7MA 1M8XA 2GL7A 4GMNA 2XA7A 2BNXA 4U5UA 3V74A 5EWPA 2IX3A 2RU4B 2IAEA 4BQKA 1Q1TC 3WOZA 2BCTA 3UKZB 4EVPA 4PLQA 4D49A 1I7WA 2Z5NA 3ZINA 3QGCA 4H3HA 4FQ3A 4U5NA 5BZ5A 5SWFA 4I37A 4I3NA 2F31A 1GCJA 2Q5DA 2JKTA 3QGBA 3PSPA 1O6PA 4EVAA 3PSTA 4CT7B 4EV8A 3WPTA 4UQIA 4A3VA 4I5LA 4OO6A 3GNIA 3K7WA 1JDHA 4WV6A 4R11A 5KL8A 5H2WA 2Z5OA 3UVUA 5HHGE 3QMLC 5SW9A 3QHEA 1IALA 3Q5UA 5AEIA 5CLCA 4HM9A 2WTKA 5H2XA 4DJSA 3LWWA 2QMRA 3Q0LA 4DVGB 1EE4A 4A0CA 1TH1A 5K9SA 3ZKVA 3JX7A 3NOWA 4CRUB 2Z5KA 4FZAA 1Q1SC 4HTVA 1BK6A 3GB8A 4ADYA 4K6JA 1IB2A 4MZ6E 4UAEA 4PVZA 3UKWB 3K5YA 4NEEA 1M5NS 4PLRA 3ZIOA 4R10A 4KZGA 3FGAA 4I2WA 3GQ2A 3IBVA 1QGRA 4I1EA 4UWXA 2X19B 2IE3A 3BX3A 4O27A 4I96A 4DB6A 4CB9A 2C1MA 2Z5JA 1JPWA 4UAFB 2YJYA 4P6ZG 4V3OA 3UJ4A 2YNSA 1I7XA 3GRLA 5BZ1A 3K5ZA 2QNAA 1LSHA 3VLDA 3GVOA 4QMJA 4B8OA 3Q0OA 2QK1A 3DW8A 5JJAA 5K6SA 2JKRA 5CLAA 2H4MA 1W63A 3QG9A 3UKYB 5B56A 4G3AA 3BSBA 5KL1A 3TT9A 3FEXC 4K92A 5D5KC 1T08A 5LSWA 3KNDA 3C5WA 5HUYC 3BSXA 4IMJA 4A3TA 3ODSA 5J3VA 3TPOA 3Q0PA 1EJYI 4BPLA 3BCTA 3ZIPA 4QMIA 2NYMB 5EKFA 5HUWC 4MFVA 1O6OA 3BWTA 3O2TA 4I2ZA 4YGXA 4XZRB 2RU4A 4YJEA 4B8JA 3TPMA 4E4VA 2OT8A 3ZHPA 4PLSA 4TNMA 5FC8E 3UJ0A 3K61A
chains in the Genus database with same CATH topology
1QGKA 4DB8A 3RZXA 2PF4A 3JY1A 1UPLA 1XM9A 1XQSA 3JXYA 3VLFA 3NMWA 2IWHA 3ZILA 4OIHA 4FP7A 3VE6A 4DBAA 3Q0MA 3RZ9A 4I2SA 1LUJA 5KLAA 4ZDUA 2X1GF 2JDQA 4U58A 5BYMA 4U2XD 4CRVB 3K64A 4YK6A 2IW3A 3EA5B 3O2QA 3T7UA 4RZPA 5CL8A 2W3CA 3ND2A 5CLDA 1EE5A 3OPBA 3EG5B 4JW2B 4JLQA 4DZSA 4L4IA 4CV5B 3UL1B 1M1EA 3OUWA 3WYFC 3L3QA 4EVTA 3C2GA 4U3JC 3Q0NA 1V18A 2Z5MA 3SLAA 1UKLA 1QBKB 5KLRB 1F59A 3A6PA 2XA7B 3L6YA 3Q0QA 1HO8A 2JAKA 3O2SA 5BZVA 1W9CA 4FFBC 3K49A 1OYZA 5CLBA 1QZ7A 2XOAA 1M8ZA 3K62A 4RV1A 3OQSA 2P8QA 3VLEA 3TX7A 2BAPA 4NZWA 3O4XA 4FZDA 3V71A 3C2HA 4YJLA 1TE4A 4I8MA 5EKGA 4I7IA 3BTRC 1Z2CB 4CBAA 1UPKA 2DB0A 4DB9A 4FZFA 1UN0A 2BKUB 3LTJA 4MZ5E 3VWAA 4HNMA 5CL4A 3L3FX 3BVSA 4UADA 4UQIB 5CLEA 2Z6GA 5KUBA 5CL6A 2YNRA 1BK5A 4I0YA 4B18A 1B3UA 