4XZRB

Structure of yeast importin a bound to the membrane protein nuclear localization signal sequence of inm protein heh1
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
423
structure length
423
Chain Sequence
AELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIETYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inner nuclear membrane protein SRC1
publication title Distinctive Properties of the Nuclear Localization Signals of Inner Nuclear Membrane Proteins Heh1 and Heh2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Membrane protein/nuclear protein
total genus 162
structure length 423
sequence length 423
ec nomenclature
pdb deposition date 2015-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00514 Arm Armadillo/beta-catenin-like repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 4xzrB00
3GVTA 4YK6A 4V3RA 4G3AA 1UKLA 3FEYC 4UAEA 3PSTA 3ZINA 1XM9A 3ZIOA 3RZXA 4CB8A 3W3UA 4A0CA 3OUXA 1QBKB 2YNRA 4QMIA 4Y5JA 1W63A 3NMZA 1LUJA 4B18A 2X19B 5LSWA 4R11A 2YNSA 3UVUA 4EVAA 2GL7A 3L6XA 2QNAA 4P6ZG 4U54A 3QHEA 4D49A 3WPTA 4U3JC 1JPPA 2X1GF 2RU4A 2VGLB 4I5NA 5K6SA 4DB8A 4EVPA 3Q0SA 2C1TA 3OUWA 3NMXA 1UPKA 3DADA 2OF3A 3GNIA 3Q5UA 3BSBA 5B56A 2DB0A 4D4EA 4B8OA 4QMHA 4MZ6E 5D5KC 3UKWB 5EKGA 3ZHPA 2PKGA 1QGRA 4HM9A 2PF4A 3Q0PA 1WA5C 3KNDA 4YJLA 5KLAA 4K92A 2Q5DA 3A6PA 1G3JA 3EBBA 2OT8A 3BWTA 2H4MA 1XQRA 2Z5OA 4CRUB 3L3FX 5KLRB 4WV6A 1T08A 2Z6HA 2W3CA 3FGAA 5E6QB 3Q0LA 2P8QA 2NYMB 4GMNA 4YI0C 1EJLI 4U58A 1F59A 4CB9A 1UPLA 3GQ2A 2IAEB 4CT7B 3ND2A 5BZVA 4CRVB 2NPPA 4E4VA 3K5YA 4DB6A 4HNMA 2BCTA 2JKTA 3BCTA 4CV5B 4UWXA 3O2QA 2NYLA 1LRVA 3O2TA 2FV2A 1Q1SC 1UN0A 4IMJA 1Q1TC 3K5ZA 4EV8A 3C2HA 4U5VA 3RZ9A 1IALA 3VWAA 4OO6A 2C1MA 2XA7B 3ZIRA 4UADA 4XZRB 3UKXB 1W63B 1WA5B 5K9SA 4L7MA 5EWPA 4K6JA 5DN7A 2Z5NA 3BTRC 4H3KA 4TNMA 3Q0MA 2JAKA 3QG9A 3TJ3A 3ZIQA 1M8ZA 3L3QA 4BQKA 3WOZA 4UAFB 4I2ZA 2JDQA 3L6YA 3DW8A 3K4EA 4U5SA 3ZKVA 3VE6A 2Z6GA 3TPOA 4CT6B 3EG5B 4I2WA 1O6OA 5J3VA 4R10A 3O4XA 4I5LA 3T7UA 5BZUA 2VGLA 4DJSA 3GB8A 3IBVA 3PSPA 5BZ5A 3WOYA 4GMOA 4IMIA 4CBAA 3FEXC 3BX2A 5HHGE 2BKUB 2JKRB 4RXHB 1W9CA 5H2WA 3TT9A 4PLQA 1M8WA 3IFQA 3K7VA 1EJYI 4LACA 4MFVA 4EV9A 4MZ5E 4R0ZA 4UQIA 3GAEA 3UL0B 5KL1A 5JJAA 3Q0NA 4FDDA 2JKTB 5BZ1A 1TH1A 2IW3A 1QZ7A 2YJYA 2Z5KA 4ADYA 4YGXA 1B3UA 2Z5JA 3Q0OA 1O6PA 3BSXA 2BNXA 4FZFA 3H3DX 3ZIPA 5KL8A 4RV1A 5AEIA 2Z5MA 3EA5B 3Q0QA 3V71A 4MFUA 3QMLC 4O27A 3Q0RA 3LWWA 4FFBC 2F31A 1JPWA 1IB2A 4PVZA 4U5UA 3LTMA 4FZDA 2IWHA 4HXTA 4YJEA 3OBVA 4V3OA 3QGCA 1PJMB 4RZPA 1JDHA 