4V3RA

Designed armadillo repeat protein with 5 internal repeats, 2nd generation c-cap and 3rd generation n-cap.
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
281
structure length
281
Chain Sequence
ELPQMVQQLNSPDQQELQSALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YIII_M5_AII
publication title Structures of Designed Armadillo-Repeat Proteins Show Propagation of Inter-Repeat Interface Effects
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 119
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 4v3rA00
3K5ZA 3OUWA 2Z5OA 4XZRB 3BCTA 1QZ7A 1WA5B 3TJ3A 4K92A 3WOYA 3Q0LA 5J3VA 1F59A 5JJAA 3AU3A 3NMWA 5DN7A 2H4MA 2IE3A 4YGXA 4CB9A 3DW8A 5KLTB 2DB0A 1IALA 1W63B 2Z5JA 3K7VA 2OT8A 4CRVB 3OUXA 2IX3A 1Q1SC 4DBAA 1T08A 4U5NA 5D5KC 3K5QA 4HNMA 3ZKVA 4DB6A 2QMRA 1GCJA 4JLQA 3BTRC 4EVPA 3Q5UA 5BZ5A 3UL0B 3LTMA 2JDQA 4GMOA 3ZIPA 4FQ3A 4DB9A 4U5VA 3VWAA 2JKRA 4PLSA 1JDHA 4RXHB 4I2WA 1M1EA 4FZFA 3Q0OA 5HHGE 4A0CA 5EWPA 1IB2A 3GVTA 3RZXA 5BYMA 1IQ1C 2PKGA 3PSPA 3Q0NA 2OF3A 4V3QA 5SW9A 3RZ9A 3QGCA 2NPPA 1O6PA 3ZIQA 1EE4A 5CTTA 4YI0C 4YK6A 2NYLB 4CT6B 4B18A 1QBKB 4FDDA 4EVTA 1OYZA 2IE4A 4RZPA 5K9SA 3BX2A 4UAEA 5H2WA 4DJSA 2QNAA 1W9CA 4YJEA 3TPMA 2XA7B 1XM9A 3C5WA 4U5UA 3H3DX 5KLAA 3EG5B 1M8XA 3GVOA 4U5LA 3C2GA 4PLQA 2RU4B 3K64A 1JPPA 3O2TA 2BAPA 2C1MA 5EKGA 4TNMA 2IW3A 2IAEA 4U5OA 2PF4A 2NYMA 2F31A 4Y5JA 3A6PA 5FC8E 5LSWA 4DVGB 3L6XA 3FGAA 3QGBA 1M5NS 3OPBA 4R11A 4WV6A 3ND2A 1M8WA 4UADA 3IFQA 3OBVA 2Z6GA 3K7WA 4P6ZB 1Q1TC 3LWWA 4MZ5E 4IMIA 2JKTA 1EJLI 3IBVA 3NMZA 4HTVA 1LRVA 5BZVA 4FZAA 2BNXA 2Z6HA 1EJYI 3Q0QA 2YNRA 3L6YA 3ZHPA 3GAEA 3DADA 3K5YA 3K61A 1PJNB 1EE5A 4MFVA 5KL8A 4D4EA 5AEIA 2JAKA 3EA5B 4BA3A 3LTJA 2NPPB 1TH1A 4EVAA 1XQSA 4GMNA 4UQIA 3V6YA 4MZ6E 4FFBC 4CB8A 3GNIA 4FZDA 5SVZA 3WYFC 3UKYB 5SWFA 3QMLC 2VGLA 4U3JC 3PSTA 1LUJA 4EV8A 4L7MA 3ZIRA 5HUWC 4V3OA 2NYLA 1UKLA 4P6ZG 3TPOA 4OO6A 5H2XA 4YJLA 1U6GC 4CV5B 2P8QA 3Q0SA 3UKXB 3C2HA 4H3KA 1I7XA 4NZWA 3ODSA 2W3CA 5BZ1A 2BCTA 3UKWB 3TJZB 4UWXA 3BSXA 2NYMB 4UAFB 2X1GF 3W3UA 2FV2A 4K6JA 3O4XA 4B8JA 2YNSA 3OQSA 5KLRB 1Y2AC 2RU4A 1O6OA 4HXTA 4QMIA 4OIHA 4MFUA 4ADYA 3NOWA 3GB8A 2WTKA 4DZSA 3QG9A 2YJYA 3GRLA 1WA5C 4G3AA 3TT9A 4CT7B 3EBBA 1G3JA 1IBRB 3FEYC 4BPLA 2QK1A 4JW2B 2JKTB 2Z5KA 1W63A 4U58A 4EV9A 3V74A 3Q0RA 3Q0MA 3ODRA 4HM9A 4I5LA 1BK5A 1I7WA 2JKRB 3ZIOA 1HO8A 4CBAA 5EKFA 1Z2CB 4QMHA 4NEEA 4RV1A 5BZUA 5K6SA 3T7UA 1UPLA 2X19B 4D49A 4ZDUA 3ZINA 3L3FX 3WPTA 1QGKA 1V18A 2IWHA 4IMJA 1QGRA 4B8PA 2BKUB 4UQIB 