4QMHA 5SVZA 2Z6HA 1IBRB 4U5OA 1PJNB 2OF3A 3FEYC 4BA3A 3H3DX 3TJ3A 2FV2A 5DN7A 3DADA 3BX2A 4IMIA 1XQRA 2QK2A 2NPPB 4JKQA 4U5LA 4R0ZA 1Y2AC 5CL5A 3OBVA 4P6ZB 4I6IA 1M8YA 3AU3A 4L4HA 4CT6B 4RXHB 3LTMA 4D4EA 5E6QB 2PKGA 2C1TA 3K4EA 1WA5C 3ZIRA 3FGAB 1JPPA 3K7VA 4JW3C 4GMOA 2VGLB 4B8PA 3ODRA 5KLTB 4H3KA 3GAEA 2NYMA 3K5QA 3IFQA 4MFUA 2IE4A 1M8WA 3W3UA 2NPPA 3UL0B 1EJLI 4CB8A 5CTTA 1U6GC 3Q0RA 4U54A 2NYLB 3OUXA 1LRVA 5CL9A 4YI0C 1WA5B 2IAEB 2JKRB 1PJMB 3NMXA 1W63B 3SL9A 3ZIQA 3NMZA 3ZIKA 4LACA 5BZUA 5CL3A 3EBBA 3GS3A 2VGLA 4Y5JA 5CL7A 3WOYA 3Q0SA 3JXZA 4JW2A 1G3JA 4V3RA 3V6YA 3GVTA 4U5VA 3TJZB 2JKTB 4V3QA 1IQ1C 3UKXB 4EV9A 4U5SA 4FDDA 4I5NA 4HXTA 2NYLA 3L6XA 4L7MA 1M8XA 2GL7A 4GMNA 2XA7A 2BNXA 4U5UA 3V74A 5EWPA 2IX3A 2RU4B 2IAEA 4BQKA 1Q1TC 3WOZA 2BCTA 3UKZB 4EVPA 4PLQA 4D49A 1I7WA 2Z5NA 3ZINA 3QGCA 4H3HA 4FQ3A 4U5NA 5BZ5A 5SWFA 4I37A 4I3NA 2F31A 1GCJA 2Q5DA 2JKTA 3QGBA 3PSPA 1O6PA 4EVAA 3PSTA 4CT7B 4EV8A 3WPTA 4UQIA 4A3VA 4I5LA 4OO6A 3GNIA 3K7WA 1JDHA 4WV6A 4R11A 5KL8A 5H2WA 2Z5OA 3UVUA 5HHGE 3QMLC 5SW9A 3QHEA 1IALA 3Q5UA 5AEIA 5CLCA 4HM9A 2WTKA 5H2XA 4DJSA 3LWWA 2QMRA 3Q0LA 4DVGB 1EE4A 4A0CA 1TH1A 5K9SA 3ZKVA 3JX7A 3NOWA 4CRUB 2Z5KA 4FZAA 1Q1SC 4HTVA 1BK6A 3GB8A 4ADYA 4K6JA 1IB2A 4MZ6E 4UAEA 4PVZA 3UKWB 3K5YA 4NEEA 1M5NS 4PLRA 3ZIOA 4R10A 4KZGA 3FGAA 4I2WA 3GQ2A 3IBVA 1QGRA 4I1EA 4UWXA 2X19B 2IE3A 3BX3A 4O27A 4I96A 4DB6A 4CB9A 2C1MA 2Z5JA 1JPWA 4UAFB 2YJYA 4P6ZG 4V3OA 2YNSA 1I7XA 3GRLA 5BZ1A 3K5ZA 2QNAA 3VLDA 3GVOA 4QMJA 4B8OA 3Q0OA 2QK1A 3DW8A 5JJAA 5K6SA 2JKRA 5CLAA 2H4MA 1W63A 3QG9A 3UKYB 5B56A 4G3AA 3BSBA 5KL1A 3TT9A 3FEXC 4K92A 5D5KC 1T08A 5LSWA 3KNDA 3C5WA 5HUYC 3BSXA 4IMJA 4A3TA 3ODSA 5J3VA 3TPOA 3Q0PA 1EJYI 4BPLA 3BCTA 3ZIPA 4QMIA 2NYMB 5EKFA 5HUWC 4MFVA 1O6OA 3BWTA 3O2TA 4I2ZA 4YGXA 4XZRB 2RU4A 4YJEA 4B8JA 3TPMA 4E4VA 2OT8A 3ZHPA 4PLSA 4TNMA 5FC8E 3K61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SL9 A;  4JW3 C;  4U2X D;  3SLA A;  4JW2 A;  1TE4 A; 
#chains in the Genus database with same CATH topology