5SVZA 2XA7A 5CTTA 3WYFC 4PLSA 3C2GA 3LTJA 4QMJA 1M8YA 3GS3A 2RU4B 3NMWA 3OQSA 1M5NS 4NEEA 2BAPA 3TJZB 4H3HA 3OPBA 4FZAA 1IQ1C 3V6YA 1M8XA 3GRLA 4U5LA 5SWFA 1I7XA 1OYZA 3K64A 3K61A 2IX3A 4BPLA 5KLTB 1U6GC 5H2XA 1BK6A 1XQSA 3K7WA 4V3QA 3UKYB 4BA3A 3NOWA 3C5WA 1HO8A 2QK1A 1PJNB 3UKZB 4DBAA 4DVGB 2QK2A 4DZSA 3AU3A 3FGAB 2WTKA 1QGKA 5SW9A 4B8PA 1V18A 2QMRA 4ZDUA 4UQIB 2IE3A 5BYMA 4HTVA 4U5OA 1GCJA 4U5NA 5HUYC 3V74A 3ODSA 5FC8E 4EVTA 2JKRA 4NZWA 4JLQA 4P6ZB 2NPPB 1BK5A 3BX3A 4B8JA 3K49A 1EE5A 2NYMA 3O2SA 3QGBA 3GVOA 2IE4A 2NYLB 1Y2AC 4FQ3A 3K62A 3UL1B 3ODRA 4PLRA 1IBRB 2IAEA 4KZGA 3TX7A 4JW2B 3K5QA 1I7WA 3TPMA 1EE4A 5HUWC 4DB9A 1M1EA 5EKFA 4OIHA 1Z2CB
chains in the Genus database with same CATH superfamily
3GVTA 4YK6A 4V3RA 4G3AA 1UKLA 3FEYC 4UAEA 3PSTA 3ZINA 1XM9A 3SL9A 3ZIOA 3RZXA 4CB8A 3W3UA 4A0CA 3OUXA 1QBKB 2YNRA 4QMIA 4Y5JA 1W63A 3NMZA 1LUJA 4B18A 2X19B 5LSWA 4R11A 2YNSA 3UVUA 4EVAA 2GL7A 3L6XA 1TE4A 2QNAA 4P6ZG 3JX7A 4U54A 3QHEA 4D49A 1LSHA 3WPTA 4U3JC 1JPPA 2X1GF 2RU4A 2VGLB 4I5NA 5K6SA 4DB8A 4EVPA 3Q0SA 2C1TA 3OUWA 3NMXA 1UPKA 3DADA 2OF3A 3GNIA 3Q5UA 3BSBA 5B56A 2DB0A 4D4EA 4B8OA 3UJ0A 5CL7A 4QMHA 4MZ6E 5D5KC 3UKWB 5EKGA 3VLFA 3ZHPA 2PKGA 1QGRA 4HM9A 2PF4A 3Q0PA 1WA5C 3KNDA 4YJLA 5KLAA 4K92A 2Q5DA 3A6PA 1G3JA 3EBBA 2OT8A 3BWTA 2H4MA 1XQRA 2Z5OA 4CRUB 3L3FX 5KLRB 4WV6A 4L4HA 1T08A 2Z6HA 2W3CA 3FGAA 5E6QB 3JXZA 3Q0LA 2P8QA 2NYMB 4GMNA 4YI0C 1EJLI 4U58A 1F59A 5CL4A 4CB9A 1UPLA 3GQ2A 2IAEB 4CT7B 3ND2A 3JXYA 5BZVA 4CRVB 2NPPA 4E4VA 3K5YA 4JW3C 4HNMA 4DB6A 2BCTA 2JKTA 3BCTA 4CV5B 4UWXA 3O2QA 4L4IA 2NYLA 1LRVA 3O2TA 2FV2A 1Q1SC 2XOAA 1UN0A 4IMJA 1Q1TC 3K5ZA 4EV8A 3C2HA 4U5VA 3RZ9A 1IALA 4JKQA 3VWAA 4OO6A 4A3TA 2C1MA 2XA7B 3ZIRA 4I2SA 4UADA 4XZRB 4I8MA 3UKXB 1W63B 1WA5B 5K9SA 5CLEA 4L7MA 5EWPA 4K6JA 5DN7A 2Z5NA 3BTRC 5CLCA 4H3KA 3SLAA 4TNMA 3Q0MA 5KUBA 2JAKA 3QG9A 3TJ3A 3ZIQA 1M8ZA 3L3QA 4BQKA 3WOZA 4UAFB 3BVSA 4I2ZA 2JDQA 3L6YA 3DW8A 3K4EA 4U5SA 3ZKVA 3VE6A 2Z6GA 3TPOA 4CT6B 3EG5B 4I1EA 4I2WA 5CL9A 1O6OA 5J3VA 4R10A 3O4XA 4I5LA 3T7UA 5BZUA 2VGLA 4DJSA 3GB8A 3IBVA 3PSPA 5BZ5A 4GMOA 3WOYA 4IMIA 4CBAA 3FEXC 3BX2A 5HHGE 2BKUB 2JKRB 4RXHB 1W9CA 5H2WA 3TT9A 4PLQA 1M8WA 5CL5A 3IFQA 3K7VA 1EJYI 4LACA 4MFVA 4EV9A 4MZ5E 4R0ZA 4UQIA 3GAEA 4I96A 3UL0B 5KL1A 5JJAA 3Q0NA 4FDDA 2JKTB 3UJ4A 5BZ1A 1TH1A 2IW3A 1QZ7A 2YJYA 5CL3A 2Z5KA 4I3NA 3ZIKA 4ADYA 4YGXA 4I37A 1B3UA 2Z5JA 3Q0OA 1O6PA 3BSXA 2BNXA 4FZFA 3H3DX 3ZIPA 5KL8A 4RV1A 5AEIA 2Z5MA 3EA5B 3Q0QA 3V71A 4JW2A 1N4KA 4MFUA 3QMLC 4O27A 3Q0RA 3LWWA 4FFBC 2F31A 1JPWA 4A3VA 