1JPWA 3QHEA 4DB8A 4QMJA 3O2QA 3FEXC 5E6QB 1M8YA 2Z5MA 3Q0PA 2C1TA 3UKZB 4I2ZA 2VGLB 1M8ZA 2Q5DA 1XQRA 1B3UA 3NMXA 4O27A 3VE6A 4R10A 4PLRA 4PVZA 3O2SA 4R0ZA 3K4EA 1UN0A 4H3HA 3V71A 3L3QA 3GS3A 4I5NA 2XA7A 3UL1B 5KL1A 3BWTA 5HUYC 1UPKA 3TX7A 4U54A 3K49A 3UVUA 2IAEB 4LACA 4BQKA 4V3RA 3K62A 1PJMB 2QK2A 3WOZA 4E4VA 2GL7A 4B8OA 3KNDA 3FGAB 3BX3A 5B56A 4KZGA 4U5SA 3BSBA 2Z5NA 3GQ2A 4CRUB 1BK6A
chains in the Genus database with same CATH superfamily
3K5ZA 3OUWA 2Z5OA 4XZRB 3BCTA 1QZ7A 1WA5B 3TJ3A 4K92A 3WOYA 3Q0LA 5J3VA 1F59A 4FP7A 5JJAA 3AU3A 3NMWA 5DN7A 2H4MA 2IE3A 4YGXA 4CB9A 3DW8A 5KLTB 2DB0A 1IALA 1W63B 2Z5JA 3K7VA 2OT8A 1N4KA 4CRVB 3OUXA 2IX3A 1Q1SC 4DBAA 1T08A 4U5NA 5D5KC 3K5QA 4HNMA 3ZKVA 4DB6A 3SLAA 2QMRA 1GCJA 4JW2A 4JLQA 3BTRC 5CLBA 4EVPA 3Q5UA 5BZ5A 3UL0B 3LTMA 2JDQA 4GMOA 3ZIPA 4FQ3A 4DB9A 4U5VA 3VWAA 2JKRA 4PLSA 5CL4A 1JDHA 4RXHB 4I2WA 1M1EA 3JX7A 4FZFA 3Q0OA 5HHGE 4A0CA 5EWPA 1IB2A 3GVTA 3RZXA 5BYMA 1IQ1C 2PKGA 3PSPA 3Q0NA 2OF3A 4V3QA 5SW9A 3RZ9A 3QGCA 2NPPA 1O6PA 3ZIQA 1EE4A 5CTTA 4YI0C 4YK6A 2NYLB 4CT6B 4B18A 1QBKB 4FDDA 4EVTA 1OYZA 2IE4A 4RZPA 5K9SA 3JXZA 3BX2A 4UAEA 5H2WA 4DJSA 2QNAA 1W9CA 4YJEA 3TPMA 2XA7B 1XM9A 4I0YA 3C5WA 4U5UA 3H3DX 5KLAA 3EG5B 1M8XA 3GVOA 4U5LA 3C2GA 4PLQA 2RU4B 3K64A 1JPPA 3O2TA 2BAPA 2C1MA 5EKGA 4TNMA 2IW3A 4A3VA 2IAEA 4U5OA 3UJ4A 2PF4A 2NYMA 2F31A 4Y5JA 3A6PA 5FC8E 5LSWA 4DVGB 3L6XA 3FGAA 3QGBA 1M5NS 3OPBA 4R11A 4WV6A 3ND2A 1M8WA 4L4HA 4UADA 3IFQA 3OBVA 4JKQA 2Z6GA 3K7WA 4P6ZB 1Q1TC 3LWWA 4MZ5E 4IMIA 2JKTA 1EJLI 3IBVA 3NMZA 4HTVA 1LRVA 5BZVA 4FZAA 3BVSA 2BNXA 3VLEA 2Z6HA 1EJYI 3Q0QA 2YNRA 3L6YA 3ZHPA 3GAEA 3DADA 3K5YA 3K61A 1PJNB 1EE5A 4MFVA 5KL8A 4D4EA 5AEIA 2JAKA 3EA5B 3SL9A 4BA3A 3LTJA 4I37A 2NPPB 1TH1A 4EVAA 1XQSA 5CL3A 4GMNA 5KUBA 3T8SA 3JY1A 3JXYA 4UQIA 4I8MA 3V6YA 4I7IA 4MZ6E 4FFBC 4CB8A 3GNIA 4FZDA 5SVZA 3WYFC 3UKYB 5SWFA 3QMLC 2VGLA 4I1EA 4U3JC 3PSTA 1LUJA 4EV8A 4L7MA 3ZIRA 5HUWC 4V3OA 2NYLA 1UKLA 4P6ZG 3TPOA 4OO6A 5H2XA 4YJLA 1U6GC 4CV5B 2P8QA 3Q0SA 3UKXB 3C2HA 4H3KA 1I7XA 4NZWA 3UJ0A 3ODSA 5CLCA 2W3CA 5BZ1A 3VLDA 2BCTA 3UKWB 3TJZB 4UWXA 3BSXA 2NYMB 4I3NA 4UAFB 2X1GF 3W3UA 2FV2A 4K6JA 3O4XA 4B8JA 2YNSA 5CL8A 5CL9A 3OQSA 5KLRB 1Y2AC 2RU4A 1O6OA 4HXTA 4QMIA 4OIHA 4MFUA 4ADYA 3NOWA 3GB8A 2WTKA 4DZSA 3QG9A 4I96A 2YJYA 3GRLA 1WA5C 4G3AA 3TT9A 4CT7B 3EBBA 1G3JA 1IBRB 3FEYC 4BPLA 2QK1A 4JW2B 2JKTB 5CL5A 2Z5KA 1W63A 4U58A 4EV9A 3V74A 3Q0RA 3Q0MA 3ODRA 4HM9A 4I5LA 1BK5A 1I7WA 2JKRB 3ZIOA 1HO8A 4CBAA 4I6IA 5EKFA 1Z2CB 4JW3C 4QMHA 