 1QGK A;  4DB8 A;  3RZX A;  2PF4 A;  3JY1 A;  1UPL A;  1XM9 A;  1XQS A;  3JXY A;  3VLF A;  3NMW A;  2IWH A;  3ZIL A;  4OIH A;  4FP7 A;  3VE6 A;  4DBA A;  3Q0M A;  3RZ9 A;  4I2S A;  1LUJ A;  5KLA A;  4ZDU A;  2X1G F;  2JDQ A;  4U58 A;  5BYM A;  4U2X D;  4CRV B;  3K64 A;  4YK6 A;  2IW3 A;  3EA5 B;  3O2Q A;  3T7U A;  4RZP A;  5CL8 A;  2W3C A;  3ND2 A;  5CLD A;  1EE5 A;  3OPB A;  3EG5 B;  4JW2 B;  1N4K A;  4JLQ A;  4DZS A;  4L4I A;  4CV5 B;  3UL1 B;  1M1E A;  3OUW A;  3WYF C;  3L3Q A;  4EVT A;  3C2G A;  4U3J C;  3Q0N A;  1V18 A;  2Z5M A;  3SLA A;  1UKL A;  1QBK B;  5KLR B;  1F59 A;  3A6P A;  2XA7 B;  3L6Y A;  3Q0Q A;  1HO8 A;  2JAK A;  3O2S A;  5BZV A;  1W9C A;  4FFB C;  3K49 A;  1OYZ A;  5CLB A;  1QZ7 A;  2XOA A;  1M8Z A;  3K62 A;  4RV1 A;  3OQS A;  2P8Q A;  3VLE A;  3TX7 A;  2BAP A;  4NZW A;  3O4X A;  4FZD A;  3V71 A;  3C2H A;  4YJL A;  1TE4 A;  4I8M A;  5EKG A;  4I7I A;  3BTR C;  1Z2C B;  4CBA A;  1UPK A;  2DB0 A;  4DB9 A;  4FZF A;  1UN0 A;  2BKU B;  3LTJ A;  4MZ5 E;  3VWA A;  4HNM A;  5CL4 A;  3L3F X;  3BVS A;  4UAD A;  4UQI B;  5CLE A;  2Z6G A;  5KUB A;  5CL6 A;  2YNR A;  1BK5 A;  4I0Y A;  4B18 A;  1B3U A;  4QMH A;  5SVZ A;  2Z6H A;  1IBR B;  4U5O A;  1PJN B;  2OF3 A;  3FEY C;  4BA3 A;  3H3D X;  3TJ3 A;  2FV2 A;  5DN7 A;  3DAD A;  3BX2 A;  4IMI A;  1XQR A;  2QK2 A;  2NPP B;  4JKQ A;  4U5L A;  4R0Z A;  1Y2A C;  5CL5 A;  3OBV A;  4P6Z B;  3T8S A;  4I6I A;  1M8Y A;  3AU3 A;  4L4H A;  4CT6 B;  4RXH B;  3LTM A;  4D4E A;  5E6Q B;  2PKG A;  2C1T A;  3K4E A;  1WA5 C;  3ZIR A;  3FGA B;  1JPP A;  3K7V A;  4JW3 C;  4GMO A;  2VGL B;  4B8P A;  3ODR A;  5KLT B;  4H3K A;  3GAE A;  2NYM A;  3K5Q A;  3IFQ A;  4MFU A;  2IE4 A;  1M8W A;  3W3U A;  2NPP A;  3UL0 B;  1EJL I;  4CB8 A;  5CTT A;  1U6G C;  3Q0R A;  4U54 A;  2NYL B;  3OUX A;  1LRV A;  5CL9 A;  4YI0 C;  1WA5 B;  2IAE B;  2JKR B;  1PJM B;  3NMX A;  1W63 B;  3SL9 A;  3ZIQ A;  3NMZ A;  3ZIK A;  4LAC A;  5BZU A;  5CL3 A;  3EBB A;  3GS3 A;  2VGL A;  4Y5J A;  5CL7 