5CL8A 1IB2A 4PVZA 4U5UA 3LTMA 4FZDA 2IWHA 4HXTA 4YJEA 3OBVA 4V3OA 4FP7A 3QGCA 1PJMB 4RZPA 1JDHA 5SVZA 2XA7A 5CTTA 3WYFC 4PLSA 3C2GA 3LTJA 4QMJA 1M8YA 3GS3A 2RU4B 4U2XD 3NMWA 3OQSA 1M5NS 4NEEA 2BAPA 3TJZB 4H3HA 3OPBA 4FZAA 1IQ1C 3V6YA 1M8XA 4I0YA 3GRLA 4U5LA 5SWFA 1I7XA 3VLDA 1OYZA 3K64A 3K61A 2IX3A 4BPLA 3ZILA 5KLTB 1U6GC 5H2XA 1BK6A 1XQSA 3K7WA 4V3QA 3UKYB 4BA3A 3NOWA 4I6IA 3JY1A 3C5WA 1HO8A 2QK1A 3UKZB 1PJNB 4DBAA 4DVGB 2QK2A 4DZSA 3AU3A 3FGAB 2WTKA 1QGKA 3VLEA 5CLDA 5SW9A 4B8PA 1V18A 2QMRA 4ZDUA 4UQIB 2IE3A 5BYMA 4HTVA 4U5OA 1GCJA 4U5NA 5HUYC 3V74A 3ODSA 5FC8E 4EVTA 2JKRA 4NZWA 4JLQA 4P6ZB 2NPPB 1BK5A 3BX3A 4B8JA 3K49A 1EE5A 2NYMA 3O2SA 3QGBA 3GVOA 2IE4A 2NYLB 1Y2AC 4FQ3A 3K62A 3UL1B 3ODRA 3T8SA 4PLRA 1IBRB 2IAEA 4KZGA 3TX7A 4JW2B 3K5QA 5CL6A 5CLAA 1I7WA 3TPMA 4I7IA 1EE4A 5HUWC 4DB9A 5CLBA 1M1EA 5EKFA 4OIHA 1Z2CB
chains in the Genus database with same CATH topology
3GVTA 4YK6A 4V3RA 4G3AA 1UKLA 3FEYC 4UAEA 3PSTA 3ZINA 1XM9A 3SL9A 3ZIOA 3RZXA 4CB8A 3W3UA 4A0CA 3OUXA 1QBKB 2YNRA 4QMIA 4Y5JA 1W63A 3NMZA 1LUJA 4B18A 2X19B 5LSWA 4R11A 2YNSA 3UVUA 4EVAA 2GL7A 3L6XA 1TE4A 2QNAA 4P6ZG 3JX7A 4U54A 3QHEA 4D49A 3WPTA 4U3JC 1JPPA 2X1GF 2RU4A 2VGLB 4I5NA 5K6SA 4DB8A 4EVPA 3Q0SA 2C1TA 3OUWA 3NMXA 1UPKA 3DADA 2OF3A 3GNIA 3Q5UA 3BSBA 5B56A 2DB0A 4D4EA 4B8OA 5CL7A 4QMHA 4MZ6E 5D5KC 3UKWB 5EKGA 3VLFA 3ZHPA 2PKGA 1QGRA 4HM9A 2PF4A 3Q0PA 1WA5C 3KNDA 4YJLA 5KLAA 4K92A 2Q5DA 3A6PA 1G3JA 3EBBA 2OT8A 3BWTA 2H4MA 1XQRA 2Z5OA 4CRUB 3L3FX 5KLRB 4WV6A 4L4HA 1T08A 2Z6HA 2W3CA 3FGAA 5E6QB 3JXZA 3Q0LA 2P8QA 2NYMB 4GMNA 4YI0C 1EJLI 4U58A 1F59A 5CL4A 4CB9A 1UPLA 3GQ2A 2IAEB 4CT7B 3ND2A 3JXYA 5BZVA 4CRVB 2NPPA 4E4VA 3K5YA 4JW3C 4HNMA 4DB6A 2BCTA 2JKTA 3BCTA 4CV5B 4UWXA 3O2QA 4L4IA 2NYLA 1LRVA 3O2TA 2FV2A 1Q1SC 2XOAA 1UN0A 4IMJA 1Q1TC 3K5ZA 4EV8A 3C2HA 4U5VA 3RZ9A 1IALA 4JKQA 3VWAA 4OO6A 4A3TA 2C1MA 2XA7B 3ZIRA 4I2SA 4UADA 4XZRB 4I8MA 3UKXB 1W63B 1WA5B 5K9SA 5CLEA 4L7MA 5EWPA 4K6JA 5DN7A 2Z5NA 3BTRC 5CLCA 4H3KA 3SLAA 4TNMA 3Q0MA 5KUBA 2JAKA 3QG9A 3TJ3A 3ZIQA 1M8ZA 3L3QA 4BQKA 3WOZA 4UAFB 3BVSA 4I2ZA 2JDQA 3L6YA 3DW8A 3K4EA 4U5SA 3ZKVA 3VE6A 2Z6GA 3TPOA 4CT6B 3EG5B 4I1EA 4I2WA 5CL9A 1O6OA 5J3VA 4R10A 3O4XA 4I5LA 3T7UA 5BZUA 2VGLA 4DJSA 3GB8A 3IBVA 3PSPA 5BZ5A 3WOYA 4GMOA 4IMIA 4CBAA 3FEXC 3BX2A 5HHGE 2BKUB 2JKRB 4RXHB 1W9CA 5H2WA 3TT9A 4PLQA 1M8WA 5CL5A 3IFQA 3K7VA 1EJYI 4LACA 4MFVA 4EV9A 4MZ5E 4R0ZA 4UQIA 3GAEA 4I96A 3UL0B 5KL1A 5JJAA 3Q0NA 4FDDA 2JKTB 5BZ1A 1TH1A 2IW3A 1QZ7A 2YJYA 5CL3A 2Z5KA 4I3NA 3ZIKA 4ADYA 4YGXA 4I37A 1B3UA 2Z5JA 