4V3RA

Designed armadillo repeat protein with 5 internal repeats, 2nd generation c-cap and 3rd generation n-cap.
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
281
structure length
281
Chain Sequence
ELPQMVQQLNSPDQQELQSALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords YIII_M5_AII
publication title Structures of Designed Armadillo-Repeat Proteins Show Propagation of Inter-Repeat Interface Effects
pubmed doi rcsb
source organism Synthetic construct
total genus 119
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 4v3rA00
1HO8A 3QHEA 3V71A 4G3AA 3TJ3A 2Q5DA 3ZIRA 4YJEA 4BQKA 1EE5A 2RU4B 2Z5JA 4B8JA 1IB2A 3FGAA 2IAEA 3UKWB 3UVUA 4V3QA 2OF3A 4PLSA 4QMHA 4PLRA 2IE4A 4R0ZA 5KL1A 3ODRA 3QGBA 3RZXA 4OIHA 1LRVA 3UKZB 3BCTA 2Z5NA 4U5NA 4I2ZA 5EKGA 1GCJA 2QNAA 5J3VA 1IALA 3UKXB 2FV2A 4EVPA 4U5VA 1Q1SC 1M5NS 3L3FX 3C2GA 4WV6A 1XQRA 4U5LA 4CV5B 3AU3A 4PLQA 4CT6B 3PSPA 2JAKA 3K49A 3EBBA 1XM9A 2XA7B 3ZIQA 1O6OA 4U58A 4DJSA 1OYZA 4FZFA 4YGXA 5EWPA 4RZPA 2IX3A 2NYMB 3L6XA 3LTJA 4GMOA 4HTVA 4A0CA 3Q0QA 3O2QA 4YI0C 5KLAA 4DB6A 4U3JC 3UL0B 3RZ9A 5H2XA 1IQ1C 4IMIA 3V6YA 1UKLA 2Z5MA 3OUXA 4O27A 3K62A 1WA5C 4BPLA 2YNRA 3K7VA 2NYLB 1TH1A 1O6PA 5B56A 4U5UA 2NPPA 3C5WA 1EJLI 3WPTA 3UL1B 3H3DX 4H3HA 5JJAA 4R10A 1M8ZA 5BZ1A 4JW2B 3GRLA 1BK5A 4CT7B 4NZWA 2JKRB 2JKTA 1M8WA 1Q1TC 4P6ZG 1PJMB 4QMJA 3WYFC 2F31A 2VGLA 4K6JA 2BAPA 5HUYC 2GL7A 2X1GF 4CB9A 4I2WA 1WA5B 3FGAB 2IAEB 1JPPA 4UWXA 3Q0OA 4MFUA 5FC8E 1PJNB 5SWFA 1T08A 4YK6A 3EG5B 1W63A 4V3OA 4FDDA 1F59A 4U5OA 4RXHB 3NMXA 3O2SA 3TPOA 1UPLA 3TT9A 4K92A 3BX2A 2QK2A 4L7MA 1V18A 3GAEA 5LSWA 4UQIA 3DADA 3TPMA 3K4EA 5CTTA 3QMLC 3VE6A 3ZIOA 4MZ6E 3VWAA 2BCTA 1M1EA 4HXTA 2WTKA 3Q0RA 1QBKB 1QGKA 3WOZA 1M8YA 4B8PA 1G3JA 1IBRB 4IMJA 2IE3A 2YJYA 4UAEA 4PVZA 5KLTB 1UN0A 3LWWA 5EKFA 5BZUA 2X19B 3IFQA 4XZRB 1EE4A 4E4VA 2PF4A 4I5NA 3K61A 4DBAA 4I5LA 3C2HA 4TNMA 2QMRA 3TX7A 3O4XA 3Q0MA 3WOYA 5BZ5A 3Q0SA 5HUWC 4CRVB 5D5KC 3K5ZA 4FFBC 2Z5OA 3T7UA 2PKGA 3Q0PA 4CRUB 3ZIPA 4DZSA 3FEXC 1LUJA 5H2WA 1JDHA 4FZDA 1I7XA 5AEIA 4FQ3A 2RU4A 3BWTA 4U54A 4ADYA 3PSTA 2NPPB 3K5YA 3L3QA 3Q0LA 3GS3A 1EJYI 4Y5JA 3W3UA 3ZINA 4DVGB 3V74A 2H4MA 4EVAA 5BZVA 2JDQA 4MFVA 4V3RA 3Q5UA 4JLQA 2JKTB 4ZDUA 4P6ZB 3ND2A 4YJLA 4HNMA 4U5SA 3BSBA 3UKYB 3QGCA 1UPKA 4H3KA 4FZAA 4EV9A 2VGLB 2P8QA 4LACA 5KLRB 2Z6HA 2XA7A 2YNSA 1QZ7A 3BTRC 4UADA 2DB0A 3QG9A 2NYMA 3GVTA 3GNIA 4UAFB 3ZKVA 1W63B 4OO6A 4MZ5E 3NMZA 4KZGA 5BYMA 4RV1A 2C1TA 5KL8A 3K5QA 3O2TA 3K7WA 4HM9A 2IWHA 4B18A 4CB8A 