4NEEA 4RV1A 5BZUA 4L4IA 4A3TA 5K6SA 3T7UA 1UPLA 3VLFA 5CLDA 2X19B 5CLEA 1LSHA 4D49A 4ZDUA 3ZINA 3L3FX 3WPTA 1QGKA 1V18A 2IWHA 4IMJA 1QGRA 4B8PA 2BKUB 4I2SA 5CLAA 4UQIB 1JPWA 3ZIKA 3QHEA 4DB8A 4QMJA 3O2QA 3FEXC 5E6QB 1M8YA 2Z5MA 3Q0PA 2C1TA 3UKZB 4I2ZA 3ZILA 5CL7A 2VGLB 4U2XD 1M8ZA 2Q5DA 1XQRA 1B3UA 3NMXA 2XOAA 4O27A 3VE6A 4R10A 4PLRA 4PVZA 3O2SA 4R0ZA 3K4EA 1UN0A 4H3HA 3V71A 3L3QA 3GS3A 4I5NA 2XA7A 3UL1B 5KL1A 3BWTA 5HUYC 1UPKA 3TX7A 4U54A 3K49A 3UVUA 2IAEB 4LACA 4BQKA 4V3RA 3K62A 1PJMB 2QK2A 3WOZA 4E4VA 2GL7A 5CL6A 4B8OA 3KNDA 3FGAB 3BX3A 5B56A 4KZGA 4U5SA 3BSBA 2Z5NA 3GQ2A 1TE4A 4CRUB 1BK6A
chains in the Genus database with same CATH topology
3K5ZA 3OUWA 2Z5OA 4XZRB 3BCTA 1QZ7A 1WA5B 3TJ3A 4K92A 3WOYA 3Q0LA 5J3VA 1F59A 4FP7A 5JJAA 3AU3A 3NMWA 5DN7A 2H4MA 2IE3A 4YGXA 4CB9A 3DW8A 5KLTB 2DB0A 1IALA 1W63B 2Z5JA 3K7VA 2OT8A 4CRVB 3OUXA 2IX3A 1Q1SC 4DBAA 1T08A 4U5NA 5D5KC 3K5QA 4HNMA 3ZKVA 4DB6A 3SLAA 2QMRA 1GCJA 4JW2A 4JLQA 3BTRC 5CLBA 4EVPA 3Q5UA 5BZ5A 3UL0B 3LTMA 2JDQA 4GMOA 3ZIPA 4FQ3A 4DB9A 4U5VA 3VWAA 2JKRA 4PLSA 5CL4A 1JDHA 4RXHB 4I2WA 1M1EA 3JX7A 4FZFA 3Q0OA 5HHGE 4A0CA 5EWPA 1IB2A 3GVTA 3RZXA 5BYMA 1IQ1C 2PKGA 3PSPA 3Q0NA 2OF3A 4V3QA 5SW9A 3RZ9A 3QGCA 2NPPA 1O6PA 3ZIQA 1EE4A 5CTTA 4YI0C 4YK6A 2NYLB 4CT6B 4B18A 1QBKB 4FDDA 4EVTA 1OYZA 2IE4A 4RZPA 5K9SA 3JXZA 3BX2A 4UAEA 5H2WA 4DJSA 2QNAA 1W9CA 4YJEA 3TPMA 2XA7B 1XM9A 4I0YA 3C5WA 4U5UA 3H3DX 5KLAA 3EG5B 1M8XA 3GVOA 4U5LA 3C2GA 4PLQA 2RU4B 3K64A 1JPPA 3O2TA 2BAPA 2C1MA 5EKGA 4TNMA 2IW3A 4A3VA 2IAEA 4U5OA 2PF4A 2NYMA 2F31A 4Y5JA 3A6PA 5FC8E 5LSWA 4DVGB 3L6XA 3FGAA 3QGBA 1M5NS 3OPBA 4R11A 4WV6A 3ND2A 1M8WA 4L4HA 4UADA 3IFQA 3OBVA 4JKQA 2Z6GA 3K7WA 4P6ZB 1Q1TC 3LWWA 4MZ5E 4IMIA 2JKTA 1EJLI 3IBVA 3NMZA 4HTVA 1LRVA 5BZVA 4FZAA 3BVSA 2BNXA 3VLEA 2Z6HA 1EJYI 3Q0QA 2YNRA 3L6YA 3ZHPA 3GAEA 3DADA 3K5YA 3K61A 1PJNB 1EE5A 4MFVA 5KL8A 4D4EA 5AEIA 2JAKA 3EA5B 3SL9A 4BA3A 3LTJA 4I37A 2NPPB 1TH1A 4EVAA 1XQSA 5CL3A 4GMNA 5KUBA 3JY1A 3JXYA 4UQIA 4I8MA 3V6YA 4I7IA 4MZ6E 4FFBC 4CB8A 3GNIA 4FZDA 5SVZA 3WYFC 3UKYB 5SWFA 3QMLC 2VGLA 4I1EA 4U3JC 3PSTA 1LUJA 4EV8A 4L7MA 3ZIRA 5HUWC 4V3OA 2NYLA 1UKLA 4P6ZG 3TPOA 4OO6A 5H2XA 4YJLA 1U6GC 4CV5B 2P8QA 3Q0SA 3UKXB 3C2HA 4H3KA 1I7XA 4NZWA 3ODSA 5CLCA 2W3CA 5BZ1A 3VLDA 2BCTA 3UKWB 3TJZB 4UWXA 3BSXA 2NYMB 4I3NA 4UAFB 2X1GF 3W3UA 2FV2A 4K6JA 3O4XA 4B8JA 2YNSA 5CL8A 5CL9A 3OQSA 5KLRB 1Y2AC 2RU4A 1O6OA 4HXTA 4QMIA 4OIHA 4MFUA 4ADYA 3NOWA 3GB8A 2WTKA 4DZSA 3QG9A 4I96A 2YJYA 3GRLA 1WA5C 4G3AA 3TT9A 