3Q0OA 1O6PA 3BSXA 2BNXA 4FZFA 3H3DX 3ZIPA 5KL8A 4RV1A 5AEIA 2Z5MA 3EA5B 3Q0QA 3V71A 4JW2A 4MFUA 3QMLC 4O27A 3Q0RA 3LWWA 4FFBC 2F31A 1JPWA 4A3VA 5CL8A 1IB2A 4PVZA 4U5UA 3LTMA 4FZDA 2IWHA 4HXTA 4YJEA 3OBVA 4V3OA 4FP7A 3QGCA 1PJMB 4RZPA 1JDHA 5SVZA 2XA7A 5CTTA 3WYFC 4PLSA 3C2GA 3LTJA 4QMJA 1M8YA 3GS3A 2RU4B 4U2XD 3NMWA 3OQSA 1M5NS 4NEEA 2BAPA 3TJZB 4H3HA 3OPBA 4FZAA 1IQ1C 3V6YA 1M8XA 4I0YA 3GRLA 4U5LA 5SWFA 1I7XA 3VLDA 1OYZA 3K64A 3K61A 2IX3A 4BPLA 3ZILA 5KLTB 1U6GC 5H2XA 1BK6A 1XQSA 3K7WA 4V3QA 3UKYB 4BA3A 3NOWA 4I6IA 3JY1A 3C5WA 1HO8A 2QK1A 1PJNB 3UKZB 4DBAA 4DVGB 2QK2A 4DZSA 3AU3A 3FGAB 2WTKA 1QGKA 3VLEA 5CLDA 5SW9A 4B8PA 1V18A 2QMRA 4ZDUA 4UQIB 2IE3A 5BYMA 4HTVA 4U5OA 1GCJA 4U5NA 5HUYC 3V74A 3ODSA 5FC8E 4EVTA 2JKRA 4NZWA 4JLQA 4P6ZB 2NPPB 1BK5A 3BX3A 4B8JA 3K49A 1EE5A 2NYMA 3O2SA 3QGBA 3GVOA 2IE4A 2NYLB 1Y2AC 4FQ3A 3K62A 3UL1B 3ODRA 4PLRA 1IBRB 2IAEA 4KZGA 3TX7A 4JW2B 3K5QA 5CL6A 5CLAA 1I7WA 3TPMA 4I7IA 1EE4A 5HUWC 4DB9A 5CLBA 1M1EA 5EKFA 4OIHA 1Z2CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GVT A;  4YK6 A;  4V3R A;  4G3A A;  1UKL A;  3FEY C;  4UAE A;  3PST A;  3ZIN A;  1XM9 A;  3ZIO A;  3RZX A;  4CB8 A;  3W3U A;  4A0C A;  3OUX A;  1QBK B;  2YNR A;  4QMI A;  4Y5J A;  1W63 A;  3NMZ A;  1LUJ A;  4B18 A;  2X19 B;  5LSW A;  4R11 A;  2YNS A;  3UVU A;  4EVA A;  2GL7 A;  3L6X A;  2QNA A;  4P6Z G;  4U54 A;  3QHE A;  4D49 A;  3WPT A;  4U3J C;  1JPP A;  2X1G F;  2RU4 A;  2VGL B;  4I5N A;  5K6S A;  4DB8 A;  4EVP A;  3Q0S A;  2C1T A;  3OUW A;  3NMX A;  1UPK A;  3DAD A;  2OF3 A;  3GNI A;  3Q5U A;  3BSB A;  5B56 A;  2DB0 A;  4D4E A;  4B8O A;  4QMH A;  4MZ6 E;  5D5K C;  3UKW B;  5EKG A;  3ZHP A;  2PKG A;  1QGR A;  4HM9 A;  2PF4 A;  3Q0P A;  1WA5 C;  3KND A;  4YJL A;  5KLA A;  4K92 A;  2Q5D A;  3A6P A;  1G3J A;  3EBB A;  2OT8 A;  3BWT A;  2H4M A;  1XQR A;  2Z5O A;  4CRU B;  3L3F X;  5KLR B;  4WV6 A;  1T08 A;  2Z6H A;  2W3C A;  3FGA A;  5E6Q B;  3Q0L A;  2P8Q A;  2NYM B;  4GMN A;  4YI0 C;  1EJL I;  4U58 A;  1F59 A;  4CB9 A;  1UPL A;  3GQ2 A;  2IAE B;  4CT7 B;  3ND2 A;  5BZV A;  4CRV B;  2NPP A;  4E4V A;  3K5Y A;  4DB6 A;  4HNM A;  2BCT A;  2JKT A;  3BCT A;  4CV5 B;  4UWX A;  3O2Q A;  2NYL A;  1LRV A;  3O2T A;  2FV2 A;  1Q1S C;  1UN0 A;  4IMJ A;  1Q1T C;  3K5Z A;  4EV8 A;  3C2H A;  4U5V A;  3RZ9 A;  1IAL A;  3VWA A;  4OO6 A;  2C1M A;  2XA7 B;  3ZIR A;  4UAD A;  4XZR B;  3UKX B;  1W63 B;  1WA5 B;  5K9S A;  4L7M A;  5EWP A;  4K6J A;  5DN7 A;  2Z5N A;  3BTR C;  4H3K A;  4TNM A;  3Q0M A;  2JAK A;  3QG9 A;  