A;  3WOY A;  3Q0S A;  3JXZ A;  4JW2 A;  1G3J A;  4V3R A;  3V6Y A;  3GVT A;  4U5V A;  3TJZ B;  2JKT B;  4V3Q A;  1IQ1 C;  3UKX B;  4EV9 A;  4U5S A;  4FDD A;  4I5N A;  4HXT A;  2NYL A;  3L6X A;  4L7M A;  1M8X A;  2GL7 A;  4GMN A;  2XA7 A;  2BNX A;  4U5U A;  3V74 A;  5EWP A;  2IX3 A;  2RU4 B;  2IAE A;  4BQK A;  1Q1T C;  3WOZ A;  2BCT A;  3UKZ B;  4EVP A;  4PLQ A;  4D49 A;  1I7W A;  2Z5N A;  3ZIN A;  3QGC A;  4H3H A;  4FQ3 A;  4U5N A;  5BZ5 A;  5SWF A;  4I37 A;  4I3N A;  2F31 A;  1GCJ A;  2Q5D A;  2JKT A;  3QGB A;  3PSP A;  1O6P A;  4EVA A;  3PST A;  4CT7 B;  4EV8 A;  3WPT A;  4UQI A;  4A3V A;  4I5L A;  4OO6 A;  3GNI A;  3K7W A;  1JDH A;  4WV6 A;  4R11 A;  5KL8 A;  5H2W A;  2Z5O A;  3UVU A;  5HHG E;  3QML C;  5SW9 A;  3QHE A;  1IAL A;  3Q5U A;  5AEI A;  5CLC A;  4HM9 A;  2WTK A;  5H2X A;  4DJS A;  3LWW A;  2QMR A;  3Q0L A;  4DVG B;  1EE4 A;  4A0C A;  1TH1 A;  5K9S A;  3ZKV A;  3JX7 A;  3NOW A;  4CRU B;  2Z5K A;  4FZA A;  1Q1S C;  4HTV A;  1BK6 A;  3GB8 A;  4ADY A;  4K6J A;  1IB2 A;  4MZ6 E;  4UAE A;  4PVZ A;  3UKW B;  3K5Y A;  4NEE A;  1M5N S;  4PLR A;  3ZIO A;  4R10 A;  4KZG A;  3FGA A;  4I2W A;  3GQ2 A;  3IBV A;  1QGR A;  4I1E A;  4UWX A;  2X19 B;  2IE3 A;  3BX3 A;  4O27 A;  4I96 A;  4DB6 A;  4CB9 A;  2C1M A;  2Z5J A;  1JPW A;  4UAF B;  2YJY A;  4P6Z G;  4V3O A;  3UJ4 A;  2YNS A;  1I7X A;  3GRL A;  5BZ1 A;  3K5Z A;  2QNA A;  1LSH A;  3VLD A;  3GVO A;  4QMJ A;  4B8O A;  3Q0O A;  2QK1 A;  3DW8 A;  5JJA A;  5K6S A;  2JKR A;  5CLA A;  2H4M A;  1W63 A;  3QG9 A;  3UKY B;  5B56 A;  4G3A A;  3BSB A;  5KL1 A;  3TT9 A;  3FEX C;  4K92 A;  5D5K C;  1T08 A;  5LSW A;  3KND A;  3C5W A;  5HUY C;  3BSX A;  4IMJ A;  4A3T A;  3ODS A;  5J3V A;  3TPO A;  3Q0P A;  1EJY I;  4BPL A;  3BCT A;  3ZIP A;  4QMI A;  2NYM B;  5EKF A;  5HUW C;  4MFV A;  1O6O A;  3BWT A;  3O2T A;  4I2Z A;  4YGX A;  4XZR B;  2RU4 A;  4YJE A;  4B8J A;  3TPM A;  4E4V A;  2OT8 A;  3ZHP A;  4PLS A;  4TNM A;  5FC8 E;  3UJ0 A;  3K61 A; 