4CT7B 3EBBA 1G3JA 1IBRB 3FEYC 4BPLA 2QK1A 4JW2B 2JKTB 5CL5A 2Z5KA 1W63A 4U58A 4EV9A 3V74A 3Q0RA 3Q0MA 3ODRA 4HM9A 4I5LA 1BK5A 1I7WA 2JKRB 3ZIOA 1HO8A 4CBAA 4I6IA 5EKFA 1Z2CB 4JW3C 4QMHA 4NEEA 4RV1A 5BZUA 4L4IA 4A3TA 5K6SA 3T7UA 3VLFA 1UPLA 5CLDA 2X19B 5CLEA 4D49A 4ZDUA 3ZINA 3L3FX 3WPTA 1QGKA 1V18A 2IWHA 4IMJA 1QGRA 4B8PA 2BKUB 4I2SA 5CLAA 4UQIB 1JPWA 3ZIKA 3QHEA 4DB8A 4QMJA 3O2QA 3FEXC 5E6QB 1M8YA 2Z5MA 3Q0PA 2C1TA 3UKZB 4I2ZA 3ZILA 5CL7A 2VGLB 4U2XD 1M8ZA 2Q5DA 1XQRA 1B3UA 3NMXA 2XOAA 4O27A 3VE6A 4R10A 4PLRA 4PVZA 3O2SA 4R0ZA 3K4EA 1UN0A 4H3HA 3V71A 3L3QA 3GS3A 4I5NA 2XA7A 3UL1B 5KL1A 3BWTA 5HUYC 1UPKA 3TX7A 4U54A 3K49A 3UVUA 2IAEB 4LACA 4BQKA 4V3RA 3K62A 1PJMB 2QK2A 3WOZA 4E4VA 2GL7A 5CL6A 4B8OA 3KNDA 3FGAB 3BX3A 5B56A 4KZGA 4U5SA 3BSBA 2Z5NA 3GQ2A 1TE4A 4CRUB 1BK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K5Z A;  3OUW A;  2Z5O A;  4XZR B;  3BCT A;  1QZ7 A;  1WA5 B;  3TJ3 A;  4K92 A;  3WOY A;  3Q0L A;  5J3V A;  1F59 A;  5JJA A;  3AU3 A;  3NMW A;  5DN7 A;  2H4M A;  2IE3 A;  4YGX A;  4CB9 A;  3DW8 A;  5KLT B;  2DB0 A;  1IAL A;  1W63 B;  2Z5J A;  3K7V A;  2OT8 A;  4CRV B;  3OUX A;  2IX3 A;  1Q1S C;  4DBA A;  1T08 A;  4U5N A;  5D5K C;  3K5Q A;  4HNM A;  3ZKV A;  4DB6 A;  2QMR A;  1GCJ A;  4JLQ A;  3BTR C;  4EVP A;  3Q5U A;  5BZ5 A;  3UL0 B;  3LTM A;  2JDQ A;  4GMO A;  3ZIP A;  4FQ3 A;  4DB9 A;  4U5V A;  3VWA A;  2JKR A;  4PLS A;  1JDH A;  4RXH B;  4I2W A;  1M1E A;  4FZF A;  3Q0O A;  5HHG E;  4A0C A;  5EWP A;  1IB2 A;  3GVT A;  3RZX A;  5BYM A;  1IQ1 C;  2PKG A;  3PSP A;  3Q0N A;  2OF3 A;  4V3Q A;  5SW9 A;  3RZ9 A;  3QGC A;  2NPP A;  1O6P A;  3ZIQ A;  1EE4 A;  5CTT A;  4YI0 C;  4YK6 A;  2NYL B;  4CT6 B;  4B18 A;  1QBK B;  4FDD A;  4EVT A;  1OYZ A;  2IE4 A;  4RZP A;  5K9S A;  3BX2 A;  4UAE A;  5H2W A;  4DJS A;  2QNA A;  1W9C A;  4YJE A;  3TPM A;  2XA7 B;  1XM9 A;  3C5W A;  4U5U A;  3H3D X;  5KLA A;  3EG5 B;  1M8X A;  3GVO A;  4U5L A;  3C2G A;  4PLQ A;  2RU4 B;  3K64 A;  1JPP A;  3O2T A;  2BAP A;  2C1M A;  5EKG A;  4TNM A;  2IW3 A;  2IAE A;  4U5O A;  2PF4 A;  2NYM A;  2F31 A;  4Y5J A;  3A6P A;  5FC8 E;  5LSW A;  4DVG B;  3L6X A;  3FGA A;  3QGB A;  1M5N S;  3OPB A;  4R11 A;  4WV6 A;  3ND2 A;  1M8W A;  4UAD A;  3IFQ A;  3OBV A;  2Z6G A;  3K7W A;  4P6Z B;  1Q1T C;  3LWW A;  4MZ5 E;  4IMI A;  2JKT A;  1EJL I;  3IBV A;  3NMZ A;  4HTV A;  1LRV A;  5BZV A;  4FZA A;  2BNX A;  2Z6H A;  1EJY I;  3Q0Q A;  2YNR A;  3L6Y A;  3ZHP A;  3GAE A;  3DAD A;  3K5Y A;  3K61 A;  