4UQIB 3EA5B 3KNDA 2IW3A 1QGRA 3Q0NA 4NEEA 1M8XA 3TJZB 4GMNA 5DN7A 1JPWA 1XQSA 5SW9A 3K64A 2NYLA 3GQ2A 5E6QB 2W3CA 4EVTA 1BK6A 4DB8A 3FEYC 5HHGE 5SVZA 3BSXA 2Z6GA 1W9CA 1Y2AC 3OQSA 4CBAA 2Z5KA 2BNXA 3L6YA 3NOWA 3ODSA 3OPBA 4EV8A 1I7WA 1Z2CB 3NMWA 4DB9A 4B8OA 2QK1A 3OBVA 3BX3A 1U6GC 3IBVA 2JKRA 3A6PA 3DW8A 3LTMA 3ZHPA 5K9SA 2BKUB 3OUWA 3GB8A 3GVOA 4R11A 5K6SA 4BA3A 2C1MA 4D49A 4D4EA 2OT8A 4QMIA 1B3UA
chains in the Genus database with same CATH superfamily
1HO8A 3QHEA 3V71A 4G3AA 3TJ3A 5CL6A 2Q5DA 3ZIRA 4YJEA 4BQKA 1EE5A 2RU4B 2Z5JA 4B8JA 1IB2A 3FGAA 2IAEA 3UKWB 3UVUA 4V3QA 2OF3A 4PLSA 4QMHA 4PLRA 2IE4A 4R0ZA 5KL1A 1TE4A 3VLDA 3ODRA 3QGBA 3RZXA 4OIHA 1LRVA 3UKZB 4I3NA 3BCTA 4L4HA 2Z5NA 4U5NA 4I2ZA 3VLFA 5EKGA 1GCJA 2QNAA 5J3VA 1IALA 3UKXB 2FV2A 4EVPA 4U5VA 1Q1SC 1M5NS 3L3FX 5CLEA 3C2GA 4WV6A 1XQRA 4U5LA 4CV5B 3AU3A 4PLQA 4CT6B 3JY1A 3PSPA 2JAKA 3K49A 3EBBA 1XM9A 2XA7B 5KUBA 1O6OA 4U58A 3ZIQA 4DJSA 1OYZA 4FZFA 4YGXA 5EWPA 3SL9A 4RZPA 2IX3A 2NYMB 3L6XA 3LTJA 4GMOA 4HTVA 4A0CA 3Q0QA 3O2QA 4YI0C 5KLAA 4DB6A 4U3JC 3UL0B 3RZ9A 5CL9A 5H2XA 1IQ1C 5CL4A 4IMIA 3V6YA 1UKLA 2Z5MA 3OUXA 4O27A 3UJ4A 3K62A 4JKQA 1WA5C 4BPLA 2YNRA 3K7VA 2NYLB 1TH1A 1O6PA 5B56A 4U5UA 2NPPA 3C5WA 1EJLI 3WPTA 3BVSA 3UL1B 3H3DX 4H3HA 5JJAA 4R10A 1M8ZA 5BZ1A 4JW2B 3GRLA 1BK5A 4CT7B 4NZWA 2JKRB 2JKTA 1M8WA 1Q1TC 5CLAA 4P6ZG 4U2XD 4A3VA 1PJMB 4QMJA 3WYFC 2F31A 2VGLA 4K6JA 2BAPA 4I2SA 5HUYC 2GL7A 2X1GF 4CB9A 4I2WA 1WA5B 3FGAB 2IAEB 3T8SA 1JPPA 4UWXA 3Q0OA 5CL7A 4MFUA 5FC8E 1PJNB 5SWFA 1T08A 4YK6A 3EG5B 1W63A 4V3OA 4FDDA 1F59A 4U5OA 4RXHB 3NMXA 3O2SA 3TPOA 1UPLA 3TT9A 4K92A 3BX2A 2QK2A 4L7MA 1V18A 1LSHA 3GAEA 5LSWA 4UQIA 3DADA 3TPMA 3K4EA 5CTTA 3QMLC 3VE6A 3ZIOA 4MZ6E 4I6IA 3VWAA 2BCTA 1M1EA 4HXTA 2WTKA 3Q0RA 1QBKB 1QGKA 3WOZA 1M8YA 4B8PA 1G3JA 1IBRB 4IMJA 5CL3A 2IE3A 2YJYA 4UAEA 4PVZA 5KLTB 1UN0A 3LWWA 5EKFA 5BZUA 2X19B 3IFQA 4XZRB 1EE4A 4E4VA 2PF4A 4I5NA 3K61A 4DBAA 4I5LA 3C2HA 4TNMA 2QMRA 3TX7A 4A3TA 3O4XA 5CLDA 3Q0MA 3WOYA 5BZ5A 3Q0SA 5HUWC 4CRVB 2XOAA 5D5KC 3K5ZA 4FFBC 2Z5OA 3T7UA 2PKGA 3Q0PA 4JW3C 3VLEA 4CRUB 3ZIPA 4FP7A 4DZSA 3FEXC 1LUJA 5H2WA 1JDHA 4FZDA 1I7XA 5AEIA 4I1EA 4FQ3A 2RU4A 3BWTA 5CL5A 4U54A 4ADYA 3PSTA 2NPPB 3K5YA 5CL8A 3L3QA 3Q0LA 3GS3A 1EJYI 4Y5JA 3W3UA 3ZINA 4DVGB 3V74A 2H4MA 4EVAA 5BZVA 2JDQA 4MFVA 4V3RA 3Q5UA 4JLQA 2JKTB 5CLCA 4I0YA 4ZDUA 4P6ZB 3ND2A 4YJLA 4HNMA 4U5SA 3BSBA 3UKYB 3ZIKA 3QGCA 1UPKA 4H3KA 4FZAA 4EV9A 2VGLB 2P8QA 4LACA 5KLRB 3JX7A 2Z6HA 2XA7A 2YNSA 1QZ7A 3BTRC 4UADA 2DB0A 