3TJ3 A;  3ZIQ A;  1M8Z A;  3L3Q A;  4BQK A;  3WOZ A;  4UAF B;  4I2Z A;  2JDQ A;  3L6Y A;  3DW8 A;  3K4E A;  4U5S A;  3ZKV A;  3VE6 A;  2Z6G A;  3TPO A;  4CT6 B;  3EG5 B;  4I2W A;  1O6O A;  5J3V A;  4R10 A;  3O4X A;  4I5L A;  3T7U A;  5BZU A;  2VGL A;  4DJS A;  3GB8 A;  3IBV A;  3PSP A;  5BZ5 A;  3WOY A;  4GMO A;  4IMI A;  4CBA A;  3FEX C;  3BX2 A;  5HHG E;  2BKU B;  2JKR B;  4RXH B;  1W9C A;  5H2W A;  3TT9 A;  4PLQ A;  1M8W A;  3IFQ A;  3K7V A;  1EJY I;  4LAC A;  4MFV A;  4EV9 A;  4MZ5 E;  4R0Z A;  4UQI A;  3GAE A;  3UL0 B;  5KL1 A;  5JJA A;  3Q0N A;  4FDD A;  2JKT B;  5BZ1 A;  1TH1 A;  2IW3 A;  1QZ7 A;  2YJY A;  2Z5K A;  4ADY A;  4YGX A;  1B3U A;  2Z5J A;  3Q0O A;  1O6P A;  3BSX A;  2BNX A;  4FZF A;  3H3D X;  3ZIP A;  5KL8 A;  4RV1 A;  5AEI A;  2Z5M A;  3EA5 B;  3Q0Q A;  3V71 A;  4MFU A;  3QML C;  4O27 A;  3Q0R A;  3LWW A;  4FFB C;  2F31 A;  1JPW A;  1IB2 A;  4PVZ A;  4U5U A;  3LTM A;  4FZD A;  2IWH A;  4HXT A;  4YJE A;  3OBV A;  4V3O A;  3QGC A;  1PJM B;  4RZP A;  1JDH A;  5SVZ A;  2XA7 A;  5CTT A;  3WYF C;  4PLS A;  3C2G A;  3LTJ A;  4QMJ A;  1M8Y A;  3GS3 A;  2RU4 B;  3NMW A;  3OQS A;  1M5N S;  4NEE A;  2BAP A;  3TJZ B;  4H3H A;  3OPB A;  4FZA A;  1IQ1 C;  3V6Y A;  1M8X A;  3GRL A;  4U5L A;  5SWF A;  1I7X A;  1OYZ A;  3K64 A;  3K61 A;  2IX3 A;  4BPL A;  5KLT B;  1U6G C;  5H2X A;  1BK6 A;  1XQS A;  3K7W A;  4V3Q A;  3UKY B;  4BA3 A;  3NOW A;  3C5W A;  1HO8 A;  2QK1 A;  1PJN B;  3UKZ B;  4DBA A;  4DVG B;  2QK2 A;  4DZS A;  3AU3 A;  3FGA B;  2WTK A;  1QGK A;  5SW9 A;  4B8P A;  1V18 A;  2QMR A;  4ZDU A;  4UQI B;  2IE3 A;  5BYM A;  4HTV A;  4U5O A;  1GCJ A;  4U5N A;  5HUY C;  3V74 A;  3ODS A;  5FC8 E;  4EVT A;  2JKR A;  4NZW A;  4JLQ A;  4P6Z B;  2NPP B;  1BK5 A;  3BX3 A;  4B8J A;  3K49 A;  1EE5 A;  2NYM A;  3O2S A;  3QGB A;  3GVO A;  2IE4 A;  2NYL B;  1Y2A C;  4FQ3 A;  3K62 A;  3UL1 B;  3ODR A;  4PLR A;  1IBR B;  2IAE A;  4KZG A;  3TX7 A;  4JW2 B;  3K5Q A;  1I7W A;  3TPM A;  1EE4 A;  5HUW C;  4DB9 A;  1M1E A;  5EKF A;  4OIH A;  1Z2C B; 
#chains in the Genus database with same CATH topology
 3GVT A;  4YK6 A;  4V3R A;  4G3A A;  1UKL A;  3FEY C;  4UAE A;  3PST A;  3ZIN A;  1XM9 A;  3SL9 A;  3ZIO A;  3RZX A;  4CB8 A;  3W3U A;  4A0C A;  3OUX A;  1QBK B;  2YNR A;  4QMI A;  4Y5J A;  1W63 A;  3NMZ A;  1LUJ A;  4B18 A;  2X19 B;  5LSW A;  4R11 A;  2YNS A;  3UVU A;  4EVA A;  2GL7 A;  3L6X A;  1TE4 A;  2QNA A;  4P6Z G;  3JX7 A;  4U54 A;  3QHE A;  4D49 A;  1LSH A;  3WPT A;  4U3J C;  1JPP A;  2X1G F;  2RU4 A;  2VGL