1PJN B;  1EE5 A;  4MFV A;  5KL8 A;  4D4E A;  5AEI A;  2JAK A;  3EA5 B;  4BA3 A;  3LTJ A;  2NPP B;  1TH1 A;  4EVA A;  1XQS A;  4GMN A;  4UQI A;  3V6Y A;  4MZ6 E;  4FFB C;  4CB8 A;  3GNI A;  4FZD A;  5SVZ A;  3WYF C;  3UKY B;  5SWF A;  3QML C;  2VGL A;  4U3J C;  3PST A;  1LUJ A;  4EV8 A;  4L7M A;  3ZIR A;  5HUW C;  4V3O A;  2NYL A;  1UKL A;  4P6Z G;  3TPO A;  4OO6 A;  5H2X A;  4YJL A;  1U6G C;  4CV5 B;  2P8Q A;  3Q0S A;  3UKX B;  3C2H A;  4H3K A;  1I7X A;  4NZW A;  3ODS A;  2W3C A;  5BZ1 A;  2BCT A;  3UKW B;  3TJZ B;  4UWX A;  3BSX A;  2NYM B;  4UAF B;  2X1G F;  3W3U A;  2FV2 A;  4K6J A;  3O4X A;  4B8J A;  2YNS A;  3OQS A;  5KLR B;  1Y2A C;  2RU4 A;  1O6O A;  4HXT A;  4QMI A;  4OIH A;  4MFU A;  4ADY A;  3NOW A;  3GB8 A;  2WTK A;  4DZS A;  3QG9 A;  2YJY A;  3GRL A;  1WA5 C;  4G3A A;  3TT9 A;  4CT7 B;  3EBB A;  1G3J A;  1IBR B;  3FEY C;  4BPL A;  2QK1 A;  4JW2 B;  2JKT B;  2Z5K A;  1W63 A;  4U58 A;  4EV9 A;  3V74 A;  3Q0R A;  3Q0M A;  3ODR A;  4HM9 A;  4I5L A;  1BK5 A;  1I7W A;  2JKR B;  3ZIO A;  1HO8 A;  4CBA A;  5EKF A;  1Z2C B;  4QMH A;  4NEE A;  4RV1 A;  5BZU A;  5K6S A;  3T7U A;  1UPL A;  2X19 B;  4D49 A;  4ZDU A;  3ZIN A;  3L3F X;  3WPT A;  1QGK A;  1V18 A;  2IWH A;  4IMJ A;  1QGR A;  4B8P A;  2BKU B;  4UQI B;  1JPW A;  3QHE A;  4DB8 A;  4QMJ A;  3O2Q A;  3FEX C;  5E6Q B;  1M8Y A;  2Z5M A;  3Q0P A;  2C1T A;  3UKZ B;  4I2Z A;  2VGL B;  1M8Z A;  2Q5D A;  1XQR A;  1B3U A;  3NMX A;  4O27 A;  3VE6 A;  4R10 A;  4PLR A;  4PVZ A;  3O2S A;  4R0Z A;  3K4E A;  1UN0 A;  4H3H A;  3V71 A;  3L3Q A;  3GS3 A;  4I5N A;  2XA7 A;  3UL1 B;  5KL1 A;  3BWT A;  5HUY C;  1UPK A;  3TX7 A;  4U54 A;  3K49 A;  3UVU A;  2IAE B;  4LAC A;  4BQK A;  4V3R A;  3K62 A;  1PJM B;  2QK2 A;  3WOZ A;  4E4V A;  2GL7 A;  4B8O A;  3KND A;  3FGA B;  3BX3 A;  5B56 A;  4KZG A;  4U5S A;  3BSB A;  2Z5N A;  3GQ2 A;  4CRU B;  1BK6 A; 
#chains in the Genus database with same CATH topology
 3K5Z A;  3OUW A;  2Z5O A;  4XZR B;  3BCT A;  1QZ7 A;  1WA5 B;  3TJ3 A;  4K92 A;  3WOY A;  3Q0L A;  5J3V A;  1F59 A;  4FP7 A;  5JJA A;  3AU3 A;  3NMW A;  5DN7 A;  2H4M A;  2IE3 A;  4YGX A;  4CB9 A;  3DW8 A;  5KLT B;  2DB0 A;  1IAL A;  1W63 B;  2Z5J A;  3K7V A;  2OT8 A;  1N4K A;  4CRV B;  3OUX A;  2IX3 A;  1Q1S C;  4DBA A;  1T08 A;  4U5N A;  5D5K C;  3K5Q A;  4HNM A;  3ZKV A;  4DB6 A;  3SLA A;  2QMR A;  1GCJ A;  4JW2 A;  4JLQ A;  3BTR C;  5CLB A;  4EVP A;  3Q5U A;  5BZ5 A;  3UL0 B;  3LTM A;  2JDQ A;  4GMO A;  3ZIP A;  4FQ3 A;  