3ODSA

Crystal structure of the k185a mutant of the n-terminal domain of human symplekin
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
320
structure length
320
Chain Sequence
MTTSERVVDLLNQAALITNDSKITVLKQVQELIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRDENVNVVKKAILTMTQLYKVALQWMVKSRVISELQEACWDMVSAMAGDIILLLDSDNDGIRTHAIAFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLWEEGKAALEQLLKFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKNLKLHLLSVLKHPASLEFQAQITTLLVDLGTPQAEIARNMPSSKDTRKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Symplekin
publication title Crystal structure of the human symplekin-Ssu72-CTD phosphopeptide complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 122
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11935 DUF3453 Domain of unknown function (DUF3453)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3odsA00
4U58A 4UAEA 4WV6A 4YK6A 1M5NS 1QGKA 4U5UA 3GNIA 4FFBC 3UKZB 2Z5MA 3FEYC 1Q1TC 3QGBA 5K9SA 2JKRB 3Q0RA 4DB6A 4EVAA 3GVOA 4YGXA 4R10A 4CB8A 2NYLA 4UWXA 2Z5KA 4U54A 3BTRC 4BA3A 1O6OA 1IBRB 5KL8A 2JKTA 1PJNB 5KLAA 1XQRA 5HUWC 4KZGA 1UKLA 3Q0LA 4TNMA 5HUYC 4I2WA 2VGLB 4UQIA 1LUJA 4Y5JA 1T08A 4FDDA 3VWAA 5BZ5A 3DW8A 3LWWA 4OIHA 1Q1SC 1Z2CB 4CRVB 3C2HA 1M8YA 4V3QA 3PSTA 3IBVA 3V6YA 1U6GC 4FZAA 4L7MA 4PLQA 1GCJA 4YJLA 3L3FX 4CT7B 1EE5A 3FGAB 4JW2B 2YNSA 2OT8A 1XM9A 3O2SA 3L3QA 3NMZA 2BCTA 4B8OA 5LSWA 1G3JA 1OYZA 1JPPA 1LRVA 1M1EA 4A0CA 2IAEA 4EV8A 1W63A 3VE6A 5BYMA 2IX3A 5KLRB 1UPKA 3K49A 2PF4A 4V3OA 2X1GF 3OPBA 1UPLA 3EA5B 3L6XA 4H3KA 2Z6GA 2XA7A 3UKWB 5EWPA 4CT6B 3TPMA 3ZINA 4RZPA 1QGRA 5SW9A 4U3JC 3QGCA 5EKFA 3ND2A 2F31A 3WPTA 2NYMB 3C2GA 4G3AA 2NYMA 3WOZA 1F59A 1PJMB 3Q0MA 5D5KC 5K6SA 4MZ6E 1XQSA 3K7VA 4K92A 3NOWA 4CRUB 4RXHB 4FZDA 3Q5UA 1JDHA 2BKUB 4IMIA 3Q0PA 2PKGA 4H3HA 5FC8E 3EBBA 3K64A 4U5VA 5KL1A 2NYLB 2WTKA 2Z5OA 3BWTA 5EKGA 3V74A 3UKYB 4EVTA 1TH1A 2QK2A 2JKTB 3OQSA 2NPPB 5J3VA 2NPPA 3ZHPA 3ZIOA 3BSBA 3OUWA 4DB8A 3K5YA 4UQIB 4V3RA 2YJYA 4YJEA 1EE4A 4MFUA 5KLTB 3UKXB 5H2WA 1IALA 3NMWA 4U5SA 2RU4A 1M8WA 1QZ7A 3K4EA 2BNXA 4FZFA 5SWFA 1IQ1C 3GB8A 5B56A 3NMXA 4K6JA 4E4VA 3TX7A 4I5NA 5HHGE 4PLSA 4U5LA 3PSPA 4D4EA 5BZ1A 2X19B 1I7XA 2JDQA 3EG5B 4DVGB 3ZIQA 3GS3A 2IAEB 3FEXC 4I2ZA 1W63B 4DZSA 5CTTA 3LTMA 3GQ2A 4MFVA 4HTVA 4CV5B 3KNDA 5JJAA 3O2QA 3IFQA 3RZXA 3UVUA 2OF3A 2IWHA 1I7WA 2P8QA 3ZIRA 4QMHA 2XA7B 4QMJA 2Z5NA 3O2TA 3C5WA 5H2XA 3UL1B 3ODRA 4RV1A 4PLRA 4OO6A 3TJ3A 4R11A 4UAFB 4P6ZG 3QHEA 3K5ZA 3H3DX 2Q5DA 2FV2A 4HNMA 3BX3A 4BQKA 4QMIA 3OBVA 