#chains in the Genus database with same CATH homology
 1QGK A;  4DB8 A;  3RZX A;  2PF4 A;  3JY1 A;  1UPL A;  1XM9 A;  1XQS A;  3JXY A;  3VLF A;  3NMW A;  2IWH A;  3ZIL A;  4OIH A;  4FP7 A;  3VE6 A;  4DBA A;  3Q0M A;  3RZ9 A;  4I2S A;  1LUJ A;  5KLA A;  4ZDU A;  2X1G F;  2JDQ A;  4U58 A;  5BYM A;  4U2X D;  4CRV B;  3K64 A;  4YK6 A;  2IW3 A;  3EA5 B;  3O2Q A;  3T7U A;  4RZP A;  5CL8 A;  2W3C A;  3ND2 A;  5CLD A;  1EE5 A;  3OPB A;  3EG5 B;  4JW2 B;  4JLQ A;  4DZS A;  4L4I A;  4CV5 B;  3UL1 B;  1M1E A;  3OUW A;  3WYF C;  3L3Q A;  4EVT A;  3C2G A;  4U3J C;  3Q0N A;  1V18 A;  2Z5M A;  3SLA A;  1UKL A;  1QBK B;  5KLR B;  1F59 A;  3A6P A;  2XA7 B;  3L6Y A;  3Q0Q A;  1HO8 A;  2JAK A;  3O2S A;  5BZV A;  1W9C A;  4FFB C;  3K49 A;  1OYZ A;  5CLB A;  1QZ7 A;  2XOA A;  1M8Z A;  3K62 A;  4RV1 A;  3OQS A;  2P8Q A;  3VLE A;  3TX7 A;  2BAP A;  4NZW A;  3O4X A;  4FZD A;  3V71 A;  3C2H A;  4YJL A;  1TE4 A;  4I8M A;  5EKG A;  4I7I A;  3BTR C;  1Z2C B;  4CBA A;  1UPK A;  2DB0 A;  4DB9 A;  4FZF A;  1UN0 A;  2BKU B;  3LTJ A;  4MZ5 E;  3VWA A;  4HNM A;  5CL4 A;  3L3F X;  3BVS A;  4UAD A;  4UQI B;  5CLE A;  2Z6G A;  5KUB A;  5CL6 A;  2YNR A;  1BK5 A;  4I0Y A;  4B18 A;  1B3U A;  4QMH A;  5SVZ A;  2Z6H A;  1IBR B;  4U5O A;  1PJN B;  2OF3 A;  3FEY C;  4BA3 A;  3H3D X;  3TJ3 A;  2FV2 A;  5DN7 A;  3DAD A;  3BX2 A;  4IMI A;  1XQR A;  2QK2 A;  2NPP B;  4JKQ A;  4U5L A;  4R0Z A;  1Y2A C;  5CL5 A;  3OBV A;  4P6Z B;  4I6I A;  1M8Y A;  3AU3 A;  4L4H A;  4CT6 B;  4RXH B;  3LTM A;  4D4E A;  5E6Q B;  2PKG A;  2C1T A;  3K4E A;  1WA5 C;  3ZIR A;  3FGA B;  1JPP A;  3K7V A;  4JW3 C;  4GMO A;  2VGL B;  4B8P A;  3ODR A;  5KLT B;  4H3K A;  3GAE A;  2NYM A;  3K5Q A;  3IFQ A;  4MFU A;  2IE4 A;  1M8W A;  3W3U A;  2NPP A;  3UL0 B;  1EJL I;  4CB8 A;  5CTT A;  1U6G C;  3Q0R A;  4U54 A;  2NYL B;  3OUX A;  1LRV A;  5CL9 A;  4YI0 C;  1WA5 B;  2IAE B;  2JKR B;  1PJM B;  3NMX A;  1W63 B;  3SL9 A;  3ZIQ A;  3NMZ A;  3ZIK A;  4LAC A;  5BZU A;  5CL3 A;  3EBB A;  3GS3 A;  2VGL A;  4Y5J A;  