4DB9 A;  4U5V A;  3VWA A;  2JKR A;  4PLS A;  5CL4 A;  1JDH A;  4RXH B;  4I2W A;  1M1E A;  3JX7 A;  4FZF A;  3Q0O A;  5HHG E;  4A0C A;  5EWP A;  1IB2 A;  3GVT A;  3RZX A;  5BYM A;  1IQ1 C;  2PKG A;  3PSP A;  3Q0N A;  2OF3 A;  4V3Q A;  5SW9 A;  3RZ9 A;  3QGC A;  2NPP A;  1O6P A;  3ZIQ A;  1EE4 A;  5CTT A;  4YI0 C;  4YK6 A;  2NYL B;  4CT6 B;  4B18 A;  1QBK B;  4FDD A;  4EVT A;  1OYZ A;  2IE4 A;  4RZP A;  5K9S A;  3JXZ A;  3BX2 A;  4UAE A;  5H2W A;  4DJS A;  2QNA A;  1W9C A;  4YJE A;  3TPM A;  2XA7 B;  1XM9 A;  4I0Y A;  3C5W A;  4U5U A;  3H3D X;  5KLA A;  3EG5 B;  1M8X A;  3GVO A;  4U5L A;  3C2G A;  4PLQ A;  2RU4 B;  3K64 A;  1JPP A;  3O2T A;  2BAP A;  2C1M A;  5EKG A;  4TNM A;  2IW3 A;  4A3V A;  2IAE A;  4U5O A;  3UJ4 A;  2PF4 A;  2NYM A;  2F31 A;  4Y5J A;  3A6P A;  5FC8 E;  5LSW A;  4DVG B;  3L6X A;  3FGA A;  3QGB A;  1M5N S;  3OPB A;  4R11 A;  4WV6 A;  3ND2 A;  1M8W A;  4L4H A;  4UAD A;  3IFQ A;  3OBV A;  4JKQ A;  2Z6G A;  3K7W A;  4P6Z B;  1Q1T C;  3LWW A;  4MZ5 E;  4IMI A;  2JKT A;  1EJL I;  3IBV A;  3NMZ A;  4HTV A;  1LRV A;  5BZV A;  4FZA A;  3BVS A;  2BNX A;  3VLE A;  2Z6H A;  1EJY I;  3Q0Q A;  2YNR A;  3L6Y A;  3ZHP A;  3GAE A;  3DAD A;  3K5Y A;  3K61 A;  1PJN B;  1EE5 A;  4MFV A;  5KL8 A;  4D4E A;  5AEI A;  2JAK A;  3EA5 B;  3SL9 A;  4BA3 A;  3LTJ A;  4I37 A;  2NPP B;  1TH1 A;  4EVA A;  1XQS A;  5CL3 A;  4GMN A;  5KUB A;  3T8S A;  3JY1 A;  3JXY A;  4UQI A;  4I8M A;  3V6Y A;  4I7I A;  4MZ6 E;  4FFB C;  4CB8 A;  3GNI A;  4FZD A;  5SVZ A;  3WYF C;  3UKY B;  5SWF A;  3QML C;  2VGL A;  4I1E A;  4U3J C;  3PST A;  1LUJ A;  4EV8 A;  4L7M A;  3ZIR A;  5HUW C;  4V3O A;  2NYL A;  1UKL A;  4P6Z G;  3TPO A;  4OO6 A;  5H2X A;  4YJL A;  1U6G C;  4CV5 B;  2P8Q A;  3Q0S A;  3UKX B;  3C2H A;  4H3K A;  1I7X A;  4NZW A;  3UJ0 A;  3ODS A;  5CLC A;  2W3C A;  5BZ1 A;  3VLD A;  2BCT A;  3UKW B;  3TJZ B;  4UWX A;  3BSX A;  2NYM B;  4I3N A;  4UAF B;  2X1G F;  3W3U A;  2FV2 A;  4K6J A;  3O4X A;  4B8J A;  2YNS A;  5CL8 A;  5CL9 A;  3OQS A;  5KLR B;  1Y2A C;  2RU4 A;  1O6O A;  4HXT A;  4QMI A;  4OIH A;  4MFU A;  4ADY A;  3NOW A;  3GB8 A;  2WTK A;  4DZS A;  3QG9 A;  4I96 A;  2YJY A;  3GRL A;  1WA5 C;  4G3A A;  3TT9 A;  4CT7 B;  3EBB A;  1G3J A;  1IBR B;  3FEY C;  4BPL A;  2QK1 A;  4JW2 B;  2JKT B;  5CL5 A;  2Z5K A;  1W63 A;  4U58 A;  4EV9 A;  3V74 A;  3Q0R A;  3Q0M A;  3ODR A;  4HM9 A;  4I5L A;  1BK5 A;  1I7W A;  2JKR B;  3ZIO A;  1HO8 A;  4CBA A;  4I6I A;  5EKF A;  1Z2C B;  4JW3 C;  