3TPOA 4CB9A 4B8PA 3ZKVA 1QBKB 4JLQA 5BZVA 3BX2A 5E6QB 2W3CA 4HM9A 4I5LA 3T7UA 4GMNA 3LTJA 3BCTA 3DADA 4CBAA 4GMOA 2JKRA 3K61A 3V71A 2Z6HA 2C1MA 1M8ZA 3K7WA 4FQ3A 3BSXA 4O27A 3QG9A 3TT9A 2RU4B 4R0ZA 1WA5C 2QNAA 4YI0C 1EJYI 3Q0QA 1EJLI 3A6PA 1O6PA 2JAKA 4IMJA 3Q0SA 4HXTA 3GRLA 4ZDUA 5SVZA 4NEEA 4BPLA 2VGLA 4UADA 2IE3A 2H4MA 3K62A 1IB2A 1Y2AC 2GL7A 5BZUA 2DB0A 3L6YA 3W3UA 2C1TA 1JPWA 4P6ZB 3K5QA 3RZ9A 4EV9A 4D49A 4U5OA 3FGAA 1BK6A 3ODSA 4U5NA 3WOYA 1B3UA 2IW3A 3UL0B 2YNRA 2BAPA 3AU3A 5DN7A 1V18A 3OUXA 3QMLC 3ZIPA 3Q0OA 3GAEA 3Q0NA 2QMRA 4ADYA 2IE4A 1WA5B 2Z5JA 4MZ5E 1W9CA 4PVZA 4NZWA 4DJSA 1UN0A 2QK1A 4LACA 3WYFC 4DB9A 1BK5A 1HO8A 3O4XA 3GVTA 1M8XA 3TJZB 4B8JA 4XZRB 5AEIA 4DBAA 4EVPA 4B18A
chains in the Genus database with same CATH superfamily
4U58A 4UAEA 4WV6A 4YK6A 1M5NS 5CLDA 1QGKA 4U5UA 3GNIA 4FFBC 4JW3C 3UKZB 2Z5MA 3FEYC 1Q1TC 3QGBA 5K9SA 2JKRB 3Q0RA 4DB6A 4EVAA 3GVOA 4YGXA 4R10A 4CB8A 2NYLA 4UWXA 2Z5KA 4U54A 3BTRC 4BA3A 1O6OA 1IBRB 5KL8A 2JKTA 5CL6A 1PJNB 5KLAA 1XQRA 5HUWC 4KZGA 1UKLA 3Q0LA 4TNMA 5HUYC 3VLDA 4I2WA 2VGLB 4UQIA 1LUJA 3JXZA 4Y5JA 1T08A 4FDDA 3VWAA 5BZ5A 3DW8A 3LWWA 4OIHA 1Q1SC 1Z2CB 4CRVB 3C2HA 1M8YA 4V3QA 3PSTA 3IBVA 3V6YA 1U6GC 4FZAA 4L7MA 4PLQA 1GCJA 4YJLA 5CLCA 3L3FX 4CT7B 1EE5A 3FGAB 4JW2B 2YNSA 2OT8A 1XM9A 3O2SA 5CL7A 3L3QA 3NMZA 2BCTA 4B8OA 5LSWA 1G3JA 1OYZA 1JPPA 1LRVA 1M1EA 4A0CA 1LSHA 4L4IA 2IAEA 4EV8A 1W63A 3VE6A 5BYMA 2IX3A 5CL8A 5KLRB 3JXYA 1UPKA 3K49A 2PF4A 4V3OA 2X1GF 3OPBA 1UPLA 3EA5B 3L6XA 4H3KA 3JY1A 2Z6GA 2XA7A 3UKWB 5EWPA 4CT6B 3TPMA 3ZINA 4RZPA 1QGRA 5SW9A 4U3JC 3QGCA 5EKFA 3ND2A 2F31A 3WPTA 2NYMB 3C2GA 4G3AA 2NYMA 3WOZA 1F59A 1PJMB 3Q0MA 5D5KC 5K6SA 4MZ6E 1XQSA 3K7VA 4K92A 3NOWA 4CRUB 4L4HA 4RXHB 4FZDA 3Q5UA 1JDHA 2BKUB 4IMIA 3Q0PA 2PKGA 4H3HA 5FC8E 3EBBA 3K64A 4U5VA 5KL1A 2NYLB 2WTKA 2Z5OA 3BWTA 5EKGA 3V74A 3UKYB 5CL3A 4EVTA 5CLAA 1TH1A 2QK2A 2JKTB 3OQSA 2NPPB 5KUBA 5J3VA 2NPPA 3ZHPA 3ZIOA 3BSBA 3OUWA 4DB8A 3K5YA 4UQIB 4V3RA 3UJ0A 2YJYA 4YJEA 5CLEA 1EE4A 4MFUA 5KLTB 3UKXB 5H2WA 1IALA 3NMWA 4U5SA 2RU4A 1M8WA 1QZ7A 3K4EA 2BNXA 4FZFA 5SWFA 1N4KA 1IQ1C 3GB8A 5B56A 3NMXA 4K6JA 4E4VA 4I2SA 3TX7A 4I5NA 5HHGE 4PLSA 4U5LA 3PSPA 4D4EA 5BZ1A 2X19B 1I7XA 2JDQA 3EG5B 4DVGB 3ZIQA 3GS3A 2IAEB 3FEXC 3BVSA 4I2ZA 1W63B 4DZSA 5CTTA 3LTMA 3GQ2A 4MFVA 4HTVA 4CV5B 3KNDA 5JJAA 3O2QA 3IFQA 3RZXA 3UVUA 2OF3A 2IWHA 1I7WA 2P8QA 3ZIRA 4QMHA 2XA7B 4QMJA 5CL5A 2Z5NA 3O2TA 3C5WA 5H2XA 4I6IA 3UL1B 3ODRA 4RV1A 4PLRA 4OO6A 3TJ3A 4R11A 4I0YA 5CL9A 4UAFB 4P6ZG 3QHEA 2XOAA 3SLAA 5CLBA 3K5ZA 3H3DX 2Q5DA 