3ZILA 3QG9A 2NYMA 3GVTA 3GNIA 4UAFB 3ZKVA 1W63B 4OO6A 4MZ5E 3NMZA 4KZGA 5BYMA 4RV1A 3UJ0A 4I7IA 2C1TA 4I8MA 5KL8A 3K5QA 3O2TA 3K7WA 3SLAA 4HM9A 2IWHA 4B18A 4CB8A 4L4IA 4UQIB 3EA5B 3KNDA 2IW3A 1QGRA 3Q0NA 4NEEA 1M8XA 3TJZB 4GMNA 5DN7A 1N4KA 1JPWA 1XQSA 5SW9A 3K64A 2NYLA 3GQ2A 5E6QB 3JXYA 2W3CA 4EVTA 1BK6A 4DB8A 3FEYC 5HHGE 5SVZA 3BSXA 2Z6GA 1W9CA 1Y2AC 3OQSA 4CBAA 2Z5KA 2BNXA 3L6YA 3NOWA 3ODSA 3OPBA 4EV8A 4JW2A 1I7WA 1Z2CB 3NMWA 4DB9A 4B8OA 2QK1A 3OBVA 3BX3A 1U6GC 3IBVA 2JKRA 3A6PA 4I37A 3DW8A 3LTMA 3ZHPA 5CLBA 5K9SA 2BKUB 3OUWA 3GB8A 3GVOA 4R11A 5K6SA 4BA3A 3JXZA 2C1MA 4I96A 4D49A 4D4EA 2OT8A 4QMIA 1B3UA
chains in the Genus database with same CATH topology
1HO8A 3QHEA 3V71A 4G3AA 3TJ3A 5CL6A 2Q5DA 3ZIRA 4YJEA 4BQKA 1EE5A 2RU4B 2Z5JA 4B8JA 1IB2A 3FGAA 2IAEA 3UKWB 3UVUA 4V3QA 2OF3A 4PLSA 4QMHA 4PLRA 2IE4A 4R0ZA 5KL1A 1TE4A 3VLDA 3ODRA 3QGBA 3RZXA 4OIHA 1LRVA 3UKZB 4I3NA 3BCTA 4L4HA 2Z5NA 4U5NA 4I2ZA 3VLFA 5EKGA 1GCJA 2QNAA 5J3VA 1IALA 3UKXB 2FV2A 4EVPA 4U5VA 1Q1SC 1M5NS 3L3FX 5CLEA 3C2GA 4WV6A 1XQRA 4U5LA 4CV5B 3AU3A 4PLQA 4CT6B 3JY1A 3PSPA 2JAKA 3K49A 3EBBA 1XM9A 2XA7B 5KUBA 1O6OA 4U58A 3ZIQA 4DJSA 1OYZA 4FZFA 4YGXA 5EWPA 3SL9A 4RZPA 2IX3A 2NYMB 3L6XA 3LTJA 4GMOA 4HTVA 4A0CA 3Q0QA 3O2QA 4YI0C 5KLAA 4DB6A 4U3JC 3UL0B 3RZ9A 5CL9A 5H2XA 1IQ1C 5CL4A 4IMIA 3V6YA 1UKLA 2Z5MA 3OUXA 4O27A 3K62A 4JKQA 1WA5C 4BPLA 2YNRA 3K7VA 2NYLB 1TH1A 1O6PA 5B56A 4U5UA 2NPPA 3C5WA 1EJLI 3WPTA 3BVSA 3UL1B 3H3DX 4H3HA 5JJAA 4R10A 1M8ZA 5BZ1A 4JW2B 3GRLA 1BK5A 4CT7B 4NZWA 2JKRB 2JKTA 1M8WA 1Q1TC 5CLAA 4P6ZG 4U2XD 4A3VA 1PJMB 4QMJA 3WYFC 2F31A 2VGLA 4K6JA 2BAPA 4I2SA 5HUYC 2GL7A 2X1GF 4CB9A 4I2WA 1WA5B 3FGAB 2IAEB 1JPPA 4UWXA 3Q0OA 5CL7A 4MFUA 5FC8E 1PJNB 5SWFA 1T08A 4YK6A 3EG5B 1W63A 4V3OA 4FDDA 1F59A 4U5OA 4RXHB 3NMXA 3O2SA 3TPOA 1UPLA 3TT9A 4K92A 3BX2A 2QK2A 4L7MA 1V18A 3GAEA 5LSWA 4UQIA 3DADA 3TPMA 3K4EA 5CTTA 3QMLC 3VE6A 3ZIOA 4MZ6E 4I6IA 3VWAA 2BCTA 1M1EA 4HXTA 2WTKA 3Q0RA 1QBKB 1QGKA 3WOZA 1M8YA 4B8PA 1G3JA 1IBRB 4IMJA 5CL3A 2IE3A 2YJYA 4UAEA 4PVZA 5KLTB 1UN0A 3LWWA 5EKFA 5BZUA 2X19B 3IFQA 4XZRB 1EE4A 4E4VA 2PF4A 4I5NA 3K61A 4DBAA 4I5LA 3C2HA 4TNMA 2QMRA 3TX7A 4A3TA 3O4XA 5CLDA 3Q0MA 3WOYA 5BZ5A 3Q0SA 5HUWC 4CRVB 2XOAA 5D5KC 3K5ZA 4FFBC 2Z5OA 3T7UA 2PKGA 3Q0PA 4JW3C 3VLEA 4CRUB 3ZIPA 4FP7A 4DZSA 3FEXC 1LUJA 5H2WA 1JDHA 4FZDA 1I7XA 5AEIA 4I1EA 4FQ3A 2RU4A 3BWTA 5CL5A 4U54A 4ADYA 3PSTA 2NPPB 3K5YA 5CL8A 3L3QA 3Q0LA 3GS3A 1EJYI 4Y5JA 3W3UA 3ZINA 4DVGB 3V74A 2H4MA 4EVAA 5BZVA 2JDQA 4MFVA 