B;  4I5N A;  5K6S A;  4DB8 A;  4EVP A;  3Q0S A;  2C1T A;  3OUW A;  3NMX A;  1UPK A;  3DAD A;  2OF3 A;  3GNI A;  3Q5U A;  3BSB A;  5B56 A;  2DB0 A;  4D4E A;  4B8O A;  3UJ0 A;  5CL7 A;  4QMH A;  4MZ6 E;  5D5K C;  3UKW B;  5EKG A;  3VLF A;  3ZHP A;  2PKG A;  1QGR A;  4HM9 A;  2PF4 A;  3Q0P A;  1WA5 C;  3KND A;  4YJL A;  5KLA A;  4K92 A;  2Q5D A;  3A6P A;  1G3J A;  3EBB A;  2OT8 A;  3BWT A;  2H4M A;  1XQR A;  2Z5O A;  4CRU B;  3L3F X;  5KLR B;  4WV6 A;  4L4H A;  1T08 A;  2Z6H A;  2W3C A;  3FGA A;  5E6Q B;  3JXZ A;  3Q0L A;  2P8Q A;  2NYM B;  4GMN A;  4YI0 C;  1EJL I;  4U58 A;  1F59 A;  5CL4 A;  4CB9 A;  1UPL A;  3GQ2 A;  2IAE B;  4CT7 B;  3ND2 A;  3JXY A;  5BZV A;  4CRV B;  2NPP A;  4E4V A;  3K5Y A;  4JW3 C;  4HNM A;  4DB6 A;  2BCT A;  2JKT A;  3BCT A;  4CV5 B;  4UWX A;  3O2Q A;  4L4I A;  2NYL A;  1LRV A;  3O2T A;  2FV2 A;  1Q1S C;  2XOA A;  1UN0 A;  4IMJ A;  1Q1T C;  3K5Z A;  4EV8 A;  3C2H A;  4U5V A;  3RZ9 A;  1IAL A;  4JKQ A;  3VWA A;  4OO6 A;  4A3T A;  2C1M A;  2XA7 B;  3ZIR A;  4I2S A;  4UAD A;  4XZR B;  4I8M A;  3UKX B;  1W63 B;  1WA5 B;  5K9S A;  5CLE A;  4L7M A;  5EWP A;  4K6J A;  5DN7 A;  2Z5N A;  3BTR C;  5CLC A;  4H3K A;  3SLA A;  4TNM A;  3Q0M A;  5KUB A;  2JAK A;  3QG9 A;  3TJ3 A;  3ZIQ A;  1M8Z A;  3L3Q A;  4BQK A;  3WOZ A;  4UAF B;  3BVS A;  4I2Z A;  2JDQ A;  3L6Y A;  3DW8 A;  3K4E A;  4U5S A;  3ZKV A;  3VE6 A;  2Z6G A;  3TPO A;  4CT6 B;  3EG5 B;  4I1E A;  4I2W A;  5CL9 A;  1O6O A;  5J3V A;  4R10 A;  3O4X A;  4I5L A;  3T7U A;  5BZU A;  2VGL A;  4DJS A;  3GB8 A;  3IBV A;  3PSP A;  5BZ5 A;  4GMO A;  3WOY A;  4IMI A;  4CBA A;  3FEX C;  3BX2 A;  5HHG E;  2BKU B;  2JKR B;  4RXH B;  1W9C A;  5H2W A;  3TT9 A;  4PLQ A;  1M8W A;  5CL5 A;  3IFQ A;  3K7V A;  1EJY I;  4LAC A;  4MFV A;  4EV9 A;  4MZ5 E;  4R0Z A;  4UQI A;  3GAE A;  4I96 A;  3UL0 B;  5KL1 A;  5JJA A;  3Q0N A;  4FDD A;  2JKT B;  3UJ4 A;  5BZ1 A;  1TH1 A;  2IW3 A;  1QZ7 A;  2YJY A;  5CL3 A;  2Z5K A;  4I3N A;  3ZIK A;  4ADY A;  4YGX A;  4I37 A;  1B3U A;  2Z5J A;  3Q0O A;  1O6P A;  3BSX A;  2BNX A;  4FZF A;  3H3D X;  3ZIP A;  5KL8 A;  4RV1 A;  5AEI A;  2Z5M A;  3EA5 B;  3Q0Q A;  3V71 A;  4JW2 A;  1N4K A;  4MFU A;  3QML C;  4O27 A;  3Q0R A;  3LWW A;  4FFB C;  2F31 A;  1JPW A;  4A3V A;  5CL8 A;  1IB2 A;  4PVZ A;  4U5U A;  3LTM A;  4FZD A;  2IWH A;  4HXT A;  4YJE A;  3OBV A;  4V3O A;  4FP7 A;  3QGC A;  1PJM B;  4RZP A;  1JDH A;  5SVZ A;  2XA7 A;  5CTT A;  3WYF C;  4PLS A;  3C2G A;  3LTJ A;  4QMJ A;  1M8Y A;  3GS3 A;  2RU4 B;  4U2X D;  3NMW A;  