2FV2A 4HNMA 3BX3A 4FP7A 4BQKA 4QMIA 3OBVA 3TPOA 4CB9A 4B8PA 3ZKVA 1QBKB 4JLQA 5BZVA 3BX2A 5E6QB 2W3CA 4HM9A 4I7IA 4I5LA 3T7UA 4GMNA 3LTJA 3BCTA 3DADA 4I3NA 4CBAA 4GMOA 2JKRA 3K61A 3V71A 3VLFA 2Z6HA 2C1MA 1M8ZA 3K7WA 4FQ3A 3BSXA 4O27A 3QG9A 3TT9A 2RU4B 4R0ZA 3ZIKA 1WA5C 2QNAA 4YI0C 1EJYI 3Q0QA 1EJLI 4I96A 3A6PA 1O6PA 2JAKA 4IMJA 3UJ4A 3Q0SA 4HXTA 3GRLA 4ZDUA 5SVZA 4NEEA 4BPLA 2VGLA 4UADA 2IE3A 2H4MA 3K62A 4I1EA 1IB2A 1Y2AC 2GL7A 5BZUA 2DB0A 3L6YA 3W3UA 4U2XD 2C1TA 1JPWA 3VLEA 4A3VA 4P6ZB 3T8SA 3K5QA 3RZ9A 4EV9A 4D49A 4U5OA 3FGAA 4JKQA 4A3TA 1BK6A 3ODSA 4U5NA 4JW2A 3WOYA 3SL9A 1B3UA 2IW3A 3UL0B 2YNRA 1TE4A 3JX7A 4I37A 4I8MA 2BAPA 3AU3A 5DN7A 1V18A 3OUXA 3QMLC 3ZIPA 3Q0OA 3GAEA 3Q0NA 2QMRA 4ADYA 2IE4A 1WA5B 2Z5JA 4MZ5E 1W9CA 4PVZA 4NZWA 4DJSA 1UN0A 2QK1A 4LACA 3WYFC 4DB9A 1BK5A 1HO8A 3O4XA 5CL4A 3GVTA 3ZILA 1M8XA 3TJZB 4B8JA 4XZRB 5AEIA 4DBAA 4EVPA 4B18A
chains in the Genus database with same CATH topology
4U58A 4UAEA 4WV6A 4YK6A 1M5NS 5CLDA 1QGKA 4U5UA 3GNIA 4FFBC 4JW3C 3UKZB 2Z5MA 3FEYC 1Q1TC 3QGBA 5K9SA 2JKRB 3Q0RA 4DB6A 4EVAA 3GVOA 4YGXA 4R10A 4CB8A 2NYLA 4UWXA 2Z5KA 4U54A 3BTRC 4BA3A 1O6OA 1IBRB 5KL8A 2JKTA 5CL6A 1PJNB 5KLAA 1XQRA 5HUWC 4KZGA 1UKLA 3Q0LA 4TNMA 5HUYC 3VLDA 4I2WA 2VGLB 4UQIA 1LUJA 3JXZA 4Y5JA 1T08A 4FDDA 3VWAA 5BZ5A 3DW8A 3LWWA 4OIHA 1Q1SC 1Z2CB 4CRVB 3C2HA 1M8YA 4V3QA 3PSTA 3IBVA 3V6YA 1U6GC 4FZAA 4L7MA 4PLQA 1GCJA 4YJLA 5CLCA 3L3FX 4CT7B 1EE5A 3FGAB 4JW2B 2YNSA 2OT8A 1XM9A 3O2SA 5CL7A 3L3QA 3NMZA 2BCTA 4B8OA 5LSWA 1G3JA 1OYZA 1JPPA 1LRVA 1M1EA 4A0CA 4L4IA 2IAEA 4EV8A 1W63A 3VE6A 5BYMA 2IX3A 5CL8A 5KLRB 3JXYA 1UPKA 3K49A 2PF4A 4V3OA 2X1GF 3OPBA 1UPLA 3EA5B 3L6XA 4H3KA 3JY1A 2Z6GA 2XA7A 3UKWB 5EWPA 4CT6B 3TPMA 3ZINA 4RZPA 1QGRA 5SW9A 4U3JC 3QGCA 5EKFA 3ND2A 2F31A 3WPTA 2NYMB 3C2GA 4G3AA 2NYMA 3WOZA 1F59A 1PJMB 3Q0MA 5D5KC 5K6SA 4MZ6E 1XQSA 3K7VA 4K92A 3NOWA 4CRUB 4L4HA 4RXHB 4FZDA 3Q5UA 1JDHA 2BKUB 4IMIA 3Q0PA 2PKGA 4H3HA 5FC8E 3EBBA 3K64A 4U5VA 5KL1A 2NYLB 2WTKA 2Z5OA 3BWTA 5EKGA 3V74A 3UKYB 5CL3A 4EVTA 5CLAA 1TH1A 2QK2A 2JKTB 3OQSA 2NPPB 5KUBA 5J3VA 2NPPA 3ZHPA 3ZIOA 3BSBA 3OUWA 4DB8A 3K5YA 4UQIB 4V3RA 2YJYA 4YJEA 5CLEA 1EE4A 4MFUA 5KLTB 3UKXB 5H2WA 1IALA 3NMWA 4U5SA 2RU4A 1M8WA 1QZ7A 3K4EA 2BNXA 4FZFA 5SWFA 1IQ1C 3GB8A 5B56A 3NMXA 4K6JA 4E4VA 4I2SA 3TX7A 4I5NA 5HHGE 4PLSA 4U5LA 3PSPA 4D4EA 5BZ1A 2X19B 1I7XA 2JDQA 3EG5B 4DVGB 3ZIQA 3GS3A 2IAEB 3FEXC 3BVSA 4I2ZA 1W63B 4DZSA 5CTTA 3LTMA 3GQ2A 4MFVA 4HTVA 4CV5B 3KNDA 5JJAA 3O2QA 3IFQA 3RZXA 3UVUA 2OF3A 2IWHA 1I7WA 2P8QA 3ZIRA 4QMHA 2XA7B 