4QMH A;  4NEE A;  4RV1 A;  5BZU A;  4L4I A;  4A3T A;  5K6S A;  3T7U A;  1UPL A;  3VLF A;  5CLD A;  2X19 B;  5CLE A;  1LSH A;  4D49 A;  4ZDU A;  3ZIN A;  3L3F X;  3WPT A;  1QGK A;  1V18 A;  2IWH A;  4IMJ A;  1QGR A;  4B8P A;  2BKU B;  4I2S A;  5CLA A;  4UQI B;  1JPW A;  3ZIK A;  3QHE A;  4DB8 A;  4QMJ A;  3O2Q A;  3FEX C;  5E6Q B;  1M8Y A;  2Z5M A;  3Q0P A;  2C1T A;  3UKZ B;  4I2Z A;  3ZIL A;  5CL7 A;  2VGL B;  4U2X D;  1M8Z A;  2Q5D A;  1XQR A;  1B3U A;  3NMX A;  2XOA A;  4O27 A;  3VE6 A;  4R10 A;  4PLR A;  4PVZ A;  3O2S A;  4R0Z A;  3K4E A;  1UN0 A;  4H3H A;  3V71 A;  3L3Q A;  3GS3 A;  4I5N A;  2XA7 A;  3UL1 B;  5KL1 A;  3BWT A;  5HUY C;  1UPK A;  3TX7 A;  4U54 A;  3K49 A;  3UVU A;  2IAE B;  4LAC A;  4BQK A;  4V3R A;  3K62 A;  1PJM B;  2QK2 A;  3WOZ A;  4E4V A;  2GL7 A;  5CL6 A;  4B8O A;  3KND A;  3FGA B;  3BX3 A;  5B56 A;  4KZG A;  4U5S A;  3BSB A;  2Z5N A;  3GQ2 A;  1TE4 A;  4CRU B;  1BK6 A; 
#chains in the Genus database with same CATH homology
 3K5Z A;  3OUW A;  2Z5O A;  4XZR B;  3BCT A;  1QZ7 A;  1WA5 B;  3TJ3 A;  4K92 A;  3WOY A;  3Q0L A;  5J3V A;  1F59 A;  4FP7 A;  5JJA A;  3AU3 A;  3NMW A;  5DN7 A;  2H4M A;  2IE3 A;  4YGX A;  4CB9 A;  3DW8 A;  5KLT B;  2DB0 A;  1IAL A;  1W63 B;  2Z5J A;  3K7V A;  2OT8 A;  4CRV B;  3OUX A;  2IX3 A;  1Q1S C;  4DBA A;  1T08 A;  4U5N A;  5D5K C;  3K5Q A;  4HNM A;  3ZKV A;  4DB6 A;  3SLA A;  2QMR A;  1GCJ A;  4JW2 A;  4JLQ A;  3BTR C;  5CLB A;  4EVP A;  3Q5U A;  5BZ5 A;  3UL0 B;  3LTM A;  2JDQ A;  4GMO A;  3ZIP A;  4FQ3 A;  4DB9 A;  4U5V A;  3VWA A;  2JKR A;  4PLS A;  5CL4 A;  1JDH A;  4RXH B;  4I2W A;  1M1E A;  3JX7 A;  4FZF A;  3Q0O A;  5HHG E;  4A0C A;  5EWP A;  1IB2 A;  3GVT A;  3RZX A;  5BYM A;  1IQ1 C;  2PKG A;  3PSP A;  3Q0N A;  2OF3 A;  4V3Q A;  5SW9 A;  3RZ9 A;  3QGC A;  2NPP A;  1O6P A;  3ZIQ A;  1EE4 A;  5CTT A;  4YI0 C;  4YK6 A;  2NYL B;  4CT6 B;  4B18 A;  1QBK B;  4FDD A;  4EVT A;  1OYZ A;  2IE4 A;  4RZP A;  5K9S A;  3JXZ A;  3BX2 A;  4UAE A;  5H2W A;  4DJS A;  2QNA A;  1W9C A;  4YJE A;  3TPM A;  2XA7 B;  1XM9 A;  4I0Y A;  3C5W A;  4U5U A;  3H3D X;  5KLA A;  3EG5 B;  1M8X A;  3GVO A;  4U5L A;  3C2G A;  4PLQ A;  2RU4 B;  3K64 A;  1JPP A;  3O2T A;  2BAP A;  2C1M A;  5EKG A;  4TNM A;  2IW3 A;  4A3V A;  2IAE A;  4U5O A;  2PF4 A;  2NYM A;  2F31 A;  4Y5J A;  3A6P A;  5FC8 E;  5LSW A;  4DVG B;  3L6X A;  3FGA A;  3QGB A;  1M5N S;  3OPB A;  4R11 A;  4WV6 A;  3ND2 A;  1M8W A;  4L4H A;  4UAD A;  3IFQ A;  3OBV A;  4JKQ A;  2Z6G