3OQS A;  1M5N S;  4NEE A;  2BAP A;  3TJZ B;  4H3H A;  3OPB A;  4FZA A;  1IQ1 C;  3V6Y A;  1M8X A;  4I0Y A;  3GRL A;  4U5L A;  5SWF A;  1I7X A;  3VLD A;  1OYZ A;  3K64 A;  3K61 A;  2IX3 A;  4BPL A;  3ZIL A;  5KLT B;  1U6G C;  5H2X A;  1BK6 A;  1XQS A;  3K7W A;  4V3Q A;  3UKY B;  4BA3 A;  3NOW A;  4I6I A;  3JY1 A;  3C5W A;  1HO8 A;  2QK1 A;  3UKZ B;  1PJN B;  4DBA A;  4DVG B;  2QK2 A;  4DZS A;  3AU3 A;  3FGA B;  2WTK A;  1QGK A;  3VLE A;  5CLD A;  5SW9 A;  4B8P A;  1V18 A;  2QMR A;  4ZDU A;  4UQI B;  2IE3 A;  5BYM A;  4HTV A;  4U5O A;  1GCJ A;  4U5N A;  5HUY C;  3V74 A;  3ODS A;  5FC8 E;  4EVT A;  2JKR A;  4NZW A;  4JLQ A;  4P6Z B;  2NPP B;  1BK5 A;  3BX3 A;  4B8J A;  3K49 A;  1EE5 A;  2NYM A;  3O2S A;  3QGB A;  3GVO A;  2IE4 A;  2NYL B;  1Y2A C;  4FQ3 A;  3K62 A;  3UL1 B;  3ODR A;  3T8S A;  4PLR A;  1IBR B;  2IAE A;  4KZG A;  3TX7 A;  4JW2 B;  3K5Q A;  5CL6 A;  5CLA A;  1I7W A;  3TPM A;  4I7I A;  1EE4 A;  5HUW C;  4DB9 A;  5CLB A;  1M1E A;  5EKF A;  4OIH A;  1Z2C B; 
#chains in the Genus database with same CATH homology
 3GVT A;  4YK6 A;  4V3R A;  4G3A A;  1UKL A;  3FEY C;  4UAE A;  3PST A;  3ZIN A;  1XM9 A;  3SL9 A;  3ZIO A;  3RZX A;  4CB8 A;  3W3U A;  4A0C A;  3OUX A;  1QBK B;  2YNR A;  4QMI A;  4Y5J A;  1W63 A;  3NMZ A;  1LUJ A;  4B18 A;  2X19 B;  5LSW A;  4R11 A;  2YNS A;  3UVU A;  4EVA A;  2GL7 A;  3L6X A;  1TE4 A;  2QNA A;  4P6Z G;  3JX7 A;  4U54 A;  3QHE A;  4D49 A;  3WPT A;  4U3J C;  1JPP A;  2X1G F;  2RU4 A;  2VGL B;  4I5N A;  5K6S A;  4DB8 A;  4EVP A;  3Q0S A;  2C1T A;  3OUW A;  3NMX A;  1UPK A;  3DAD A;  2OF3 A;  3GNI A;  3Q5U A;  3BSB A;  5B56 A;  2DB0 A;  4D4E A;  4B8O A;  5CL7 A;  4QMH A;  4MZ6 E;  5D5K C;  3UKW B;  5EKG A;  3VLF A;  3ZHP A;  2PKG A;  1QGR A;  4HM9 A;  2PF4 A;  3Q0P A;  1WA5 C;  3KND A;  4YJL A;  5KLA A;  4K92 A;  2Q5D A;  3A6P A;  1G3J A;  3EBB A;  2OT8 A;  3BWT A;  2H4M A;  1XQR A;  2Z5O A;  4CRU B;  3L3F X;  5KLR B;  4WV6 A;  4L4H A;  1T08 A;  2Z6H A;  2W3C A;  3FGA A;  5E6Q B;  3JXZ A;  3Q0L A;  2P8Q A;  2NYM B;  4GMN A;  4YI0 C;  1EJL I;  4U58 A;  1F59 A;  5CL4 A;  4CB9 A;  1UPL A;  3GQ2 A;  2IAE B;  4CT7 B;  3ND2 A;  3JXY A;  5BZV A;  4CRV B;  2NPP A;  4E4V A;  3K5Y A;  4JW3 C;  4HNM A;  4DB6 A;  2BCT A;  2JKT A;  3BCT A;  4CV5 B;  4UWX A;  3O2Q A;  4L4I A;  2NYL A;  1LRV A;  3O2T A;  2FV2 A;  1Q1S C;  2XOA A;  1UN0 A;  4IMJ A;  1Q1T C;  3K5Z A;  4EV8 A;  3C2H A;  4U5V A;  3RZ9 A;  1IAL A;  4JKQ A;  3VWA A;  4OO6 A;  4A3T A;  2C1M A;  2XA7 B;  3ZIR A;  4I2S A;  