4QMJA 5CL5A 2Z5NA 3O2TA 3C5WA 5H2XA 4I6IA 3UL1B 3ODRA 4RV1A 4PLRA 4OO6A 3TJ3A 4R11A 4I0YA 5CL9A 4UAFB 4P6ZG 3QHEA 2XOAA 3SLAA 5CLBA 3K5ZA 3H3DX 2Q5DA 2FV2A 4HNMA 3BX3A 4FP7A 4BQKA 4QMIA 3OBVA 3TPOA 4CB9A 4B8PA 3ZKVA 1QBKB 4JLQA 5BZVA 3BX2A 5E6QB 2W3CA 4HM9A 4I7IA 4I5LA 3T7UA 4GMNA 3LTJA 3BCTA 3DADA 4I3NA 4CBAA 4GMOA 2JKRA 3K61A 3V71A 3VLFA 2Z6HA 2C1MA 1M8ZA 3K7WA 4FQ3A 3BSXA 4O27A 3QG9A 3TT9A 2RU4B 4R0ZA 3ZIKA 1WA5C 2QNAA 4YI0C 1EJYI 3Q0QA 1EJLI 4I96A 3A6PA 1O6PA 2JAKA 4IMJA 3Q0SA 4HXTA 3GRLA 4ZDUA 5SVZA 4NEEA 4BPLA 2VGLA 4UADA 2IE3A 2H4MA 3K62A 4I1EA 1IB2A 1Y2AC 2GL7A 5BZUA 2DB0A 3L6YA 3W3UA 4U2XD 2C1TA 1JPWA 3VLEA 4A3VA 4P6ZB 3K5QA 3RZ9A 4EV9A 4D49A 4U5OA 3FGAA 4JKQA 4A3TA 1BK6A 3ODSA 4U5NA 4JW2A 3WOYA 3SL9A 1B3UA 2IW3A 3UL0B 2YNRA 1TE4A 3JX7A 4I37A 4I8MA 2BAPA 3AU3A 5DN7A 1V18A 3OUXA 3QMLC 3ZIPA 3Q0OA 3GAEA 3Q0NA 2QMRA 4ADYA 2IE4A 1WA5B 2Z5JA 4MZ5E 1W9CA 4PVZA 4NZWA 4DJSA 1UN0A 2QK1A 4LACA 3WYFC 4DB9A 1BK5A 1HO8A 3O4XA 5CL4A 3GVTA 3ZILA 1M8XA 3TJZB 4B8JA 4XZRB 5AEIA 4DBAA 4EVPA 4B18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U58 A;  4UAE A;  4WV6 A;  4YK6 A;  1M5N S;  1QGK A;  4U5U A;  3GNI A;  4FFB C;  3UKZ B;  2Z5M A;  3FEY C;  1Q1T C;  3QGB A;  5K9S A;  2JKR B;  3Q0R A;  4DB6 A;  4EVA A;  3GVO A;  4YGX A;  4R10 A;  4CB8 A;  2NYL A;  4UWX A;  2Z5K A;  4U54 A;  3BTR C;  4BA3 A;  1O6O A;  1IBR B;  5KL8 A;  2JKT A;  1PJN B;  5KLA A;  1XQR A;  5HUW C;  4KZG A;  1UKL A;  3Q0L A;  4TNM A;  5HUY C;  4I2W A;  2VGL B;  4UQI A;  1LUJ A;  4Y5J A;  1T08 A;  4FDD A;  3VWA A;  5BZ5 A;  3DW8 A;  3LWW A;  4OIH A;  1Q1S C;  1Z2C B;  4CRV B;  3C2H A;  1M8Y A;  4V3Q A;  3PST A;  3IBV A;  3V6Y A;  1U6G C;  4FZA A;  4L7M A;  4PLQ A;  1GCJ A;  4YJL A;  3L3F X;  4CT7 B;  1EE5 A;  3FGA B;  4JW2 B;  2YNS A;  2OT8 A;  1XM9 A;  3O2S A;  3L3Q A;  3NMZ A;  2BCT A;  4B8O A;  5LSW A;  1G3J A;  1OYZ A;  1JPP A;  1LRV A;  1M1E A;  4A0C A;  2IAE A;  4EV8 A;  1W63 A;  3VE6 A;  5BYM A;  2IX3 A;  5KLR B;  1UPK A;  3K49 A;  2PF4 A;  4V3O A;  2X1G F;  3OPB A;  1UPL A;  3EA5 B;  3L6X A;  4H3K A;  2Z6G A;  2XA7 A;  3UKW B;  5EWP A;  4CT6 B;  3TPM A;  3ZIN A;  4RZP A;  1QGR A;  5SW9 A;  4U3J C;  3QGC A;  5EKF A;  3ND2 A;  2F31 A;  3WPT A;  2NYM B;  3C2G A;  4G3A A;  2NYM A;  3WOZ A;  1F59 A;  1PJM B;  3Q0M A;  5D5K C;  5K6S A;  4MZ6 E;  1XQS A;  3K7V A;  4K92 A;  3NOW A;  4CRU B;  4RXH B;  4FZD A;  3Q5U A;  1JDH A;  2BKU B;  4IMI A;  3Q0P A;  2PKG A;  4H3H A;  5FC8 E;  3EBB A;  3K64 A;  4U5V A;  5KL1 A;  2NYL B;  2WTK A;  2Z5O A;  3BWT