A;  3K7W A;  4P6Z B;  1Q1T C;  3LWW A;  4MZ5 E;  4IMI A;  2JKT A;  1EJL I;  3IBV A;  3NMZ A;  4HTV A;  1LRV A;  5BZV A;  4FZA A;  3BVS A;  2BNX A;  3VLE A;  2Z6H A;  1EJY I;  3Q0Q A;  2YNR A;  3L6Y A;  3ZHP A;  3GAE A;  3DAD A;  3K5Y A;  3K61 A;  1PJN B;  1EE5 A;  4MFV A;  5KL8 A;  4D4E A;  5AEI A;  2JAK A;  3EA5 B;  3SL9 A;  4BA3 A;  3LTJ A;  4I37 A;  2NPP B;  1TH1 A;  4EVA A;  1XQS A;  5CL3 A;  4GMN A;  5KUB A;  3JY1 A;  3JXY A;  4UQI A;  4I8M A;  3V6Y A;  4I7I A;  4MZ6 E;  4FFB C;  4CB8 A;  3GNI A;  4FZD A;  5SVZ A;  3WYF C;  3UKY B;  5SWF A;  3QML C;  2VGL A;  4I1E A;  4U3J C;  3PST A;  1LUJ A;  4EV8 A;  4L7M A;  3ZIR A;  5HUW C;  4V3O A;  2NYL A;  1UKL A;  4P6Z G;  3TPO A;  4OO6 A;  5H2X A;  4YJL A;  1U6G C;  4CV5 B;  2P8Q A;  3Q0S A;  3UKX B;  3C2H A;  4H3K A;  1I7X A;  4NZW A;  3ODS A;  5CLC A;  2W3C A;  5BZ1 A;  3VLD A;  2BCT A;  3UKW B;  3TJZ B;  4UWX A;  3BSX A;  2NYM B;  4I3N A;  4UAF B;  2X1G F;  3W3U A;  2FV2 A;  4K6J A;  3O4X A;  4B8J A;  2YNS A;  5CL8 A;  5CL9 A;  3OQS A;  5KLR B;  1Y2A C;  2RU4 A;  1O6O A;  4HXT A;  4QMI A;  4OIH A;  4MFU A;  4ADY A;  3NOW A;  3GB8 A;  2WTK A;  4DZS A;  3QG9 A;  4I96 A;  2YJY A;  3GRL A;  1WA5 C;  4G3A A;  3TT9 A;  4CT7 B;  3EBB A;  1G3J A;  1IBR B;  3FEY C;  4BPL A;  2QK1 A;  4JW2 B;  2JKT B;  5CL5 A;  2Z5K A;  1W63 A;  4U58 A;  4EV9 A;  3V74 A;  3Q0R A;  3Q0M A;  3ODR A;  4HM9 A;  4I5L A;  1BK5 A;  1I7W A;  2JKR B;  3ZIO A;  1HO8 A;  4CBA A;  4I6I A;  5EKF A;  1Z2C B;  4JW3 C;  4QMH A;  4NEE A;  4RV1 A;  5BZU A;  4L4I A;  4A3T A;  5K6S A;  3T7U A;  3VLF A;  1UPL A;  5CLD A;  2X19 B;  5CLE A;  4D49 A;  4ZDU A;  3ZIN A;  3L3F X;  3WPT A;  1QGK A;  1V18 A;  2IWH A;  4IMJ A;  1QGR A;  4B8P A;  2BKU B;  4I2S A;  5CLA A;  4UQI B;  1JPW A;  3ZIK A;  3QHE A;  4DB8 A;  4QMJ A;  3O2Q A;  3FEX C;  5E6Q B;  1M8Y A;  2Z5M A;  3Q0P A;  2C1T A;  3UKZ B;  4I2Z A;  3ZIL A;  5CL7 A;  2VGL B;  4U2X D;  1M8Z A;  2Q5D A;  1XQR A;  1B3U A;  3NMX A;  2XOA A;  4O27 A;  3VE6 A;  4R10 A;  4PLR A;  4PVZ A;  3O2S A;  4R0Z A;  3K4E A;  1UN0 A;  4H3H A;  3V71 A;  3L3Q A;  3GS3 A;  4I5N A;  2XA7 A;  3UL1 B;  5KL1 A;  3BWT A;  5HUY C;  1UPK A;  3TX7 A;  4U54 A;  3K49 A;  3UVU A;  2IAE B;  4LAC A;  4BQK A;  4V3R A;  3K62 A;  1PJM B;  2QK2 A;  3WOZ A;  4E4V A;  2GL7 A;  5CL6 A;  4B8O A;  3KND A;  3FGA B;  3BX3 A;  5B56 A;  4KZG A;  4U5S A;  3BSB A;  2Z5N A;  3GQ2 A;  1TE4 A;  4CRU B;  1BK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...