4V3RA 3Q5UA 4JLQA 2JKTB 5CLCA 4I0YA 4ZDUA 4P6ZB 3ND2A 4YJLA 4HNMA 4U5SA 3BSBA 3UKYB 3ZIKA 3QGCA 1UPKA 4H3KA 4FZAA 4EV9A 2VGLB 2P8QA 4LACA 5KLRB 3JX7A 2Z6HA 2XA7A 2YNSA 1QZ7A 3BTRC 4UADA 2DB0A 3ZILA 3QG9A 2NYMA 3GVTA 3GNIA 4UAFB 3ZKVA 1W63B 4OO6A 4MZ5E 3NMZA 4KZGA 5BYMA 4RV1A 4I7IA 2C1TA 4I8MA 5KL8A 3K5QA 3O2TA 3K7WA 3SLAA 4HM9A 2IWHA 4B18A 4CB8A 4L4IA 4UQIB 3EA5B 3KNDA 2IW3A 1QGRA 3Q0NA 4NEEA 1M8XA 3TJZB 4GMNA 5DN7A 1JPWA 1XQSA 5SW9A 3K64A 2NYLA 3GQ2A 5E6QB 3JXYA 2W3CA 4EVTA 1BK6A 4DB8A 3FEYC 5HHGE 5SVZA 3BSXA 2Z6GA 1W9CA 1Y2AC 3OQSA 4CBAA 2Z5KA 2BNXA 3L6YA 3NOWA 3ODSA 3OPBA 4EV8A 4JW2A 1I7WA 1Z2CB 3NMWA 4DB9A 4B8OA 2QK1A 3OBVA 3BX3A 1U6GC 3IBVA 2JKRA 3A6PA 4I37A 3DW8A 3LTMA 3ZHPA 5CLBA 5K9SA 2BKUB 3OUWA 3GB8A 3GVOA 4R11A 5K6SA 4BA3A 3JXZA 2C1MA 4I96A 4D49A 4D4EA 2OT8A 4QMIA 1B3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HO8 A;  3QHE A;  3V71 A;  4G3A A;  3TJ3 A;  2Q5D A;  3ZIR A;  4YJE A;  4BQK A;  1EE5 A;  2RU4 B;  2Z5J A;  4B8J A;  1IB2 A;  3FGA A;  2IAE A;  3UKW B;  3UVU A;  4V3Q A;  2OF3 A;  4PLS A;  4QMH A;  4PLR A;  2IE4 A;  4R0Z A;  5KL1 A;  3ODR A;  3QGB A;  3RZX A;  4OIH A;  1LRV A;  3UKZ B;  3BCT A;  2Z5N A;  4U5N A;  4I2Z A;  5EKG A;  1GCJ A;  2QNA A;  5J3V A;  1IAL A;  3UKX B;  2FV2 A;  4EVP A;  4U5V A;  1Q1S C;  1M5N S;  3L3F X;  3C2G A;  4WV6 A;  1XQR A;  4U5L A;  4CV5 B;  3AU3 A;  4PLQ A;  4CT6 B;  3PSP A;  2JAK A;  3K49 A;  3EBB A;  1XM9 A;  2XA7 B;  3ZIQ A;  1O6O A;  4U58 A;  4DJS A;  1OYZ A;  4FZF A;  4YGX A;  5EWP A;  4RZP A;  2IX3 A;  2NYM B;  3L6X A;  3LTJ A;  4GMO A;  4HTV A;  4A0C A;  3Q0Q A;  3O2Q A;  4YI0 C;  5KLA A;  4DB6 A;  4U3J C;  3UL0 B;  3RZ9 A;  5H2X A;  1IQ1 C;  4IMI A;  3V6Y A;  1UKL A;  2Z5M A;  3OUX A;  4O27 A;  3K62 A;  1WA5 C;  4BPL A;  2YNR A;  3K7V A;  2NYL B;  1TH1 A;  1O6P A;  5B56 A;  4U5U A;  2NPP A;  3C5W A;  1EJL I;  3WPT A;  3UL1 B;  3H3D X;  4H3H A;  5JJA A;  4R10 A;  1M8Z A;  5BZ1 A;  4JW2 B;  3GRL A;  1BK5 A;  4CT7 B;  4NZW A;  2JKR B;  2JKT A;  1M8W A;  1Q1T C;  4P6Z G;  1PJM B;  4QMJ A;  3WYF C;  2F31 A;  2VGL A;  4K6J A;  2BAP A;  5HUY C;  2GL7 A;  2X1G F;  4CB9 A;  4I2W A;  1WA5 B;  3FGA B;  2IAE B;  1JPP A;  4UWX A;  3Q0O A;  4MFU A;  5FC8 E;  1PJN B;  5SWF A;  1T08 A;  4YK6 A;  3EG5 B;  1W63 A;  4V3O A;  4FDD A;  1F59 A;  4U5O A;  4RXH B;  3NMX A;  3O2S A;  3TPO A;  1UPL A;  3TT9 A;  4K92 A;  3BX2 A;  2QK2 A;  4L7M A;  1V18 A;  3GAE A;  5LSW A;  4UQI A;  3DAD A;  3TPM A;  3K4E A;  5CTT A;  3QML C;  