A;  5EKG A;  3V74 A;  3UKY B;  4EVT A;  1TH1 A;  2QK2 A;  2JKT B;  3OQS A;  2NPP B;  5J3V A;  2NPP A;  3ZHP A;  3ZIO A;  3BSB A;  3OUW A;  4DB8 A;  3K5Y A;  4UQI B;  4V3R A;  2YJY A;  4YJE A;  1EE4 A;  4MFU A;  5KLT B;  3UKX B;  5H2W A;  1IAL A;  3NMW A;  4U5S A;  2RU4 A;  1M8W A;  1QZ7 A;  3K4E A;  2BNX A;  4FZF A;  5SWF A;  1IQ1 C;  3GB8 A;  5B56 A;  3NMX A;  4K6J A;  4E4V A;  3TX7 A;  4I5N A;  5HHG E;  4PLS A;  4U5L A;  3PSP A;  4D4E A;  5BZ1 A;  2X19 B;  1I7X A;  2JDQ A;  3EG5 B;  4DVG B;  3ZIQ A;  3GS3 A;  2IAE B;  3FEX C;  4I2Z A;  1W63 B;  4DZS A;  5CTT A;  3LTM A;  3GQ2 A;  4MFV A;  4HTV A;  4CV5 B;  3KND A;  5JJA A;  3O2Q A;  3IFQ A;  3RZX A;  3UVU A;  2OF3 A;  2IWH A;  1I7W A;  2P8Q A;  3ZIR A;  4QMH A;  2XA7 B;  4QMJ A;  2Z5N A;  3O2T A;  3C5W A;  5H2X A;  3UL1 B;  3ODR A;  4RV1 A;  4PLR A;  4OO6 A;  3TJ3 A;  4R11 A;  4UAF B;  4P6Z G;  3QHE A;  3K5Z A;  3H3D X;  2Q5D A;  2FV2 A;  4HNM A;  3BX3 A;  4BQK A;  4QMI A;  3OBV A;  3TPO A;  4CB9 A;  4B8P A;  3ZKV A;  1QBK B;  4JLQ A;  5BZV A;  3BX2 A;  5E6Q B;  2W3C A;  4HM9 A;  4I5L A;  3T7U A;  4GMN A;  3LTJ A;  3BCT A;  3DAD A;  4CBA A;  4GMO A;  2JKR A;  3K61 A;  3V71 A;  2Z6H A;  2C1M A;  1M8Z A;  3K7W A;  4FQ3 A;  3BSX A;  4O27 A;  3QG9 A;  3TT9 A;  2RU4 B;  4R0Z A;  1WA5 C;  2QNA A;  4YI0 C;  1EJY I;  3Q0Q A;  1EJL I;  3A6P A;  1O6P A;  2JAK A;  4IMJ A;  3Q0S A;  4HXT A;  3GRL A;  4ZDU A;  5SVZ A;  4NEE A;  4BPL A;  2VGL A;  4UAD A;  2IE3 A;  2H4M A;  3K62 A;  1IB2 A;  1Y2A C;  2GL7 A;  5BZU A;  2DB0 A;  3L6Y A;  3W3U A;  2C1T A;  1JPW A;  4P6Z B;  3K5Q A;  3RZ9 A;  4EV9 A;  4D49 A;  4U5O A;  3FGA A;  1BK6 A;  3ODS A;  4U5N A;  3WOY A;  1B3U A;  2IW3 A;  3UL0 B;  2YNR A;  2BAP A;  3AU3 A;  5DN7 A;  1V18 A;  3OUX A;  3QML C;  3ZIP A;  3Q0O A;  3GAE A;  3Q0N A;  2QMR A;  4ADY A;  2IE4 A;  1WA5 B;  2Z5J A;  4MZ5 E;  1W9C A;  4PVZ A;  4NZW A;  4DJS A;  1UN0 A;  2QK1 A;  4LAC A;  3WYF C;  4DB9 A;  1BK5 A;  1HO8 A;  3O4X A;  3GVT A;  1M8X A;  3TJZ B;  4B8J A;  4XZR B;  5AEI A;  4DBA A;  4EVP A;  4B18 A; 
#chains in the Genus database with same CATH topology
 4U58 A;  4UAE A;  4WV6 A;  4YK6 A;  1M5N S;  5CLD A;  1QGK A;  4U5U A;  3GNI A;  4FFB C;  4JW3 C;  3UKZ B;  2Z5M A;  3FEY C;  1Q1T C;  3QGB A;  5K9S A;  2JKR B;  3Q0R A;  4DB6 A;  4EVA A;  3GVO A;  4YGX A;  4R10 A;  4CB8 A;  2NYL A;  4UWX A;  2Z5K A;  4U54 A;  3BTR C;  4BA3 A;  1O6O A;  1IBR B;  5KL8 A;  2JKT A;  5CL6 A;  1PJN B;  5KLA A;  1XQR A;  5HUW C;  4KZG A;  1UKL A;  3Q0L A;  4TNM A;  5HUY