4UAD A;  4XZR B;  4I8M A;  3UKX B;  1W63 B;  1WA5 B;  5K9S A;  5CLE A;  4L7M A;  5EWP A;  4K6J A;  5DN7 A;  2Z5N A;  3BTR C;  5CLC A;  4H3K A;  3SLA A;  4TNM A;  3Q0M A;  5KUB A;  2JAK A;  3QG9 A;  3TJ3 A;  3ZIQ A;  1M8Z A;  3L3Q A;  4BQK A;  3WOZ A;  4UAF B;  3BVS A;  4I2Z A;  2JDQ A;  3L6Y A;  3DW8 A;  3K4E A;  4U5S A;  3ZKV A;  3VE6 A;  2Z6G A;  3TPO A;  4CT6 B;  3EG5 B;  4I1E A;  4I2W A;  5CL9 A;  1O6O A;  5J3V A;  4R10 A;  3O4X A;  4I5L A;  3T7U A;  5BZU A;  2VGL A;  4DJS A;  3GB8 A;  3IBV A;  3PSP A;  5BZ5 A;  3WOY A;  4GMO A;  4IMI A;  4CBA A;  3FEX C;  3BX2 A;  5HHG E;  2BKU B;  2JKR B;  4RXH B;  1W9C A;  5H2W A;  3TT9 A;  4PLQ A;  1M8W A;  5CL5 A;  3IFQ A;  3K7V A;  1EJY I;  4LAC A;  4MFV A;  4EV9 A;  4MZ5 E;  4R0Z A;  4UQI A;  3GAE A;  4I96 A;  3UL0 B;  5KL1 A;  5JJA A;  3Q0N A;  4FDD A;  2JKT B;  5BZ1 A;  1TH1 A;  2IW3 A;  1QZ7 A;  2YJY A;  5CL3 A;  2Z5K A;  4I3N A;  3ZIK A;  4ADY A;  4YGX A;  4I37 A;  1B3U A;  2Z5J A;  3Q0O A;  1O6P A;  3BSX A;  2BNX A;  4FZF A;  3H3D X;  3ZIP A;  5KL8 A;  4RV1 A;  5AEI A;  2Z5M A;  3EA5 B;  3Q0Q A;  3V71 A;  4JW2 A;  4MFU A;  3QML C;  4O27 A;  3Q0R A;  3LWW A;  4FFB C;  2F31 A;  1JPW A;  4A3V A;  5CL8 A;  1IB2 A;  4PVZ A;  4U5U A;  3LTM A;  4FZD A;  2IWH A;  4HXT A;  4YJE A;  3OBV A;  4V3O A;  4FP7 A;  3QGC A;  1PJM B;  4RZP A;  1JDH A;  5SVZ A;  2XA7 A;  5CTT A;  3WYF C;  4PLS A;  3C2G A;  3LTJ A;  4QMJ A;  1M8Y A;  3GS3 A;  2RU4 B;  4U2X D;  3NMW A;  3OQS A;  1M5N S;  4NEE A;  2BAP A;  3TJZ B;  4H3H A;  3OPB A;  4FZA A;  1IQ1 C;  3V6Y A;  1M8X A;  4I0Y A;  3GRL A;  4U5L A;  5SWF A;  1I7X A;  3VLD A;  1OYZ A;  3K64 A;  3K61 A;  2IX3 A;  4BPL A;  3ZIL A;  5KLT B;  1U6G C;  5H2X A;  1BK6 A;  1XQS A;  3K7W A;  4V3Q A;  3UKY B;  4BA3 A;  3NOW A;  4I6I A;  3JY1 A;  3C5W A;  1HO8 A;  2QK1 A;  1PJN B;  3UKZ B;  4DBA A;  4DVG B;  2QK2 A;  4DZS A;  3AU3 A;  3FGA B;  2WTK A;  1QGK A;  3VLE A;  5CLD A;  5SW9 A;  4B8P A;  1V18 A;  2QMR A;  4ZDU A;  4UQI B;  2IE3 A;  5BYM A;  4HTV A;  4U5O A;  1GCJ A;  4U5N A;  5HUY C;  3V74 A;  3ODS A;  5FC8 E;  4EVT A;  2JKR A;  4NZW A;  4JLQ A;  4P6Z B;  2NPP B;  1BK5 A;  3BX3 A;  4B8J A;  3K49 A;  1EE5 A;  2NYM A;  3O2S A;  3QGB A;  3GVO A;  2IE4 A;  2NYL B;  1Y2A C;  4FQ3 A;  3K62 A;  3UL1 B;  3ODR A;  4PLR A;  1IBR B;  2IAE A;  4KZG A;  3TX7 A;  4JW2 B;  3K5Q A;  5CL6 A;  5CLA A;  1I7W A;  3TPM A;  4I7I A;  1EE4 A;  5HUW C;  4DB9 A;  5CLB A;  1M1E A;  5EKF A;  4OIH A;  1Z2C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...