3VE6 A;  3ZIO A;  4MZ6 E;  3VWA A;  2BCT A;  1M1E A;  4HXT A;  2WTK A;  3Q0R A;  1QBK B;  1QGK A;  3WOZ A;  1M8Y A;  4B8P A;  1G3J A;  1IBR B;  4IMJ A;  2IE3 A;  2YJY A;  4UAE A;  4PVZ A;  5KLT B;  1UN0 A;  3LWW A;  5EKF A;  5BZU A;  2X19 B;  3IFQ A;  4XZR B;  1EE4 A;  4E4V A;  2PF4 A;  4I5N A;  3K61 A;  4DBA A;  4I5L A;  3C2H A;  4TNM A;  2QMR A;  3TX7 A;  3O4X A;  3Q0M A;  3WOY A;  5BZ5 A;  3Q0S A;  5HUW C;  4CRV B;  5D5K C;  3K5Z A;  4FFB C;  2Z5O A;  3T7U A;  2PKG A;  3Q0P A;  4CRU B;  3ZIP A;  4DZS A;  3FEX C;  1LUJ A;  5H2W A;  1JDH A;  4FZD A;  1I7X A;  5AEI A;  4FQ3 A;  2RU4 A;  3BWT A;  4U54 A;  4ADY A;  3PST A;  2NPP B;  3K5Y A;  3L3Q A;  3Q0L A;  3GS3 A;  1EJY I;  4Y5J A;  3W3U A;  3ZIN A;  4DVG B;  3V74 A;  2H4M A;  4EVA A;  5BZV A;  2JDQ A;  4MFV A;  4V3R A;  3Q5U A;  4JLQ A;  2JKT B;  4ZDU A;  4P6Z B;  3ND2 A;  4YJL A;  4HNM A;  4U5S A;  3BSB A;  3UKY B;  3QGC A;  1UPK A;  4H3K A;  4FZA A;  4EV9 A;  2VGL B;  2P8Q A;  4LAC A;  5KLR B;  2Z6H A;  2XA7 A;  2YNS A;  1QZ7 A;  3BTR C;  4UAD A;  2DB0 A;  3QG9 A;  2NYM A;  3GVT A;  3GNI A;  4UAF B;  3ZKV A;  1W63 B;  4OO6 A;  4MZ5 E;  3NMZ A;  4KZG A;  5BYM A;  4RV1 A;  2C1T A;  5KL8 A;  3K5Q A;  3O2T A;  3K7W A;  4HM9 A;  2IWH A;  4B18 A;  4CB8 A;  4UQI B;  3EA5 B;  3KND A;  2IW3 A;  1QGR A;  3Q0N A;  4NEE A;  1M8X A;  3TJZ B;  4GMN A;  5DN7 A;  1JPW A;  1XQS A;  5SW9 A;  3K64 A;  2NYL A;  3GQ2 A;  5E6Q B;  2W3C A;  4EVT A;  1BK6 A;  4DB8 A;  3FEY C;  5HHG E;  5SVZ A;  3BSX A;  2Z6G A;  1W9C A;  1Y2A C;  3OQS A;  4CBA A;  2Z5K A;  2BNX A;  3L6Y A;  3NOW A;  3ODS A;  3OPB A;  4EV8 A;  1I7W A;  1Z2C B;  3NMW A;  4DB9 A;  4B8O A;  2QK1 A;  3OBV A;  3BX3 A;  1U6G C;  3IBV A;  2JKR A;  3A6P A;  3DW8 A;  3LTM A;  3ZHP A;  5K9S A;  2BKU B;  3OUW A;  3GB8 A;  3GVO A;  4R11 A;  5K6S A;  4BA3 A;  2C1M A;  4D49 A;  4D4E A;  2OT8 A;  4QMI A;  1B3U A; 
#chains in the Genus database with same CATH topology
 1HO8 A;  3QHE A;  3V71 A;  4G3A A;  3TJ3 A;  5CL6 A;  2Q5D A;  3ZIR A;  4YJE A;  4BQK A;  1EE5 A;  2RU4 B;  2Z5J A;  4B8J A;  1IB2 A;  3FGA A;  2IAE A;  3UKW B;  3UVU A;  4V3Q A;  2OF3 A;  4PLS A;  4QMH A;  4PLR A;  2IE4 A;  4R0Z A;  5KL1 A;  1TE4 A;  3VLD A;  3ODR A;  3QGB A;  3RZX A;  4OIH A;  1LRV A;  3UKZ B;  4I3N A;  3BCT A;  4L4H A;  2Z5N A;  4U5N A;  4I2Z A;  3VLF A;  5EKG A;  1GCJ A;  2QNA A;  5J3V A;  1IAL A;  3UKX B;  2FV2 A;  4EVP A;  4U5V A;  1Q1S C;  1M5N S;  3L3F X;  5CLE A;  3C2G A;  4WV6 A;  1XQR A;  4U5L