C;  3VLD A;  4I2W A;  2VGL B;  4UQI A;  1LUJ A;  3JXZ A;  4Y5J A;  1T08 A;  4FDD A;  3VWA A;  5BZ5 A;  3DW8 A;  3LWW A;  4OIH A;  1Q1S C;  1Z2C B;  4CRV B;  3C2H A;  1M8Y A;  4V3Q A;  3PST A;  3IBV A;  3V6Y A;  1U6G C;  4FZA A;  4L7M A;  4PLQ A;  1GCJ A;  4YJL A;  5CLC A;  3L3F X;  4CT7 B;  1EE5 A;  3FGA B;  4JW2 B;  2YNS A;  2OT8 A;  1XM9 A;  3O2S A;  5CL7 A;  3L3Q A;  3NMZ A;  2BCT A;  4B8O A;  5LSW A;  1G3J A;  1OYZ A;  1JPP A;  1LRV A;  1M1E A;  4A0C A;  1LSH A;  4L4I A;  2IAE A;  4EV8 A;  1W63 A;  3VE6 A;  5BYM A;  2IX3 A;  5CL8 A;  5KLR B;  3JXY A;  1UPK A;  3K49 A;  2PF4 A;  4V3O A;  2X1G F;  3OPB A;  1UPL A;  3EA5 B;  3L6X A;  4H3K A;  3JY1 A;  2Z6G A;  2XA7 A;  3UKW B;  5EWP A;  4CT6 B;  3TPM A;  3ZIN A;  4RZP A;  1QGR A;  5SW9 A;  4U3J C;  3QGC A;  5EKF A;  3ND2 A;  2F31 A;  3WPT A;  2NYM B;  3C2G A;  4G3A A;  2NYM A;  3WOZ A;  1F59 A;  1PJM B;  3Q0M A;  5D5K C;  5K6S A;  4MZ6 E;  1XQS A;  3K7V A;  4K92 A;  3NOW A;  4CRU B;  4L4H A;  4RXH B;  4FZD A;  3Q5U A;  1JDH A;  2BKU B;  4IMI A;  3Q0P A;  2PKG A;  4H3H A;  5FC8 E;  3EBB A;  3K64 A;  4U5V A;  5KL1 A;  2NYL B;  2WTK A;  2Z5O A;  3BWT A;  5EKG A;  3V74 A;  3UKY B;  5CL3 A;  4EVT A;  5CLA A;  1TH1 A;  2QK2 A;  2JKT B;  3OQS A;  2NPP B;  5KUB A;  5J3V A;  2NPP A;  3ZHP A;  3ZIO A;  3BSB A;  3OUW A;  4DB8 A;  3K5Y A;  4UQI B;  4V3R A;  3UJ0 A;  2YJY A;  4YJE A;  5CLE A;  1EE4 A;  4MFU A;  5KLT B;  3UKX B;  5H2W A;  1IAL A;  3NMW A;  4U5S A;  2RU4 A;  1M8W A;  1QZ7 A;  3K4E A;  2BNX A;  4FZF A;  5SWF A;  1N4K A;  1IQ1 C;  3GB8 A;  5B56 A;  3NMX A;  4K6J A;  4E4V A;  4I2S A;  3TX7 A;  4I5N A;  5HHG E;  4PLS A;  4U5L A;  3PSP A;  4D4E A;  5BZ1 A;  2X19 B;  1I7X A;  2JDQ A;  3EG5 B;  4DVG B;  3ZIQ A;  3GS3 A;  2IAE B;  3FEX C;  3BVS A;  4I2Z A;  1W63 B;  4DZS A;  5CTT A;  3LTM A;  3GQ2 A;  4MFV A;  4HTV A;  4CV5 B;  3KND A;  5JJA A;  3O2Q A;  3IFQ A;  3RZX A;  3UVU A;  2OF3 A;  2IWH A;  1I7W A;  2P8Q A;  3ZIR A;  4QMH A;  2XA7 B;  4QMJ A;  5CL5 A;  2Z5N A;  3O2T A;  3C5W A;  5H2X A;  4I6I A;  3UL1 B;  3ODR A;  4RV1 A;  4PLR A;  4OO6 A;  3TJ3 A;  4R11 A;  4I0Y A;  5CL9 A;  4UAF B;  4P6Z G;  3QHE A;  2XOA A;  3SLA A;  5CLB A;  3K5Z A;  3H3D X;  2Q5D A;  2FV2 A;  4HNM A;  3BX3 A;  4FP7 A;  4BQK A;  4QMI A;  3OBV A;  3TPO A;  4CB9 A;  4B8P A;  3ZKV A;  1QBK B;  4JLQ A;  5BZV A;  3BX2 A;  5E6Q B;  2W3C A;  4HM9 A;  4I7I A;  4I5L A;  3T7U A;  4GMN A;  3LTJ A;  3BCT A;  3DAD A;  4I3N A;  4CBA A;  4GMO A;  2JKR A;  3K61 A;  3V71 A;  3VLF A;  2Z6H A;  2C1M