5CL7 A;  3WOY A;  3Q0S A;  3JXZ A;  4JW2 A;  1G3J A;  4V3R A;  3V6Y A;  3GVT A;  4U5V A;  3TJZ B;  2JKT B;  4V3Q A;  1IQ1 C;  3UKX B;  4EV9 A;  4U5S A;  4FDD A;  4I5N A;  4HXT A;  2NYL A;  3L6X A;  4L7M A;  1M8X A;  2GL7 A;  4GMN A;  2XA7 A;  2BNX A;  4U5U A;  3V74 A;  5EWP A;  2IX3 A;  2RU4 B;  2IAE A;  4BQK A;  1Q1T C;  3WOZ A;  2BCT A;  3UKZ B;  4EVP A;  4PLQ A;  4D49 A;  1I7W A;  2Z5N A;  3ZIN A;  3QGC A;  4H3H A;  4FQ3 A;  4U5N A;  5BZ5 A;  5SWF A;  4I37 A;  4I3N A;  2F31 A;  1GCJ A;  2Q5D A;  2JKT A;  3QGB A;  3PSP A;  1O6P A;  4EVA A;  3PST A;  4CT7 B;  4EV8 A;  3WPT A;  4UQI A;  4A3V A;  4I5L A;  4OO6 A;  3GNI A;  3K7W A;  1JDH A;  4WV6 A;  4R11 A;  5KL8 A;  5H2W A;  2Z5O A;  3UVU A;  5HHG E;  3QML C;  5SW9 A;  3QHE A;  1IAL A;  3Q5U A;  5AEI A;  5CLC A;  4HM9 A;  2WTK A;  5H2X A;  4DJS A;  3LWW A;  2QMR A;  3Q0L A;  4DVG B;  1EE4 A;  4A0C A;  1TH1 A;  5K9S A;  3ZKV A;  3JX7 A;  3NOW A;  4CRU B;  2Z5K A;  4FZA A;  1Q1S C;  4HTV A;  1BK6 A;  3GB8 A;  4ADY A;  4K6J A;  1IB2 A;  4MZ6 E;  4UAE A;  4PVZ A;  3UKW B;  3K5Y A;  4NEE A;  1M5N S;  4PLR A;  3ZIO A;  4R10 A;  4KZG A;  3FGA A;  4I2W A;  3GQ2 A;  3IBV A;  1QGR A;  4I1E A;  4UWX A;  2X19 B;  2IE3 A;  3BX3 A;  4O27 A;  4I96 A;  4DB6 A;  4CB9 A;  2C1M A;  2Z5J A;  1JPW A;  4UAF B;  2YJY A;  4P6Z G;  4V3O A;  2YNS A;  1I7X A;  3GRL A;  5BZ1 A;  3K5Z A;  2QNA A;  3VLD A;  3GVO A;  4QMJ A;  4B8O A;  3Q0O A;  2QK1 A;  3DW8 A;  5JJA A;  5K6S A;  2JKR A;  5CLA A;  2H4M A;  1W63 A;  3QG9 A;  3UKY B;  5B56 A;  4G3A A;  3BSB A;  5KL1 A;  3TT9 A;  3FEX C;  4K92 A;  5D5K C;  1T08 A;  5LSW A;  3KND A;  3C5W A;  5HUY C;  3BSX A;  4IMJ A;  4A3T A;  3ODS A;  5J3V A;  3TPO A;  3Q0P A;  1EJY I;  4BPL A;  3BCT A;  3ZIP A;  4QMI A;  2NYM B;  5EKF A;  5HUW C;  4MFV A;  1O6O A;  3BWT A;  3O2T A;  4I2Z A;  4YGX A;  4XZR B;  2RU4 A;  4YJE A;  4B8J A;  3TPM A;  4E4V A;  2OT8 A;  3ZHP A;  4PLS A;  4TNM A;  5FC8 E;  3K61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...