A;  4CV5 B;  3AU3 A;  4PLQ A;  4CT6 B;  3JY1 A;  3PSP A;  2JAK A;  3K49 A;  3EBB A;  1XM9 A;  2XA7 B;  5KUB A;  1O6O A;  4U58 A;  3ZIQ A;  4DJS A;  1OYZ A;  4FZF A;  4YGX A;  5EWP A;  3SL9 A;  4RZP A;  2IX3 A;  2NYM B;  3L6X A;  3LTJ A;  4GMO A;  4HTV A;  4A0C A;  3Q0Q A;  3O2Q A;  4YI0 C;  5KLA A;  4DB6 A;  4U3J C;  3UL0 B;  3RZ9 A;  5CL9 A;  5H2X A;  1IQ1 C;  5CL4 A;  4IMI A;  3V6Y A;  1UKL A;  2Z5M A;  3OUX A;  4O27 A;  3UJ4 A;  3K62 A;  4JKQ A;  1WA5 C;  4BPL A;  2YNR A;  3K7V A;  2NYL B;  1TH1 A;  1O6P A;  5B56 A;  4U5U A;  2NPP A;  3C5W A;  1EJL I;  3WPT A;  3BVS A;  3UL1 B;  3H3D X;  4H3H A;  5JJA A;  4R10 A;  1M8Z A;  5BZ1 A;  4JW2 B;  3GRL A;  1BK5 A;  4CT7 B;  4NZW A;  2JKR B;  2JKT A;  1M8W A;  1Q1T C;  5CLA A;  4P6Z G;  4U2X D;  4A3V A;  1PJM B;  4QMJ A;  3WYF C;  2F31 A;  2VGL A;  4K6J A;  2BAP A;  4I2S A;  5HUY C;  2GL7 A;  2X1G F;  4CB9 A;  4I2W A;  1WA5 B;  3FGA B;  2IAE B;  3T8S A;  1JPP A;  4UWX A;  3Q0O A;  5CL7 A;  4MFU A;  5FC8 E;  1PJN B;  5SWF A;  1T08 A;  4YK6 A;  3EG5 B;  1W63 A;  4V3O A;  4FDD A;  1F59 A;  4U5O A;  4RXH B;  3NMX A;  3O2S A;  3TPO A;  1UPL A;  3TT9 A;  4K92 A;  3BX2 A;  2QK2 A;  4L7M A;  1V18 A;  1LSH A;  3GAE A;  5LSW A;  4UQI A;  3DAD A;  3TPM A;  3K4E A;  5CTT A;  3QML C;  3VE6 A;  3ZIO A;  4MZ6 E;  4I6I A;  3VWA A;  2BCT A;  1M1E A;  4HXT A;  2WTK A;  3Q0R A;  1QBK B;  1QGK A;  3WOZ A;  1M8Y A;  4B8P A;  1G3J A;  1IBR B;  4IMJ A;  5CL3 A;  2IE3 A;  2YJY A;  4UAE A;  4PVZ A;  5KLT B;  1UN0 A;  3LWW A;  5EKF A;  5BZU A;  2X19 B;  3IFQ A;  4XZR B;  1EE4 A;  4E4V A;  2PF4 A;  4I5N A;  3K61 A;  4DBA A;  4I5L A;  3C2H A;  4TNM A;  2QMR A;  3TX7 A;  4A3T A;  3O4X A;  5CLD A;  3Q0M A;  3WOY A;  5BZ5 A;  3Q0S A;  5HUW C;  4CRV B;  2XOA A;  5D5K C;  3K5Z A;  4FFB C;  2Z5O A;  3T7U A;  2PKG A;  3Q0P A;  4JW3 C;  3VLE A;  4CRU B;  3ZIP A;  4FP7 A;  4DZS A;  3FEX C;  1LUJ A;  5H2W A;  1JDH A;  4FZD A;  1I7X A;  5AEI A;  4I1E A;  4FQ3 A;  2RU4 A;  3BWT A;  5CL5 A;  4U54 A;  4ADY A;  3PST A;  2NPP B;  3K5Y A;  5CL8 A;  3L3Q A;  3Q0L A;  3GS3 A;  1EJY I;  4Y5J A;  3W3U A;  3ZIN A;  4DVG B;  3V74 A;  2H4M A;  4EVA A;  5BZV A;  2JDQ A;  4MFV A;  4V3R A;  3Q5U A;  4JLQ A;  2JKT B;  5CLC A;  4I0Y A;  4ZDU A;  4P6Z B;  3ND2 A;  4YJL A;  4HNM A;  4U5S A;  3BSB A;  3UKY B;  3ZIK A;  3QGC A;  1UPK A;  4H3K A;  4FZA A;  4EV9 A;  2VGL B;  2P8Q A;  4LAC A;  5KLR B;  3JX7 A;  2Z6H A;  2XA7 A;  2YNS A;  1QZ7 A;  3BTR C;  4UAD A;  2DB0 A;  3ZIL A;  