A;  1M8Z A;  3K7W A;  4FQ3 A;  3BSX A;  4O27 A;  3QG9 A;  3TT9 A;  2RU4 B;  4R0Z A;  3ZIK A;  1WA5 C;  2QNA A;  4YI0 C;  1EJY I;  3Q0Q A;  1EJL I;  4I96 A;  3A6P A;  1O6P A;  2JAK A;  4IMJ A;  3UJ4 A;  3Q0S A;  4HXT A;  3GRL A;  4ZDU A;  5SVZ A;  4NEE A;  4BPL A;  2VGL A;  4UAD A;  2IE3 A;  2H4M A;  3K62 A;  4I1E A;  1IB2 A;  1Y2A C;  2GL7 A;  5BZU A;  2DB0 A;  3L6Y A;  3W3U A;  4U2X D;  2C1T A;  1JPW A;  3VLE A;  4A3V A;  4P6Z B;  3T8S A;  3K5Q A;  3RZ9 A;  4EV9 A;  4D49 A;  4U5O A;  3FGA A;  4JKQ A;  4A3T A;  1BK6 A;  3ODS A;  4U5N A;  4JW2 A;  3WOY A;  3SL9 A;  1B3U A;  2IW3 A;  3UL0 B;  2YNR A;  1TE4 A;  3JX7 A;  4I37 A;  4I8M A;  2BAP A;  3AU3 A;  5DN7 A;  1V18 A;  3OUX A;  3QML C;  3ZIP A;  3Q0O A;  3GAE A;  3Q0N A;  2QMR A;  4ADY A;  2IE4 A;  1WA5 B;  2Z5J A;  4MZ5 E;  1W9C A;  4PVZ A;  4NZW A;  4DJS A;  1UN0 A;  2QK1 A;  4LAC A;  3WYF C;  4DB9 A;  1BK5 A;  1HO8 A;  3O4X A;  5CL4 A;  3GVT A;  3ZIL A;  1M8X A;  3TJZ B;  4B8J A;  4XZR B;  5AEI A;  4DBA A;  4EVP A;  4B18 A; 
#chains in the Genus database with same CATH homology
 4U58 A;  4UAE A;  4WV6 A;  4YK6 A;  1M5N S;  5CLD A;  1QGK A;  4U5U A;  3GNI A;  4FFB C;  4JW3 C;  3UKZ B;  2Z5M A;  3FEY C;  1Q1T C;  3QGB A;  5K9S A;  2JKR B;  3Q0R A;  4DB6 A;  4EVA A;  3GVO A;  4YGX A;  4R10 A;  4CB8 A;  2NYL A;  4UWX A;  2Z5K A;  4U54 A;  3BTR C;  4BA3 A;  1O6O A;  1IBR B;  5KL8 A;  2JKT A;  5CL6 A;  1PJN B;  5KLA A;  1XQR A;  5HUW C;  4KZG A;  1UKL A;  3Q0L A;  4TNM A;  5HUY C;  3VLD A;  4I2W A;  2VGL B;  4UQI A;  1LUJ A;  3JXZ A;  4Y5J A;  1T08 A;  4FDD A;  3VWA A;  5BZ5 A;  3DW8 A;  3LWW A;  4OIH A;  1Q1S C;  1Z2C B;  4CRV B;  3C2H A;  1M8Y A;  4V3Q A;  3PST A;  3IBV A;  3V6Y A;  1U6G C;  4FZA A;  4L7M A;  4PLQ A;  1GCJ A;  4YJL A;  5CLC A;  3L3F X;  4CT7 B;  1EE5 A;  3FGA B;  4JW2 B;  2YNS A;  2OT8 A;  1XM9 A;  3O2S A;  5CL7 A;  3L3Q A;  3NMZ A;  2BCT A;  4B8O A;  5LSW A;  1G3J A;  1OYZ A;  1JPP A;  1LRV A;  1M1E A;  4A0C A;  4L4I A;  2IAE A;  4EV8 A;  1W63 A;  3VE6 A;  5BYM A;  2IX3 A;  5CL8 A;  5KLR B;  3JXY A;  1UPK A;  3K49 A;  2PF4 A;  4V3O A;  2X1G F;  3OPB A;  1UPL A;  3EA5 B;  3L6X A;  4H3K A;  3JY1 A;  2Z6G A;  2XA7 A;  3UKW B;  5EWP A;  4CT6 B;  3TPM A;  3ZIN A;  4RZP A;  1QGR A;  5SW9 A;  4U3J C;  3QGC A;  5EKF A;  3ND2 A;  2F31 A;  3WPT A;  2NYM B;  3C2G A;  4G3A A;  2NYM A;  3WOZ A;  1F59 A;  1PJM B;  3Q0M A;  5D5K C;  5K6S A;  4MZ6 E;  1XQS A;  3K7V A;  4K92 A;  3NOW A;  4CRU B;  4L4H A;  4RXH B;  4FZD A;  3Q5U A;  1JDH A;  2BKU B;  4IMI