3QG9 A;  2NYM A;  3GVT A;  3GNI A;  4UAF B;  3ZKV A;  1W63 B;  4OO6 A;  4MZ5 E;  3NMZ A;  4KZG A;  5BYM A;  4RV1 A;  3UJ0 A;  4I7I A;  2C1T A;  4I8M A;  5KL8 A;  3K5Q A;  3O2T A;  3K7W A;  3SLA A;  4HM9 A;  2IWH A;  4B18 A;  4CB8 A;  4L4I A;  4UQI B;  3EA5 B;  3KND A;  2IW3 A;  1QGR A;  3Q0N A;  4NEE A;  1M8X A;  3TJZ B;  4GMN A;  5DN7 A;  1N4K A;  1JPW A;  1XQS A;  5SW9 A;  3K64 A;  2NYL A;  3GQ2 A;  5E6Q B;  3JXY A;  2W3C A;  4EVT A;  1BK6 A;  4DB8 A;  3FEY C;  5HHG E;  5SVZ A;  3BSX A;  2Z6G A;  1W9C A;  1Y2A C;  3OQS A;  4CBA A;  2Z5K A;  2BNX A;  3L6Y A;  3NOW A;  3ODS A;  3OPB A;  4EV8 A;  4JW2 A;  1I7W A;  1Z2C B;  3NMW A;  4DB9 A;  4B8O A;  2QK1 A;  3OBV A;  3BX3 A;  1U6G C;  3IBV A;  2JKR A;  3A6P A;  4I37 A;  3DW8 A;  3LTM A;  3ZHP A;  5CLB A;  5K9S A;  2BKU B;  3OUW A;  3GB8 A;  3GVO A;  4R11 A;  5K6S A;  4BA3 A;  3JXZ A;  2C1M A;  4I96 A;  4D49 A;  4D4E A;  2OT8 A;  4QMI A;  1B3U A; 
#chains in the Genus database with same CATH homology
 1HO8 A;  3QHE A;  3V71 A;  4G3A A;  3TJ3 A;  5CL6 A;  2Q5D A;  3ZIR A;  4YJE A;  4BQK A;  1EE5 A;  2RU4 B;  2Z5J A;  4B8J A;  1IB2 A;  3FGA A;  2IAE A;  3UKW B;  3UVU A;  4V3Q A;  2OF3 A;  4PLS A;  4QMH A;  4PLR A;  2IE4 A;  4R0Z A;  5KL1 A;  1TE4 A;  3VLD A;  3ODR A;  3QGB A;  3RZX A;  4OIH A;  1LRV A;  3UKZ B;  4I3N A;  3BCT A;  4L4H A;  2Z5N A;  4U5N A;  4I2Z A;  3VLF A;  5EKG A;  1GCJ A;  2QNA A;  5J3V A;  1IAL A;  3UKX B;  2FV2 A;  4EVP A;  4U5V A;  1Q1S C;  1M5N S;  3L3F X;  5CLE A;  3C2G A;  4WV6 A;  1XQR A;  4U5L A;  4CV5 B;  3AU3 A;  4PLQ A;  4CT6 B;  3JY1 A;  3PSP A;  2JAK A;  3K49 A;  3EBB A;  1XM9 A;  2XA7 B;  5KUB A;  1O6O A;  4U58 A;  3ZIQ A;  4DJS A;  1OYZ A;  4FZF A;  4YGX A;  5EWP A;  3SL9 A;  4RZP A;  2IX3 A;  2NYM B;  3L6X A;  3LTJ A;  4GMO A;  4HTV A;  4A0C A;  3Q0Q A;  3O2Q A;  4YI0 C;  5KLA A;  4DB6 A;  4U3J C;  3UL0 B;  3RZ9 A;  5CL9 A;  5H2X A;  1IQ1 C;  5CL4 A;  4IMI A;  3V6Y A;  1UKL A;  2Z5M A;  3OUX A;  4O27 A;  3K62 A;  4JKQ A;  1WA5 C;  4BPL A;  2YNR A;  3K7V A;  2NYL B;  1TH1 A;  1O6P A;  5B56 A;  4U5U A;  2NPP A;  3C5W A;  1EJL I;  3WPT A;  3BVS A;  3UL1 B;  3H3D X;  4H3H A;  5JJA A;  4R10 A;  1M8Z A;  5BZ1 A;  4JW2 B;  3GRL A;  1BK5 A;  4CT7 B;  4NZW A;  2JKR B;  2JKT A;  1M8W A;  1Q1T C;  5CLA A;  4P6Z G;  4U2X D;  4A3V A;  1PJM B;  4QMJ A;  3WYF C;  2F31 A;  2VGL A;  4K6J A;  2BAP A;  4I2S A;  5HUY C;  2GL7 A;  2X1G F;  4CB9 A;  4I2W A;  1WA5 B;  3FGA B;  2IAE B;  1JPP A;  4UWX A;  3Q0O A;  5CL7 A;  4MFU A;  5FC8 E;  1PJN B;  5SWF A;  1T08 A;  4YK6 A;  3EG5 B;  1W63 A;  4V3O A;  4FDD A;  1F59 A;  4U5O A;  4RXH B;  3NMX A;  3O2S A;  3TPO A;  1UPL A;  3TT9 A;  4K92 A;  3BX2 A;  2QK2 A;  4L7M A;  1V18 A;  3GAE A;  5LSW A;  4UQI A;  3DAD A;  3TPM A;  3K4E A;  5CTT A;  3QML C;  3VE6 A;  3ZIO A;  4MZ6 E;  4I6I A;  3VWA A;  2BCT A;  1M1E A;  4HXT A;  2WTK A;  3Q0R A;  1QBK B;  1QGK A;  3WOZ A;  1M8Y A;  4B8P A;  1G3J A;  1IBR B;  4IMJ A;  5CL3 A;  2IE3 A;  2YJY A;  4UAE A;  4PVZ A;  5KLT B;  1UN0 A;  3LWW A;  5EKF A;  5BZU A;  2X19 B;  3IFQ A;  4XZR B;  1EE4 A;  4E4V A;  2PF4 A;  4I5N A;  3K61 A;  4DBA A;  4I5L A;  3C2H A;  4TNM A;  2QMR A;  3TX7 A;  4A3T A;  3O4X A;  5CLD A;  3Q0M A;  3WOY A;  5BZ5 A;  3Q0S A;  5HUW C;  4CRV B;  2XOA A;  5D5K C;  3K5Z A;  4FFB C;  2Z5O A;  3T7U A;  2PKG A;  3Q0P A;  4JW3 C;  3VLE A;  4CRU B;  3ZIP A;  4FP7 A;  4DZS A;  3FEX C;  1LUJ A;  5H2W A;  1JDH A;  4FZD A;  1I7X A;  5AEI A;  4I1E A;  4FQ3 A;  2RU4 A;  3BWT A;  5CL5 A;  4U54 A;  4ADY A;  3PST A;  2NPP B;  3K5Y A;  5CL8 A;  3L3Q A;  3Q0L A;  3GS3 A;  1EJY I;  4Y5J A;  3W3U A;  3ZIN A;  4DVG B;  3V74 A;  2H4M A;  4EVA A;  5BZV A;  2JDQ A;  4MFV A;  4V3R A;  3Q5U A;  4JLQ A;  2JKT B;  5CLC A;  4I0Y A;  4ZDU A;  4P6Z B;  3ND2 A;  4YJL A;  4HNM A;  4U5S A;  3BSB A;  3UKY B;  3ZIK A;  3QGC A;  1UPK A;  4H3K A;  4FZA A;  4EV9 A;  2VGL B;  2P8Q A;  4LAC A;  5KLR B;  3JX7 A;  2Z6H A;  2XA7 A;  2YNS A;  1QZ7 A;  3BTR C;  4UAD A;  2DB0 A;  3ZIL A;  3QG9 A;  2NYM A;  3GVT A;  3GNI A;  4UAF B;  3ZKV A;  1W63 B;  4OO6 A;  4MZ5 E;  3NMZ A;  4KZG A;  5BYM A;  4RV1 A;  4I7I A;  2C1T A;  4I8M A;  5KL8 A;  3K5Q A;  3O2T A;  3K7W A;  3SLA A;  4HM9 A;  2IWH A;  4B18 A;  4CB8 A;  4L4I A;  4UQI B;  3EA5 B;  3KND A;  2IW3 A;  1QGR A;  3Q0N A;  4NEE A;  1M8X A;  3TJZ B;  4GMN A;  5DN7 A;  1JPW A;  1XQS A;  5SW9 A;  3K64 A;  2NYL A;  3GQ2 A;  5E6Q B;  3JXY A;  2W3C A;  4EVT A;  1BK6 A;  4DB8 A;  3FEY C;  5HHG E;  5SVZ A;  3BSX A;  2Z6G A;  1W9C A;  1Y2A C;  3OQS A;  4CBA A;  2Z5K A;  2BNX A;  3L6Y A;  3NOW A;  3ODS A;  3OPB A;  4EV8 A;  4JW2 A;  1I7W A;  1Z2C B;  3NMW A;  4DB9 A;  4B8O A;  2QK1 A;  3OBV A;  3BX3 A;  1U6G C;  3IBV A;  2JKR A;  3A6P A;  4I37 A;  3DW8 A;  3LTM A;  3ZHP A;  5CLB A;  5K9S A;  2BKU B;  3OUW A;  3GB8 A;  3GVO A;  4R11 A;  5K6S A;  4BA3 A;  3JXZ A;  2C1M A;  4I96 A;  4D49 A;  4D4E A;  2OT8 A;  4QMI A;  1B3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...