A;  3Q0P A;  2PKG A;  4H3H A;  5FC8 E;  3EBB A;  3K64 A;  4U5V A;  5KL1 A;  2NYL B;  2WTK A;  2Z5O A;  3BWT A;  5EKG A;  3V74 A;  3UKY B;  5CL3 A;  4EVT A;  5CLA A;  1TH1 A;  2QK2 A;  2JKT B;  3OQS A;  2NPP B;  5KUB A;  5J3V A;  2NPP A;  3ZHP A;  3ZIO A;  3BSB A;  3OUW A;  4DB8 A;  3K5Y A;  4UQI B;  4V3R A;  2YJY A;  4YJE A;  5CLE A;  1EE4 A;  4MFU A;  5KLT B;  3UKX B;  5H2W A;  1IAL A;  3NMW A;  4U5S A;  2RU4 A;  1M8W A;  1QZ7 A;  3K4E A;  2BNX A;  4FZF A;  5SWF A;  1IQ1 C;  3GB8 A;  5B56 A;  3NMX A;  4K6J A;  4E4V A;  4I2S A;  3TX7 A;  4I5N A;  5HHG E;  4PLS A;  4U5L A;  3PSP A;  4D4E A;  5BZ1 A;  2X19 B;  1I7X A;  2JDQ A;  3EG5 B;  4DVG B;  3ZIQ A;  3GS3 A;  2IAE B;  3FEX C;  3BVS A;  4I2Z A;  1W63 B;  4DZS A;  5CTT A;  3LTM A;  3GQ2 A;  4MFV A;  4HTV A;  4CV5 B;  3KND A;  5JJA A;  3O2Q A;  3IFQ A;  3RZX A;  3UVU A;  2OF3 A;  2IWH A;  1I7W A;  2P8Q A;  3ZIR A;  4QMH A;  2XA7 B;  4QMJ A;  5CL5 A;  2Z5N A;  3O2T A;  3C5W A;  5H2X A;  4I6I A;  3UL1 B;  3ODR A;  4RV1 A;  4PLR A;  4OO6 A;  3TJ3 A;  4R11 A;  4I0Y A;  5CL9 A;  4UAF B;  4P6Z G;  3QHE A;  2XOA A;  3SLA A;  5CLB A;  3K5Z A;  3H3D X;  2Q5D A;  2FV2 A;  4HNM A;  3BX3 A;  4FP7 A;  4BQK A;  4QMI A;  3OBV A;  3TPO A;  4CB9 A;  4B8P A;  3ZKV A;  1QBK B;  4JLQ A;  5BZV A;  3BX2 A;  5E6Q B;  2W3C A;  4HM9 A;  4I7I A;  4I5L A;  3T7U A;  4GMN A;  3LTJ A;  3BCT A;  3DAD A;  4I3N A;  4CBA A;  4GMO A;  2JKR A;  3K61 A;  3V71 A;  3VLF A;  2Z6H A;  2C1M A;  1M8Z A;  3K7W A;  4FQ3 A;  3BSX A;  4O27 A;  3QG9 A;  3TT9 A;  2RU4 B;  4R0Z A;  3ZIK A;  1WA5 C;  2QNA A;  4YI0 C;  1EJY I;  3Q0Q A;  1EJL I;  4I96 A;  3A6P A;  1O6P A;  2JAK A;  4IMJ A;  3Q0S A;  4HXT A;  3GRL A;  4ZDU A;  5SVZ A;  4NEE A;  4BPL A;  2VGL A;  4UAD A;  2IE3 A;  2H4M A;  3K62 A;  4I1E A;  1IB2 A;  1Y2A C;  2GL7 A;  5BZU A;  2DB0 A;  3L6Y A;  3W3U A;  4U2X D;  2C1T A;  1JPW A;  3VLE A;  4A3V A;  4P6Z B;  3K5Q A;  3RZ9 A;  4EV9 A;  4D49 A;  4U5O A;  3FGA A;  4JKQ A;  4A3T A;  1BK6 A;  3ODS A;  4U5N A;  4JW2 A;  3WOY A;  3SL9 A;  1B3U A;  2IW3 A;  3UL0 B;  2YNR A;  1TE4 A;  3JX7 A;  4I37 A;  4I8M A;  2BAP A;  3AU3 A;  5DN7 A;  1V18 A;  3OUX A;  3QML C;  3ZIP A;  3Q0O A;  3GAE A;  3Q0N A;  2QMR A;  4ADY A;  2IE4 A;  1WA5 B;  2Z5J A;  4MZ5 E;  1W9C A;  4PVZ A;  4NZW A;  4DJS A;  1UN0 A;  2QK1 A;  4LAC A;  3WYF C;  4DB9 A;  1BK5 A;  1HO8 A;  3O4X A;  5CL4 A;  3GVT A;  3ZIL A;  1M8X A;  3TJZ B;  4B8J A;  4XZR B;  5AEI A;  4DBA A;  4EVP A;  4B18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...